Antibodies that specifically bind alpha klotho

11143661 · 2021-10-12

Assignee

Inventors

Cpc classification

International classification

Abstract

An antibody and/or binding fragment thereof, wherein the antibody and/or binding fragment thereof comprises a light chain variable region and a heavy chain variable region, the light chain variable region comprising complementarity determining region (CDR) CDR-L3 and the heavy chain variable region comprising CDR-H1, CDR-H2 and CDR-H3, with the amino acid sequences of said CDRs comprising one or more of the sequences set forth below: CDR-L3; selected from any one of SEQ ID NOs: 123, 126-130, 142, 148 or 149; CDR-H1: SEQ ID NOs: 121 or 124; CDR-H2; SEQ ID NOs: 122 or 125; and/or CDR-H3: selected from any one of SEQ ID NOs: 196-226.

Claims

1. An antibody or binding fragment thereof that specifically binds an αKlotho polypeptide, wherein the antibody or binding fragment thereof comprises: a light chain variable (VL) domain, wherein the VL domain comprises a complementarity determining region (CDR) L1, a CDR-L2 and a CDR-L3; and a heavy chain variable (VH) domain, wherein the VH domain comprises a CDR-H1, a CDR-H2 and a CDR-H3; and wherein the VL and VH domains are selected from the group consisting of: (i) a VL domain wherein the CDR-L1, the CDR-L2 and the CDR-L3 comprise amino acid sequences: QSVSSA (SEQ ID NO: 140), SAS (SEQ ID NO: 141), and QQYSYYYASPIT (SEQ ID NO: 155), respectively; and  a VH domain wherein the CDR-H1, the CDR-H2 and the CDR-H3 comprise amino acid sequences: GFNIYSSS (residues 1 to 8 of SEQ ID NO: 173), IYPYSGYT (residues 2 to 9 of SEQ ID NO: 193), and ARYSWGSSFWPGYGFDY (SEQ ID NO: 223), respectively; (ii) a VL domain wherein the CDR-L1, the CDR-L2 and the CDR-L3 comprise amino acid sequences: QSVSSA (SEQ ID NO: 140), SAS (SEQ ID NO: 141), and QQYSWYWYSPIT (SEQ ID NO: 154), respectively; and  a VH domain wherein the CDR-H1, the CDR-H2 and the CDR-H3 comprise amino acid sequences: GFNIYYSS (residues 1 to 8 of SEQ ID NO: 172), IYPYYSYT (residues 2 to 9 of SEQ ID NO: 192), and ARSVASALDY (SEQ ID NO: 222), respectively; (iii) a VL domain wherein the CDR-L1, the CDR-L2 and the CDR-L3 comprise amino acid sequences: QSVSSA (SEQ ID NO: 140), SAS (SEQ ID NO: 141), and QQGSYYWWSPIT (SEQ ID NO: 150), respectively, and  a VH domain wherein the CDR-H1, the CDR-H2 and the CDR-H3 comprise amino acid sequences: GFNIYSYS (residues 1 to 8 of SEQ ID NO: 169), IYPSSSYT (residues 2 to 9 of SEQ ID NO: 185), and ARAGYFSAYYSSWGAMDY (SEQ ID NO: 211), respectively; and (iv) a VL domain wherein the CDR-L1, the CDR-L2 and the CDR-L3 comprise amino acid sequences: QSVSSA (SEQ ID NO: 140), SAS (SEQ ID NO: 141), and QQSSPPIT (SEQ ID NO: 148), respectively; and  a VH domain wherein the CDR-H1, the CDR-H2 and the CDR-H3 comprise amino acid sequences: GFNLYSYS (residues 1 to 8 of SEQ ID NO: 167), ISPYSGYT (residues 2 to 9 of SEQ ID NO: 184), and ARSFFPYSYWVYGGGMDY (SEQ ID NO: 206), respectively.

2. The antibody or binding fragment thereof of claim 1, wherein the antibody or binding fragment thereof is selected from the group consisting of a monoclonal antibody, an inmunoglobulin molecule, a Fab, a Fab′, a F(ab)2, aF(ab′)2, a Fv, a disulfide-linked Fv, a scFv, a disulfide-linked scFv, a single-chain domain antibody, scFab, a diabody, a dimer, a minibody, a bispecific antibody fragment, a chimeric antibody, a humanized antibody and a polyclonal antibody.

3. The antibody or binding fragment thereof of claim 1, wherein the αKlotho polypeptide is a mammalian αKlotho polypeptide.

4. The antibody or binding fragment thereof of claim 3, wherein the mammalian αKlotho polypeptide is human αKlotho polypeptide.

5. The antibody or binding fragment thereof of claim 1, wherein the αKlotho polypeptide is a folded αKlotho polypeptide or a soluble αKlotho polypeptide.

6. The antibody or binding fragment thereof of claim 5, wherein the antibody or binding fragment thereof binds a soluble folded αKlotho polypeptide found in urine, plasma, and/or serum.

7. The antibody or binding fragment thereof of claim 1, wherein the antibody or binding fragment thereof binds a complex comprising a folded αKlotho polypeptide.

8. The antibody or binding fragment thereof according to claim 7, wherein the folded αKlotho polypeptide forms a complex with a fibroblast growth factor (FGF) receptor, optionally FGFR1c.

9. An antibody complex comprising the antibody or binding fragment thereof of claim 1 and an αKlotho polypeptide, optionally further comprising FGFR1c.

10. A composition comprising the antibody or binding fragment thereof of claim 1.

11. A kit comprising an antibody or binding fragment thereof that specifically binds an αKlotho polypeptide, and a reference agent, wherein the antibody or binding fragment thereof comprises: a light chain variable (VL) domain, wherein the VL domain comprises a complementarity determining region (CDR) L1, a CDR-L2 and a CDR-L3; and a heavy chain variable (VH) domain, wherein the VH domain comprises a CDR-H1, a CDR-H2 and a CDR-H3; and wherein the VL and VH domains are selected from the group consisting of: (i) a VL domain wherein the CDR-L1, the CDR-L2 and the CDR-L3 comprise amino acid sequences: QSVSSA (SEQ ID NO: 140), SAS (SEQ ID NO: 141), and QQYSYYYASPIT (SEQ ID NO: 155), respectively; and  a VH domain wherein the CDR-H1, the CDR-H2 and the CDR-H3 comprise amino acid sequences: GFNIYSSS (residues 1 to 8 of SEQ ID NO: 173), IYPYSGYT (residues 2 to 9 of SEQ ID NO: 193), and ARYSWGSSFWPGYGFDY (SEQ ID NO: 223), respectively; (ii) a VL domain wherein the CDR-L1, the CDR-L2 and the CDR-L3 comprise amino acid sequences: QSVSSA (SEQ ID NO: 140), SAS (SEQ ID NO: 141), and QQYSWYWYSPIT (SEQ ID NO: 154), respectively; and  a VH domain wherein the CDR-H1, the CDR-H2 and the CDR-H3 comprise amino acid sequences: GFNIYYSS (residues 1 to 8 of SEQ ID NO: 172), IYPYYSYT (residues 2 to 9 of SEQ ID NO: 192), and ARSVASALDY (SEQ ID NO: 222), respectively; (iii) a VL domain wherein the CDR-L1, the CDR-L2 and the CDR-L3 comprise amino acid sequences: QSVSSA (SEQ ID NO: 140), SAS (SEQ ID NO: 141), and QQGSYYWWSPIT (SEQ ID NO: 150), respectively, and  a VH domain wherein the CDR-H1, the CDR-H2 and the CDR-H3 comprise amino acid sequences: GFNIYSYS (residues 1 to 8 of SEQ ID NO: 169), IYPSSSYT (residues 2 to 9 of SEQ ID NO: 185), and ARAGYFSAYYSSWGAMDY (SEQ ID NO: 211), respectively; (iv) a VL domain wherein the CDR-L1, the CDR-L2 and the CDR-L3 comprise amino acid sequences: QSVSSA (SEQ ID NO: 140), SAS (SEQ ID NO: 141), and QQSSPPIT (SEQ ID NO: 148), respectively; and  a VH domain wherein the CDR-H1, the CDR-H2 and the CDR-H3 comprise amino acid sequences: GFNLYSYS (residues 1 to 8 of SEQ ID NO: 167), ISPYSGYT (residues 2 to 9 of SEQ ID NO: 184), and ARSFFPYSYWVYGGGMDY (SEQ ID NO: 206), respectively.

12. The kit of claim 11, wherein the kit further comprises a) instructions for use thereof and/or b) an antibody or binding fragment having light and heavy chain variable regions comprising the amino acid sequences of SEQ ID NO: 11 and 12, respectively.

13. An antibody or binding fragment thereof that specifically binds an αKlotho polypeptide, wherein the antibody or binding fragment thereof comprises: a light chain variable (VL) domain, wherein the VL domain comprises a complementarity determining region (CDR) L1, a CDR-L2 and a CDR-L3, and wherein the CDR-L1, the CDR-L2 and the CDR-L3 comprise the amino acid sequences QSVSSA (SEQ ID NO: 140), SAS (SEQ ID NO: 141), and QQYSYYYASPIT (SEQ ID NO: 155), respectively; and a heavy chain variable (VH) domain, wherein the VH domain comprises a CDR-H1, a CDR-H2 and a CDR-H3; and wherein the CDR-H1, the CDR-H2 and the CDR-H3 comprise amino acid sequences GFNIYSSS (residues 1 to 8 of SEQ ID NO: 173), IYPYSGYT (residues 2 to 9 of SEQ ID NO: 193), and ARYSWGSSFWPGYGFDY (SEQ ID NO: 223), respectively.

14. The antibody or binding fragment thereof of claim 13, wherein the amino acids at international ImMunoGeneTics database (IMGT) positions 39, 55 and 66 of the VH domain are Ile, Ser and Tyr, respectively.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) An embodiment of the present disclosure will now be described in relation to the drawings in which:

(2) FIG. 1 shows the sequence, specificity and affinity of sb106. (A) CDR sequences and VH domain framework region residues variable in Library F for anti-αKlotho sb106, according to the IMGT (international ImMunoGeneTics database) numbering scheme. IMGT CDR residues are underlined, IMGT framework region residues are not underlined, residues at IMGT positions which were randomized in the selection library are bold. (B) Specificity determination of anti-αKlotho sb106 by Fab-phage ELISA: sb106 Fab-phage were incubated with the following immobilized antigens: a complex of FGFR1c/αKlotho complex (aKL-R1), FGFR1c alone (R1), human αKlotho (Hu aKL) and mouse αKlotho (Mu aKL), or neutravidin (NA) and bovine serum albumin (BSA) as negative controls. After washing off unbound phage, bound phages were detected using an HRP-conjugated anti-phage antibody. Colorimetric HRP reagents allow for absorbance readings at 450 nm. (C) Estimation of affinity by competitive Fab-phage ELISA. sb106 Fab-phage were pre-incubated with 50, 5, 0.5, 0.05, 0.005 and 0.0005 nM soluble human αKlotho. The binding signals to immobilized human αKlotho reported are an average of two data sets. The reduction in binding to immobilized αKlotho is indicative of the fraction bound to soluble αKlotho, thus a 50% reduction in signal occurs when the soluble αKlotho concentration is approximately equal to the K.sub.D of the interaction.

(3) FIG. 2 shows the characterization of sb106-Fab by immunoblot, immunohistochemistry and immunocytochemistry. (A) Immunoblot of kidney lysate from wild type mice (WT), homozygous αKlotho hypomorphic mice (kl/kl) and transgenic αKlotho overexpressing mice (Tg-KI), using the monoclonal antibody KM2076 or the sb106-Fab. GAPDH: Glyceraldehyde phosphate dehydrogenase. (B) Immunoblot of lysates from normal rat kidney (NRK) cells, human embryonic kidney (HEK) cells, and HEK cells transfected with a plasmid for over-expression of αKlotho, using the monoclonal antibody KM2076 or the sb106-Fab. (C) Fresh or fixed rat parathyroid tissue probed with phalloidin for β-actin or sb106-IgG. (D) sb106 immunostaining of HEK293T cells transfected with a vector control, or vector for over-expression for αKlotho or βKlotho. Representative cells are shown. The DAPI nuclear staining is labeled “N”. (scale bar, 10 μm). αKlotho staining with Fab sb106 was only observed in cells transfected with αKlotho and not in cell transfected with βKlotho.

(4) FIG. 3 shows the characterization of sb106-Fab by immunoprecipitation. (A) HEK293 cells were transfected with empty vector or varying quantities (g/dish) of vector for expression of transmembrane full length αKlotho (TM-αKlotho) or soluble extracellular domain of αKlotho with a C-terminal FLAG epitope (s-αKlotho-FLAG). Cell lysates or cell culture medium was immunoprecipitated (IP) with either sb106-Fab or anti-FLAG MAb. Immunocomplexes were resolved by SDS-PAGE and immunoblotted (IB) with monoclonal anti-αKlotho antibody KM2076. (B) Urine from rat, mouse, or human was immunoprecipitated with sb106-Fab, resolved by SDS-PAGE and immunoblotted (IB) with KM2076 (left three lanes). Size-selected urine (100 kDa cut-off) was directly subjected to SDS-PAGE and immunoblotted (right three lanes). (C) Immunoprecipitations of endogenous αKlotho from serum. Serum samples from wild type (WT) mouse, klotho.sup.−/− mouse, normal human, and dialysis patient (ESRD) where incubated with sb106-Fab overnight at 4° C. Sepharose beads conjugated with anti-FLAG antibody were then added and incubated for 2 hours at 4° C. The beads were washed and bound proteins were eluted with 2×SDS sample loading buffer. Immunoblot was performed KM2076 followed by a standard anti-rat IgG secondary for visualization.

(5) FIG. 4 shows the validation of IP-IB assay using human serum spiked with recombinant αKlotho. (A) Known amounts of soluble human αKlotho ectodomain were added to sera from a healthy volunteer or an anephric dialysis patient (CKD patient). αKlotho was measured in the sera using the IP-IB assay. (B) Similar experiment as in (A) except comparisons were made where protease inhibitors (AEBSF 0.1 mM, aprotinin 0.3 μM, bestatin 10 μM, E-64 1 μM, leupeptin 50 μM, pepstatin A 1 μM) were either included or excluded from the IP. (C) αKlotho levels determined by IP-IB (y-axis) were plotted against the added recombinant αKlotho (x-axis) in the four conditions described above. Extrapolation to zero spiking shows the level of endogenous αKlotho in the serum treated with protease inhibitors. Only one line is shown for healthy serum with or without protease inhibitors as the results were indistinguishable.

(6) FIG. 5 shows IP-IB assay of serum αKlotho in humans with chronic kidney disease. (A) αKlotho was measured by the IP-IB assay in human sera from normal healthy volunteers and patients from a CKD clinic and dialysis unit using the conventional numerical staging using recombinant αKlotho as a calibration curve. Bars and error bars denote means and standard deviations. The data was analyzed by ANOVA followed by Student-Newman-Keuls test for pairwise multiple comparisons. P values achieving statistical significance between groups are indicated above the brackets. The number of subjects in each group is indicated at the bottom. (B) The concentrations of αKlotho in a large variety of human sera were determined either by IP-IB (x-axis) or by a commercial ELISA (y-axis) in the same samples. The dotted line represents identity. The grey diamonds represent sera that have been through one or more freeze-thaw cycles (stored) and the black diamonds represent sera thawed only once (fresh). (C) Sera from human subjects were assayed by IP-IB and ELISA. The same sera were subjected to the indicated cycles of repeated freeze-thaw and then assayed. Results for each sample were expressed as a percentage of the reading from the same sample thawed only once. The black lines denote the mean of the different subjects.

(7) FIG. 6 shows human urinary αKlotho levels. αKlotho was measured in the urine of healthy volunteers or patients with chronic kidney disease stage 5 (CKD5). (A) A representative IP-IB assay using recombinant murine αKlotho (rMKI) as a calibration with four subjects in each group under steady state conditions. Equal amounts of urine creatinine were used for IP-IB. (B) Summary of the data from the IP-IB assay and the commercial ELISA. Bars and error bars represent mean and standard deviation from eight subjects in each group. The mean of the healthy volunteers was set as a reference of 100%.

(8) FIG. 7 shows surface plasmon resonance (SPR) sensorgrams with sb106-Fab. (A) SPR sensorgram illustrating binding of sb106-Fab (Fsb106) to the αKlotho-FGFR1c complex. The binary complex of murine αKlotho ectodomain and human FGFR1c ligand-binding domain was immobilized on a biosensor chip and 100 nM of Fsb106 were injected over the chip. Note that the Fsb106 dissociates extremely slowly from the αKlotho-FGFR1c complex. (B) Overlay of SPR sensorgrams showing that sb106-Fab does not inhibit ternary complex formation between FGF23, αKlotho, and FGFR1c. 10 nM of αKlotho-FGFR1c complex alone and a mixture of 10 nM of αKlotho-FGFR1c complex and 100 nM of Fsb106 were injected over a biosensor chip containing immobilized FGF23.

(9) FIG. 8 is a schematic of amino acid sequences of sb106. (A) Light chain sequence (SEQ ID NO: 11) of sb106. (B) Heavy chain sequence—Fab (SEQ ID NO: 12). (C) Heavy chain sequence—IgG1 (SEQ ID NO: 13). (D) Heavy chain sequence —IgG4 (SEQ ID NO: 14). IMGT CDR residues are underlined, IMGT framework region residues are not underlined, and residues at IMGT positions which were randomized in the selection library are in bold and larger font size, and italicized amino acids are constant domains.

(10) FIG. 9 is graph showing absorbance values of a Fab phage ELISA demonstrating the binding of Fab phage clones to αKlotho in the absence or presence of sb106 Fab. Fab phage clones were incubated with immobilized αKlotho in the absence or presence of sb106 Fab (25 ug/ml), or neutravidin (NA) as a negative control. After washing off unbound phage, bound phage were detected using an HRP-conjugated anti phage antibody. Colorimetric HRP reagents allow for absorbance readings at 450 nm.

(11) FIG. 10 is a graph showing absorbance values of Fab ELISAs with additional αKlotho antibodies. Purified Fabs [5 ug/ml] were incubated with immobilized αKlotho (1 ug/ml) or bovine serum albumin (BSA), as a negative control. After washing off unbound Fab, bound Fab were detected using an HRP—conjugated anti-Flag anti-body (Fabs have Flag-tag on the light chain). Colorimetric HRP reagents allow for absorbance readings at 450 nm.

(12) FIG. 11 is a series of graphs of epitope grouping experiments of additional αKlotho antibodies. αKlotho antigen is coated on to plates, blocked and then incubated with 10 ug/ml of Fab (as indicated on the x axis) for 1 hour. Unbound Fab is washed and then the antigen with bound Fab is exposed to Fab-phage (indicated at the top of each graph) for 20 minutes. After washing off unbound phage, bound phage were detected using an HRP-conjugated anti-phage antibody. Colorimetric HRP reagents allow for absorbance readings at 450 nm. Fab is the control, reference signal for no interference and the BSA signal is the background control.

(13) FIG. 12 is a series of graphs of affinity estimates measured by surface plasmon resonance with αKlotho Fabs. Fabs were immobilized using an anti-H+L IgG for capture. αKlotho injections were serially diluted 3 times with a two-fold reduction each time; 50 ug/ml (highest curve) was the starting concentration and 6.25 ug/ml (lowest curve) was the final concentration. Curves are fitted to the Langmuir model.

(14) FIG. 13 is a series of immunoblots showing immunoprecipitations of αKlotho with identified Fabs.

(15) FIG. 14 is a graph showing absorbance values of capture ELISAs with IgGs representing 3 different epitopes of αKlotho.

(16) FIG. 15 is series of graphs showing absorbance values of sandwich ELISAs with IgGs representing 3 different epitopes of αKlotho.

(17) FIG. 16 is a graph showing absorbance values of a Fab ELISA using both human and mouse αKlotho.

(18) FIG. 17 is a series of graphs of affinity estimates measured by surface plasmon resonance against human and mouse antigen for select αKlotho Fabs. Fabs were captured using an anti-IgG(H+L) antibody and serial dilutions of αKlotho were injected. Binding curves were fitted to the Langmuir model.

(19) FIG. 17(A) shows determined K.sub.on, K.sub.off and K.sub.D values. FIG. 17 (B) and (C) show binding curves for human and mouse antigen respectively.

DETAILED DESCRIPTION OF THE DISCLOSURE

1. Definitions

(20) The term “αKlotho” or “alphaKlotho” as used herein refers to all known and naturally occurring αKlotho molecules including, full length αKlotho protein, fragments thereof such as ectodomain fragments, as well as nucleic acids encoding said protein and fragments, as determinable from the context used. Included are the soluble forms of αKlotho (proteolytically cleaved as well as alternatively spliced forms αKlotho, referred to as “soluble αKlotho” when present in a biological fluid such as blood or a fraction thereof, urine or cerebrospinal fluid and having a molecular weight of about 130 kDa, as well as the membrane-anchored form of αKlotho, and including but not limited to mammalian αKlotho such as human αKlotho, or rodent αKlotho including for example mouse and rat αKlotho.

(21) The term “acute kidney injury” or “AKI” as used herein refers to an abrupt and sustained loss of kidney function for example that can lead to accumulation of urea and other chemicals in the blood, that develops within for example seven days of an insult. AKI may be caused by disease, injury such as crushing injury to skeletal muscle and medication. AKI is classified in stages varying from risk (glomerular filtration rate (GFR) decreased by 25%), injury (GFR decreased by 50%), failure (GFR decreased by 75%), loss (complete loss of kidney function for more than four weeks) and end-stage renal disease (complete loss of kidney function for more than three months). AKI can be asymptomatic.

(22) The term “early acute kidney injury” as used herein means priorto rises in serum creatinine.

(23) The term “amino acid” includes all of the naturally occurring amino acids as well as modified amino acids.

(24) The term “antibody” as used herein is intended to include human antibodies, monoclonal antibodies, polyclonal antibodies, single chain and other chimeric antibodies. The antibody may be from recombinant sources and/or produced in transgenic animals. The antibody in an embodiment comprises a heavy chain variable region or a heavy chain comprising a heavy chain complementarity determining region 1, heavy chain complementarity determining region 2 and heavy chain complementarity determining region 3, as well as a light chain variable region or light chain comprising a light chain complementarity determining region 1, light chain complementarity determining region 2 and light chain complementarity determining region 3.

(25) The term “binding fragment” as used herein is intended to include without limitations Fab, Fab′, F(ab′)2, scFv, scFab, dsFv, ds-scFv, dimers (e.g. Fc dimers), minibodies, diabodies, and multimers thereof, multispecific antibody fragments and Domain Antibodies. Antibodies can be fragmented using conventional techniques. For example, F(ab′)2 fragments can be generated by treating the antibody with pepsin. The resulting F(ab′)2 fragment can be treated to reduce disulfide bridges to produce Fab′ fragments. Papain digestion can lead to the formation of Fab fragments. Fab, Fab′ and F(ab′)2, scFv, scFab, dsFv, ds-scFv, dimers, minibodies, diabodies, bispecific antibody fragments and other fragments can also be synthesized by recombinant techniques.

(26) The term “capture antibody” as used herein means an antibody or binding fragment thereof bound to a solid support and used to capture the target antigen in a sample, for example αKlotho polypeptide, optionally soluble αKlotho polypeptide by forming a complex with the target antigen.

(27) The term “detection antibody” as used herein means an antibody or binding fragment thereof that binds a target antigen, for example αKlotho polypeptide, optionally soluble αKlotho polypeptide, optionally a target antigen already in a complex with a capture antibody. For example, the detection antibody binds the capture antibody: αKlotho complex at an epitope on the target antigen that is different than the one recognized by the capture antibody.

(28) A “conservative amino acid substitution” as used herein, is one in which one amino acid residue is replaced with another amino acid residue without abolishing the protein's desired properties. Suitable conservative amino acid substitutions can be made by substituting amino acids with similar hydrophobicity, polarity, and R-chain length for one another. Examples of conservative amino acid substitution include:

(29) TABLE-US-00001 Conservative Substitutions Type of Amino Acid Substitutable Amino Acids Hydrophilic Ala, Pro, Gly, Glu, Asp, Gln, Asn, Ser, Thr Sulphydryl Cys Aliphatic Val, Ile, Leu, Met Basic Lys, Arg, His Aromatic Phe, Tyr, Trp

(30) The term “chronic kidney disease” or “CKD” refers to a disease causing a progressive loss in renal function. CDK is classified according to five stages which are determined according to a defined glomerular filtration rate (GFR). Stage 1 CKD is defined by a GFR of 90 mL/min/1.73 m.sup.2, stage 2 CDK is defined by a GFR between 60-89 mL/min/1.73 m.sup.2, stage 3 CKD is defined by a GFR between 30-59 mL/min/1.73 m.sup.2, stage 4 CKD is defined by a GFR between 15-29 mL/min/1.73 m.sup.2 and stage 5 CKD is defined by a GFR of less than 15 mL/min/1.73 m.sup.2. Normal kidney function is defined by a GFR between 100-130 mL/min/1.73 m.sup.2 or 90 mL/min/1.73 m.sup.2 without proteinuria.

(31) The term “control” as used herein refers to a sample from a subject or a group of subjects who are either known as having a kidney disease or not having the disease, and/or a value determined from said group of subjects, wherein subjects with αKlotho level at or below such value are likely to have the disease. The disease can be for example chronic kidney disease (CKD) or acute kidney injury (AKI). The disease can also be for example a stage of CKD such as stage 1 CKD, stage 2 CKD, stage 3 CKD, stage 4 CKD or stage 5 CKD; higher stage being more severe. In addition, the control can be for example derived from tissue of the same type as the sample of the subject being tested. In methods directed to monitoring, the control can also be tissue from the same subject taken at different a time point for example the control can be a sample from the same subject taken prior to a treatment for a kidney disease.

(32) The term “early chronic kidney disease” refers to earlier stages of CKD, and means in an embodiment stage 1 and/or stage 2 CKD. Frequently, there are no elevations of FGF23, PTH, and phosphate. Subjects with stage 1 CKD almost never present any symptoms indicating kidney damage. Subjects with stage 2 CKD do not necessarily present symptoms indicating kidney damage but occasionally do.

(33) The term “denatured” as used herein means a polypeptide that has lost tertiary and/or secondary structure (e.g. fully unfolded protein), for example when exposed to denaturing conditions in SDS sample loading buffer.

(34) The term “detectable tag” as used herein refers to moieties such as peptide sequences that can be appended or introduced into recombinant protein.

(35) The term “sandwich ELISA” as used herein refers to an ELISA comprising a solid support and a capture antibody or binding fragment thereof (specific for the antigen) immobilized onto the solid support. In such an ELISA an amount of target antigen in a sample is bound by the capture antibody (e.g. αKlotho polypeptide comprised in a sample). The bound antigen is detected by a second antibody or binding fragment thereof, i.e. a detection antibody or binding fragment thereof, which recognizes an epitope that is different from the one recognized by the capture antibody. The capture antibody:αKlotho complex) is detected by the detection antibody which can be covalently linked to an enzyme or can itself be detected by addition of a secondary antibody which is linked to an enzyme. For example, the capture antibody and/or the detection antibody can comprise CDR regions disclosed herein.

(36) The term “epitope” as used herein refers to the site on the antigen that is recognized by the antibodies or binding fragments disclosed herein.

(37) The term “heavy chain complementarity determining region” as used herein refers to regions of hypervariability within the heavy chain variable region of an antibody molecule. The heavy chain variable region has three complementarity determining regions termed heavy chain complementarity determining region 1 (CDR-H1), heavy chain complementarity determining region 2 (CDR-H2) and heavy chain complementarity determining region 3 (CDR-H3) from the amino terminus to carboxy terminus. All CDRs and framework regions (FRs) disclosed herein, amino acid sequences of CDRs and FRs disclosed herein, and CDR-encoding or FR-encoding nucleic acid sequences disclosed herein, are intended to be defined in accordance with IMGT numbering (85).

(38) The term “heavy chain variable region” as used herein refers to the variable domain of the heavy chain comprising the heavy chain complementarity determining region 1, heavy chain complementarity determining region 2 and heavy chain complementarity determining region 3. One or more amino acids or nucleotides can be modified for example replaced with a conservative substitution, for example outside the CDR sequences.

(39) The term “host cell” refers to a cell into which a recombinant DNA expression vector can be introduced to produce a recombinant cell. The host cell can be a bacterial cell such as E. coli but can also be any type of microbial, yeast, fungi, insect or mammalian host cell.

(40) The term “isolated antibody or binding fragment thereof” or “isolated and purified antibody or binding fragment thereof” refers to an antibody or binding fragment thereof that is substantially free of cellular material or culture medium when produced by recombinant DNA techniques, or chemical precursors, or other chemicals when chemically synthesized and/or other antibodies, for example directed to a different epitope.

(41) The term “K.sub.D” refers to the dissociation constant of a complex for example of a particular antibody-antigen interaction.

(42) The term “light chain complementarity determining region” as used herein refers to regions of hypervariability within the light chain variable region of an antibody molecule. Light chain variable regions have three complementarity determining regions termed light chain complementarity determining region 1, light chain complementarity determining region 2 and light chain complementarity determining region 3 from the amino terminus to the carboxy terminus.

(43) The term “light chain variable region” as used herein refers to the variable domain of the light chain comprising the light chain complementarity determining region 1, light chain complementarity determining region 2 and light chain complementarity determining region 3.

(44) The term “native” or “natively folded” as used herein refers to a protein in its native conformation (e.g. 3D conformation) or in a conformation sufficient to confer functionality, including for example partially unfolded protein capable of binding a receptor or ligand. For example, folded αKlotho protein is capable of binding to a FGF receptor such as FGFR1c and can form a FGFR1c: αKlotho complex.

(45) The term “nucleic acid sequence” as used herein refers to a sequence of nucleoside or nucleotide monomers consisting of naturally occurring bases, sugars and intersugar (backbone) linkages. The term also includes modified or substituted sequences comprising non-naturally occurring monomers or portions thereof. The nucleic acid sequences of the present application may be deoxyribonucleic acid sequences (DNA) or ribonucleic acid sequences (RNA) and may include naturally occurring bases including adenine, guanine, cytosine, thymidine and uracil. The sequences may also contain modified bases. Examples of such modified bases include aza and deaza adenine, guanine, cytosine, thymidine and uracil and xanthine and hypoxanthine. The nucleic acid can be either double stranded or single stranded, and represents the sense or antisense strand. Further, the term “nucleic acid” includes the complementary nucleic acid sequences as well as codon optimized or synonymous codon equivalents. The term “isolated nucleic acid sequences” as used herein refers to a nucleic acid substantially free of cellular material or culture medium when produced by recombinant DNA techniques, or chemical precursors, or other chemicals when chemically synthesized. An isolated nucleic acid is also substantially free of sequences which naturally flank the nucleic acid (i.e. sequences located at the 5′ and 3′ ends of the nucleic acid) from which the nucleic acid is derived.

(46) The term “polypeptide” as used herein refers to a polymer consisting of a large number of amino acid residues bonded together in a chain. The polypeptide can form a part or the whole of a protein. The polypeptide may be arranged in a long, continuous and unbranched peptide chain. The polypeptide may also be arranged in a biologically functional way. The polypeptide may be folded into a specific three dimensional structure that confers it a defined activity. The term “polypeptide” as used herein is used interchangeably with the term “protein”.

(47) The term “isolated polypeptide” as used herein means substantially free of cellular material or culture medium when produced by recombinant DNA techniques, or chemical precursors, or other chemicals when chemically synthesized.

(48) The term “reference agent” as used herein refers to an agent that can be used in an assay and that can be for example a standard amount of αKlotho protein used as a reference for example for detecting, screening or for diagnosing kidney condition such as chronic kidney disease and acute kidney disease.

(49) The term “sample” as used herein refers to any biological fluid, cell or tissue sample from a subject, which can be assayed for αKlotho such as soluble biomarkers. For example the sample can comprise urine, serum, plasma or cerebrospinal fluid. The sample can for example be a “post-treatment” sample wherein the sample is obtained after one or more treatments, or a “base-line sample” which is for example used as a base line for assessing disease progression.

(50) The term “sb106”, “sb106 antibody” or “clone ID 48” as used herein means an antibody comprising light and heavy chain amino acid sequences set forth below:

(51) Light chain variable region sequence (IMGT CDR sequences are underlined, IMGT framework region residues are not underlined, and residues at IMGT positions which were randomized in the selection library are shown in bold):

(52) TABLE-US-00002 (SEQ ID NO: 11) DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIY SASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQAGYSPITF GQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQ WKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEV THQGLSSPVTKSFNRGEC
Heavy chain variable region sequence (IMGT CDR sequences are underlined, IMGT framework region residues are not underlined, and residues at IMGT positions which were randomized in the selection library are shown in bold):

(53) TABLE-US-00003 (SEQ ID NO: 12) EVQLVESGGGLVQPGGSLRLSCAASGFNISYYSIHWVRQAPGKGLEWVA YISPSYGYTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCAR YYVYASHGWAGYGMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGT AALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTV PSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT
and comprising complementarity determining regions determined using IMGT numbering, e.g. with the amino acid sequences set forth below (IMGT CDR sequences are underlined, IMGT framework region residues are not underlined, and residues at IMGT positions which were randomized in the selection library are shown in bold):

(54) Light chain variable region:

(55) TABLE-US-00004 CDR-L1: (SEQ ID NO: 9) QSVSSA CDR-L2: (SEQ ID NO: 10) SAS CDR-L3: (SEQ ID NO: 5) QQAGYSPIT

(56) Heavy chain variable region:

(57) TABLE-US-00005 CDR-H1: (SEQ ID NO: 6) GFNISYYSI CDR-H2: (SEQ ID NO: 7) YISPSYGYTS CDR-H3: (SEQ ID NO: 8) ARYYVYASHGWAGYGMDY.
Sub-clones (e.g. variants) of sb106 were identified which have one or more CDRs (as shown in Table 2) which replace corresponding CDRs of sb106, and which have non-Library F-variable framework regions (i.e. all IMGT framework region positions except for IMGT VH domain positions 39, 55 and 66) which are identical to those of sb106.

(58) Sb106 recognizes an epitope of αKlotho that is different from an epitope recognized by the antibodies and/or binding fragments herein disclosed (e.g. epitope B and epitope C). As such, sb106 and antibodies comprising the CDRs of sb106 and/or the variants of sb106 may be used in conjunction with the antibodies and/or binding fragments thereof herein described (e.g. directed to epitope B and/or epitope C) in a detection assay, for example an ELISA such as a sandwich ELISA.

(59) The term “sequence identity” as used herein refers to the percentage of sequence identity between two polypeptide sequences or two nucleic acid sequences. To determine the percent identity of two amino acid sequences or of two nucleic acid sequences, the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in the sequence of a first amino acid or nucleic acid sequence for optimal alignment with a second amino acid or nucleic acid sequence). The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position. The percent identity between the two sequences is a function of the number of identical positions shared by the sequences (i.e., % identity=number of identical overlapping positions/total number of positions.times.100%). In one embodiment, the two sequences are the same length. The determination of percent identity between two sequences can also be accomplished using a mathematical algorithm. A preferred, non-limiting example of a mathematical algorithm utilized for the comparison of two sequences is the algorithm of Karlin and Altschul, 1990, Proc. Natl. Acad. Sci. U.S.A. 87:2264-2268, modified as in Karlin and Altschul, 1993, Proc. Natl. Acad. Sci. U.S.A. 90:5873-5877. Such an algorithm is incorporated into the NBLAST and XBLAST programs of Altschul et al., 1990, J. Mol. Biol. 215:403. BLAST nucleotide searches can be performed with the NBLAST nucleotide program parameters set, e.g., for score=100, wordlength=12 to obtain nucleotide sequences homologous to a nucleic acid molecules of the present application. BLAST protein searches can be performed with the XBLAST program parameters set, e.g., to score-50, wordlength=3 to obtain amino acid sequences homologous to a protein molecule of the present invention. To obtain gapped alignments for comparison purposes, Gapped BLAST can be utilized as described in Altschul et al., 1997, Nucleic Acids Res. 25:3389-3402. Alternatively, PSI-BLAST can be used to perform an iterated search which detects distant relationships between molecules (Id.). When utilizing BLAST, Gapped BLAST, and PSI-Blast programs, the default parameters of the respective programs (e.g., of XBLAST and NBLAST) can be used (see, e.g., the NCBI website). Another preferred, non-limiting example of a mathematical algorithm utilized for the comparison of sequences is the algorithm of Myers and Miller, 1988, CABIOS 4:11-17. Such an algorithm is incorporated in the ALIGN program (version 2.0) which is part of the GCG sequence alignment software package. When utilizing the ALIGN program for comparing amino acid sequences, a PAM120 weight residue table, a gap length penalty of 12, and a gap penalty of 4 can be used. The percent identity between two sequences can be determined using techniques similarto those described above, with orwithout allowing gaps. In calculating percent identity, typically only exact matches are counted.

(60) By “at least moderately stringent hybridization conditions” it is meant that conditions are selected which promote selective hybridization between two complementary nucleic acid molecules in solution. Hybridization may occur to all or a portion of a nucleic acid sequence molecule. The hybridizing portion is typically at least 15 (e.g. 20, 25, 30, 40 or 50) nucleotides in length. Those skilled in the art will recognize that the stability of a nucleic acid duplex, or hybrids, is determined by the Tm, which in sodium containing buffers is a function of the sodium ion concentration and temperature (Tm=81.5° C.−16.6 (Log 10 [Na+])+0.41 (%(G+C)−600/I), or similar equation). Accordingly, the parameters in the wash conditions that determine hybrid stability are sodium ion concentration and temperature. In order to identify molecules that are similar, but not identical, to a known nucleic acid molecule a 1% mismatch may be assumed to result in about a 1° C. decrease in Tm, for example if nucleic acid molecules are sought that have a >95% identity, the final wash temperature will be reduced by about 5° C. Based on these considerations those skilled in the art will be able to readily select appropriate hybridization conditions. In preferred embodiments, stringent hybridization conditions are selected. By way of example the following conditions may be employed to achieve stringent hybridization: hybridization at 5× sodium chloride/sodium citrate (SSC)/5×Denhardt's solution/1.0% SDS at Tm−5° C. based on the above equation, followed by a wash of 0.2×SSC/0.1% SDS at 60° C. Moderately stringent hybridization conditions include a washing step in 3×SSC at 42° C. It is understood, however, that equivalent stringencies may be achieved using alternative buffers, salts and temperatures. Additional guidance regarding hybridization conditions may be found in: Current Protocols in Molecular Biology, John Wiley & Sons, N.Y., 2002, and in: Sambrook et al., Molecular Cloning: a Laboratory Manual, Cold Spring Harbor Laboratory Press, 2001.

(61) The term “subject” as used herein refers to any member of the animal kingdom, preferably a mammal, more preferably a human being or a rodent such as a rat or a mouse. In one embodiment, the subject is suspected of having a kidney disorder such as chronic kidney disease (CKD) or acute kidney injury (AKI).

(62) The term “variant” as used herein includes one or more amino acid and/or nucleotide modifications in a sequence (polypeptide or nucleic acid respectively) for example, one or more modifications of a light chain or a heavy chain complementarity determining region (CDR) disclosed herein that perform substantially the same function as the light chain and heavy chain CDRs disclosed herein in substantially the same way. For instance, variants of the CDRs disclosed herein have the same function of being able to specifically bind to an epitope on folded αKlotho protein or in the case of nucleotide modifications, encode CDRs that have same function of being able to specifically bind to an epitope on folded αKlotho protein. For example, codon optimized and degenerate sequences are included. Variants of CDRs disclosed herein include, without limitation, conservative amino acid substitutions as well as additions and deletions to the CDR sequences disclosed herein. For example the addition or deletion can be 1, 2, 3 or 4 amino acids and/or the corresponding number of nucleotides.

(63) The term “level” as used herein refers to an amount (e.g. relative amount or concentration) of αKlotho protein that is detectable or measurable in a sample. For example, the soluble αKlotho level can be a concentration such as pM or a relative amount such as 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2.2, 2.4, 2.6, 2.8, 3.0, 3.2, 3.4, 3.6, 3.8, 4.0, 4.2, 4.4, 4.6, 4.8, 5.0 and/or 10 times a control level, where for example, the control level is the level of soluble αKlotho in a healthy subject.

(64) In understanding the scope of the present disclosure, the term “comprising” and its derivatives, as used herein, are intended to be open ended terms that specify the presence of the stated features, elements, components, groups, integers, and/or steps, but do not exclude the presence of other unstated features, elements, components, groups, integers and/or steps. The foregoing also applies to words having similar meanings such as the terms, “including”, “having” and their derivatives. Finally, terms of degree such as “substantially”, “about” and “approximately” as used herein mean a reasonable amount of deviation of the modified term such that the end result is not significantly changed. These terms of degree should be construed as including a deviation of at least ±5% of the modified term if this deviation would not negate the meaning of the word it modifies.

(65) In understanding the scope of the present disclosure, the term “consisting” and its derivatives, as used herein, are intended to be close ended terms that specify the presence of stated features, elements, components, groups, integers, and/or steps, and also exclude the presence of other unstated features, elements, components, groups, integers and/or steps.

(66) The recitation of numerical ranges by endpoints herein includes all numbers and fractions subsumed within that range (e.g. 1 to 5 includes 1, 1.5, 2, 2.75, 3, 3.90, 4, and 5). It is also to be understood that all numbers and fractions thereof are presumed to be modified by the term “about.” Further, it is to be understood that “a,” “an,” and “the” include plural referents unless the content clearly dictates otherwise. The term “about” means plus or minus 0.1 to 10%, 1-10%, or preferably 1-5%, of the number to which reference is being made.

(67) Further, the definitions and embodiments described in particular sections are intended to be applicable to other embodiments herein described for which they are suitable as would be understood by a person skilled in the art. For example, in the following passages, different aspects of the invention are defined in more detail. Each aspect so defined may be combined with any other aspect or aspects unless clearly indicated to the contrary. In particular, any feature indicated as being preferred or advantageous may be combined with any other feature or features indicated as being preferred or advantageous.

II. Antibody and/or Binding Fragment Thereof

(68) The present disclosure relates to an antibody and/or binding fragment thereof and methods of making and use for example for diagnosing and/or prognosing kidney diseases.

(69) International application No. PCT/CA2015/050728 entitled ANTIBODIES WITH HIGH AFFINITY FOR ALPHA-KLOTHO, herein incorporated by reference, disclosed sb106 antibody. Herein described are additional antibodies that specifically bind αKlotho at different epitopes. As described in FIG. 10, the additional antibodies were identified from a synthetic antibody library and were shown to bind αKlotho. As shown in Example 11 and FIG. 11, epitope grouping experiments using competitive ELISA reveal that the sb106 antibody binds a distinct epitope (identified as A), while the presently described antibodies bind at least two different epitopes, identified as epitopes B and C. It is further described in FIG. 14 that the epitopes A and B are located within amino acids 550-981 of αKlotho whereas epitope C is located within amino acids 1-549 of αKlotho. These experiments show that the 3 epitopes to which the antibodies bind can be used in a detection assay, for example an ELISA.

(70) Accordingly, a first aspect is an antibody and/or binding fragment thereof that specifically binds αKlotho polypeptide at a different epitope than recognized by an antibody having light and heavy chain variable regions comprising the amino acid sequences of SEQ ID NO: 11 and 12, respectively.

(71) In an embodiment, “CDR-H1” is composed of IMGT CDR-H1 and the VH domain residue at IMGT position 39 flanking the carboxy terminal residue of IMGT CDR-H1, and “CDR-H2” is composed of IMGT CDR-H2 and the VH domain residues at IMGT positions 55 and 66 flanking the amino terminal residue and flanking the carboxy terminal residue, respectively, of IMGT CDR-H2.

(72) In an embodiment, the antibody or binding fragment thereof has a light chain variable region comprising CDR-11, CDR-L2 and CDR-L3 and a heavy chain variable region comprising CDR-H1, CDR-H2 and CDR-H3 wherein the CDR regions are determined using IMGT numbering.

(73) In an embodiment, the antibody and/or binding fragment thereof binds αKlotho polypeptide at a different epitope than recognized by an antibody or binding fragment thereof having a light chain variable region comprising CDR-L3 having amino acid sequences SEQ ID NO: 5, and a heavy chain variable region comprising CDR-H1, CDR-H2 and CDR-H3 having amino acid sequences SEQ ID NO: 6, 7 and 8, respectively.

(74) In an embodiment, the antibody and/or binding fragment thereof binds αKlotho polypeptide at a different epitope than recognized by an antibody or binding fragment thereof having a light chain variable region comprising CDR-L1, CDR-L2 and CDR-L3 having amino acid sequences SEQ ID NO: 9, 10 and 5, respectively, and a heavy chain variable region comprising CDR-H1, CDR-H2 and CDR-H3 having amino acid sequences SEQ ID NO: 6, 7 and 8, respectively.

(75) In one embodiment, the antibody and/or binding fragment thereof binds to epitope B located within amino acids 550-981 of αKlotho however does not bind to the epitope recognized by sb106 antibody.

(76) In an embodiment, the antibody and/or binding fragment thereof specifically binds within amino acids 1 to 549 of αKlotho polypeptide.

(77) In an embodiment, the αKlotho polypeptide is folded, optionally in native conformation (e.g. fully folded).

(78) Accordingly another aspect is an antibody and/or binding fragment thereof, wherein the antibody and/or binding fragment thereof specifically binds to an epitope of a folded αKlotho polypeptide and specifically binds αKlotho polypeptide at a different epitope than recognized by an antibody having light and heavy chain variable regions comprising the amino acid sequences of SEQ ID NO: 11 and 12, respectively.

(79) A further aspect is an antibody and/or binding fragment thereof, wherein the antibody and/or binding fragment thereof specifically binds to αKlotho polypeptide in an unfixed or mildly fixed sample and specifically binds αKlotho polypeptide at a different epitope than recognized by an antibody having light and heavy chain variable regions comprising the amino acid sequences of SEQ ID NO: 11 and 12, respectively.

(80) In an embodiment, the αKlotho polypeptide in the unfixed or mildly fixed sample is folded αKlotho.

(81) As shown in Example 12, the antibodies herein disclosed have binding affinities to αKlotho ranging from 240 μM to 8.7 nM. In an embodiment, the antibody and/or binding fragment has a dissociation constant (K.sub.D) for the αKlotho polypeptide of about or less than 50 nM, about or less than 40 nM, about or less than 30 nM, about or less than 25 nM, about or less than 20 nM, about or less than 15 nM, about or less than 12 nM, about or less than 10 nM, about or less than 9 nM, about or less than 8 nM, about or less than 7 nM, about or less than 6 nM, about or less than 5 nM, about or less than 4 nM, about or less than 3 nM, about or less than 2 nM or about or less than 1 nM, as measured by competitive ELISA assay and/or SPR immunoassay.

(82) In an embodiment, the antibody and/or binding fragment thereof comprises a light chain variable region and a heavy chain variable region, the light chain variable region comprising complementarity determining region CDR-L3 and the heavy chain variable region comprising complementarity determining regions CDR-H1, CDR-H2 and CDR-H3, with the amino acid sequences of said CDRs comprising one or more of the sequences set forth below: CDR-L3: selected from any one of SEQ ID NOs: 123, 126-130, 142, 148 or 149; CDR-H1: SEQ ID NOs: 121 or 124; CDR-H2: SEQ ID NOs: 122 or 125; and/or CDR-H3: selected from any one of SEQ ID NO: 196-226.

(83) In an embodiment, the CDR-H1 region comprises the sequence of SEQ ID NO: 133 or 134.

(84) In an embodiment, the CDR-H2 region comprises the sequence of SEQ ID NO: 135 or 136.

(85) In an embodiment, the complementarity determining regions comprise the amino acid sequences selected from SEQ ID NOs: 142-226, optionally as set forth below: CDR-L3: selected from any one of SEQ ID NOs: 142-156; CDR-H1: selected from any one of SEQ ID NOs: 157-174; CDR-H2: selected from any one of SEQ ID NOs: 175-195; and/or CDR-H3: selected from any one of SEQ ID NOs: 196-226.

(86) In an embodiment, the light chain variable region further comprises complementarity determining regions CDR-L1 and/or CDR-L2 comprising the amino acid sequences set forth below: CDR-L1: SEQ ID NO: 140 and/or CDR-L2: SEQ ID NO: 141.

(87) In an embodiment, the antibody and/or binding fragment thereof comprises a light chain variable region and a heavy chain variable region comprising CDR-11, -L2, -L3, -H1, -H2 and -H3 amino acid sequences as set forth in Tables 3A and 3D-3I.

(88) In an embodiment, the antibody and/or binding fragment thereof binds epitope B of αKlotho and comprises CDR regions as set forth in Tables 3A and/or 3D-3F.

(89) In an embodiment, the antibody and/or binding fragment thereof that specifically binds αKlotho comprises CDR regions of an antibody identified as specific for epitope B as set forth in Table 3A.

(90) In an embodiment, the CDRs of the antibody and/or binding fragment thereof that specifically binds αKlotho are selected from those indicated for clones 4804, 4805, 4807, 4808, 4809, 4811, 4812, 4813, 4815, 4816, 4818, 4820, 4821, 4822, 4823, 4824, 4825, 4826, 4827, 4829, 4832, 4833 and 4834, as set forth in Table 3A.

(91) In an embodiment, the antibody and/or binding fragment thereof that specifically binds αKlotho comprises CDR regions of an antibody identified as specific for epitope C as set forth in Table 3A and/or 3G-3I.

(92) In an embodiment, the antibody and/or binding fragment thereof that specifically binds αKlotho comprises CDR regions of an antibody identified as specific for epitope C, as set forth in Table 3A.

(93) In an embodiment, the CDRs of the antibody and/or binding fragment thereof that specifically binds αKlotho are selected from those indicated for clones 4814, 4819, 4830 and 4831, as set forth in Table 3A.

(94) In an embodiment, CDRs of the antibody and/or binding fragment that specifically binds αKlotho are selected from those indicated for clones 4806, 4810, 4817 and 4828, as set forth in Table 3A.

(95) As an example, the CDR sequences of antibody sb173 (clone id 4808) in the context of the full length light and heavy variable regions are shown in Table 4. The underlined residues denoting the CDR regions may be replaced with other CDR sequences described herein, for example as set forth in Table 3A.

(96) The antibody optionally a human antibody can be any class of immunoglobulins including: IgM, IgG, IgD, IgA or IgE; and any isotype, including: IgG1, IgG2, IgG3 and IgG4.

(97) Any of the Fab clones can for example be inserted into a full length immunoglobulin molecule, for example by subcloning. CDRs of a Fab clone identified here can be grafted onto an antibody to make a CDR-grafted antibody.

(98) Humanized or chimeric antibody may include sequences from one or more than one isotype or class.

(99) Further, antibodies described herein may be produced as antigen binding fragments such as Fab, Fab′ F(ab′).sub.2, Fd, Fv and single domain antibody fragments, or as single chain antibodies in which the heavy and light chains are linked by a spacer. Also, the human or chimeric antibodies may exist in monomeric or polymeric form.

(100) Chimeric antibodies can be prepared using recombinant techniques. As described in the Examples, the Fab identified in the screen was reformatted into full length IgG by subcloning the variable domains of the antibody's light and heavy chains into mammalian expression vectors and producing the IgG protein for example as shown in the Examples using human embryonic kidney cells (HEK293T). As described elsewhere any cell type suitable for expressing an antibody can be used.

(101) In yet another embodiment, the light chain complementarity determining region CDR-L3 and heavy chain complementarity determining regions CDR-H1, CDR-H2 and CDR-H3 have at least 70%, at least 80% or at least 90% sequence identity to SEQ ID NOs: 142-156, SEQ ID NOs: 157-174, SEQ ID NOs: 175-195, and SEQ ID NOs: 196-226, respectively.

(102) In an embodiment, the antibody, binding fragment thereof, optionally the CDR sequence has one or more conservative substitutions.

(103) In one embodiment, the antibody and/or binding fragment thereof is selected from the group consisting of a an immunoglobulin molecule, a Fab, a Fab′, a F(ab)2, a F(ab′)2, a Fv, a disulfide linked Fv, a scFv, a disulfide linked scFv, a single chain domain antibody including fragment scFab, a diabody, a dimer, a minibody, a bispecific antibody fragment, a chimeric antibody, a human antibody, a humanized antibody and a polyclonal antibody.

(104) Fab, Fab′ and F(ab′).sub.2, scFv, scFab, dsFv, ds-scFv, dimers, minibodies, diabodies, bispecific antibody fragments and other fragments can be synthesized or expressed by recombinant techniques.

(105) Antibodies can also be fragmented using conventional techniques. For example, F(ab′).sub.2 fragments can be generated by treating the antibody with pepsin. The resulting F(ab′).sub.2 fragment can be treated to reduce disulfide bridges to produce Fab′ fragments. Papain digestion can lead to the formation of Fab fragments.

(106) In an embodiment, the antibody is a human antibody.

(107) Human antibodies are optionally obtained from transgenic animals (U.S. Pat. Nos. 6,150,584; 6,114,598; and 5,770,429). In this approach the heavy chain joining region (J.sub.H) gene in a chimeric or germ-line mutant mouse is deleted. Human germ-line immunoglobulin gene array is subsequently transferred to such mutant mice. The resulting transgenic mouse is then capable of generating a full repertoire of human antibodies upon antigen challenge.

(108) In an embodiment, the antibody is a chimeric antibody comprising one or more CDRs selected from SEQ ID NOs: 140 to 226.

(109) As shown in Example 15, the antibody and/or binding fragment thereof herein disclosed is cross-reactive to several species. In an embodiment, the αKlotho polypeptide bound is mammalian αKlotho polypeptide, for example, the αKlotho polypeptide is selected from human αKlotho polypeptide or rodent αKlotho polypeptide such as mouse αKlotho polypeptide or rat αKlotho polypeptide.

(110) In an embodiment, the antibody and/or binding fragment thereof preferentially binds human αKlotho over mouse αKlotho.

(111) In another embodiment, the folded αKlotho polypeptide is soluble folded αKlotho polypeptide. For example, the antibody and/or binding fragment thereof binds soluble folded αKlotho polypeptide found in urine, plasma, and/or serum.

(112) As shown in Example 16, Fab fragments herein disclosed were able to bind αKlotho alone and in a complex (αKlotho-FGFR1c). In yet another embodiment, the antibody and/or binding fragment thereof binds a complex comprising folded αKlotho polypeptide. For example, the complex can comprise the folded αKlotho polypeptide with a fibroblast growth factor (FGF) receptor, optionally FGFR1c.

(113) In a further embodiment, the antibody and/or binding fragment is labelled and/or conjugated to a tag, for example to produce a diagnostic agent. For example, the detectable tag can be a purification tag such as a His-tag, a HA-tag, a GST-tag, biotin or a FLAG-tag.

(114) The label is preferably capable of producing, either directly or indirectly, a detectable signal. For example, the label may be radio-opaque or a radioisotope, such as .sup.3H, .sup.14C .sup.32P, .sup.35S, .sup.123, .sup.125I, .sup.131I; a fluorescent (fluorophore) or chemiluminescent (chromophore) compound, such as fluorescein isothiocyanate, rhodamine or luciferin; an enzyme, such as alkaline phosphatase, beta-galactosidase or horseradish peroxidase (HRP); an imaging agent; or a metal ion.

(115) Another aspect of the disclosure relates to an antibody complex comprising the antibody and/or binding fragment thereof and αKlotho, optionally further comprising FGFR1c.

(116) In an embodiment, the antibody complex comprises FGFR1c and optionally further comprises FGF23.

(117) In an embodiment, the antibody and/or binding fragment thereof is an isolated antibody and/or binding fragment thereof.

(118) Yet another aspect is a nucleic acid encoding an antibody and/or binding fragment thereof such as a binding fragment thereof described herein. In an embodiment, the nucleic acid encodes an antibody and/or binding fragment thereof comprising a light chain variable region and a heavy chain variable region, the light chain variable region comprising complementarity determining regions CDR-L1, CDR-L2 and CDR-L3 and the heavy chain variable region comprising complementarity determining regions CDR-H1, CDR-H2 and CDR-H3, with the amino acid sequences of said CDRs comprising one or more of the sequences set forth below: CDR-L3: selected from any one of SEQ ID NOs: 123, 126-130, 142, 148 or 149; CDR-H1: SEQ ID NOs: 121 or 124; CDR-H2: SEQ ID NOs: 122 or 125; and/or CDR-H3: selected from any one of SEQ ID NOs: 196-226.

(119) In an embodiment, the nucleic acid encoding an antibody and/or binding fragment thereof further comprises the sequences set forth below: CDR-L3: selected from any one of SEQ ID NOs: 229-243; CDR-H1: selected from any one of SEQ ID NOs: 244-262; CDR-H2: selected from any one of SEQ ID NOs: 263-285; and/or CDR-H3: selected from any one of SEQ ID NOs: 286-316.

(120) In an embodiment, the light chain variable region comprises complementarity determining regions CDR-L1 and/or CDR-L2 having the nucleic acid sequences set forth below: CDR-L1: SEQ ID NO: 227 and/or CDR-L2: SEQ ID NO: 228.

(121) Variants of the CDRs that bind the different epitopes are described. In addition, the degeneracy of the genetic code allows for different nucleic acids to encode the same amino acid sequence. Accordingly, also included are nucleotide sequences that hybridize to the nucleic acid sequences encoding the antibody and/or binding fragment thereof disclosed herein under at least moderately stringent hybridization conditions and which encode an antibody that also specifically binds cKlotho polypeptide.

(122) Also included in another embodiment are codon degenerate or optimized sequences. In another embodiment, the nucleic acid sequences have at least 70%, most preferably at least 80%, even more preferably at least 90% and even most preferably at least 95% sequence identity to nucleic acid sequences encoding SEQ ID NOs: 227-316 (as shown in Table 3B and 3C).

(123) The antibodies described herein can comprise one or more of the features described herein.

(124) In an embodiment, the nucleic acid is an isolated nucleic acid.

(125) Another aspect is a vector comprising the nucleic acid herein disclosed. In an embodiment, the vector is an isolated vector.

(126) The vector can be any vector suitable for producing an antibody and/or binding fragment thereof, including for example vectors described herein. Possible expression vectors include but are not limited to cosmids, plasmids, or modified viruses (e.g. replication defective retroviruses, adenoviruses and adeno-associated viruses).

(127) A further aspect is a recombinant cell producing the antibody and/or binding fragment thereof herein disclosed or the vector herein disclosed.

(128) The recombinant cell can be generated using any cell suitable for producing a polypeptide, for example suitable for producing an antibody and/or binding fragment thereof.

(129) Suitable host cells include a wide variety of prokaryotic and eukaryotic host cells. For example, the proteins of the invention may be expressed in bacterial cells such as E. coli, insect cells (using baculovirus), yeast cells or mammalian cells.

(130) More particularly, bacterial host cells suitable for producing recombinant antibody producing cells include E. coli, B. subtilis, Salmonella typhimurium, and various species within the genus Pseudomonas, Streptomyces, and Staphylococcus, as well as many other bacterial species well known to one of ordinary skill in the art. Suitable bacterial expression vectors preferably comprise a promoter which functions in the host cell, one or more selectable phenotypic markers, and a bacterial origin of replication. Representative promoters include the ß-lactamase (penicillinase) and lactose promoter system, the trp promoter and the tac promoter. Representative selectable markers include various antibiotic resistance markers such as the kanamycin or ampicillin resistance genes. Suitable expression vectors include but are not limited to bacteriophages such as lambda derivatives or plasmids such as pBR322, the pUC plasmids pUC18, pUC19, pUC118, pUC119, and pNH8A, pNH16a, pNH18a, and Bluescript M13 (Stratagene, La Jolla, Calif.).

(131) Suitable yeast and fungi host cells include, but are not limited to Saccharomyces cerevisiae, Schizosaccharomyces pombe, the genera Pichia or Kluyveromyces and various species of the genus Aspergillus. Examples of vectors for expression in yeast S. cerivisiae include pYepSec1, pMFa, pJRY88, and pYES2 (Invitrogen Corporation, San Diego, Calif.). Protocols for the transformation of yeast and fungi are well known to those of ordinary skill in the art.

(132) Suitable mammalian cells include, among others: COS (e.g., ATCC No. CRL 1650 or 1651), BHK (e.g. ATCC No. CRL 6281), CHO (ATCC No. CCL 61), HeLa (e.g., ATCC No. CCL 2), 293 (ATCC No. 1573), NS-1 cells and any derivatives of these lines.

(133) In an embodiment, the mammalian cells used to produce a recombinant antibody are selected from CHO, HEK293 cells or Freestyle™ 293-F cells (Life technologies). FreeStyle 293-F cell line is derived from the 293 cell line and can be used with the FreeStyle™ MAX 293 Expression System, FreeStyle™ 293 Expression System or other expression systems.

(134) Suitable expression vectors for directing expression in mammalian cells generally include a promoter (e.g., derived from viral material such as polyoma, Adenovirus 2, cytomegalovirus and Simian Virus 40), as well as other transcriptional and translational control sequences.

(135) In an embodiment, the vector is designed for production of light chain or IgG1 heavy chain.

(136) Suitable insect cells include cells and cell lines from Bombyx or Spodotera species. Baculovirus vectors available for expression of proteins in cultured insect cells (SF 9 cells) include the pAc series and the pVL series.

(137) The recombinant expression vectors may also contain genes which encode a fusion moiety (i.e. a “fusion protein”) which provides increased expression or stability of the recombinant peptide; increased solubility of the recombinant peptide; and aid in the purification of the target recombinant peptide by acting as a ligand in affinity purification, including for example tags and labels described herein. Further, a proteolytic cleavage site may be added to the target recombinant protein to allow separation of the recombinant protein from the fusion moiety subsequent to purification of the fusion protein. Typical fusion expression vectors include pGEX (Amrad Corp., Melbourne, Australia), pMAL (New England Biolabs, Beverly, Mass.) and pRIT5 (Pharmacia, Piscataway, N.J.) which fuse glutathione S-transferase (GST), maltose E binding protein, or protein A, respectively, to the recombinant protein.

(138) “Operatively linked” is intended to mean that the nucleic acid is linked to regulatory sequences in a manner which allows expression of the nucleic acid. Suitable regulatory sequences may be derived from a variety of sources, including bacterial, fungal, viral, mammalian, or insect genes. Selection of appropriate regulatory sequences is dependent on the host cell chosen and may be readily accomplished by one of ordinary skill in the art. Examples of such regulatory sequences include: a transcriptional promoter and enhancer or RNA polymerase binding sequence, a ribosomal binding sequence, including a translation initiation signal. Additionally, depending on the host cell chosen and the vector employed, other sequences, such as an origin of replication, additional DNA restriction sites, enhancers, and sequences conferring inducibility of transcription may be incorporated into the expression vector.

(139) In an embodiment, expression of the antibody or binding fragment thereof is under the control of an inducible promoter. Examples of inducible non-fusion expression vectors include pTrc (28) and pET 11d.

(140) The recombinant expression vectors may also contain a marker gene which facilitates the selection of host cells transformed or transfected with a recombinant molecule of the invention. Examples of selectable marker genes are genes encoding a protein such as G418 and hygromycin which confer resistance to certain drugs, ß-galactosidase, chloramphenicol acetyltransferase, firefly luciferase, or an immunoglobulin or portion thereof such as the Fc portion of an immunoglobulin preferably IgG. Transcription of the selectable marker gene is monitored by changes in the concentration of the selectable marker protein such as ß-galactosidase, chloramphenicol acetyltransferase, or firefly luciferase. If the selectable marker gene encodes a protein conferring antibiotic resistance such as neomycin resistance transformant cells can be selected with G418. Cells that have incorporated the selectable marker gene will survive, while the other cells die. This makes it possible to visualize and assay for expression of recombinant expression vectors of the invention and in particular to determine the effect of a mutation on expression and phenotype. It will be appreciated that selectable markers can be introduced on a separate vector from the nucleic acid of interest. Other selectable markers include fluorescent proteins such as GFP which may be cotransduced with the nucleic acid of interest.

(141) Yet another aspect is a composition comprising the antibody and/or binding fragment thereof, the nucleic acid herein disclosed or the recombinant cell herein disclosed, optionally in combination with a suitable diluent or carrier.

(142) The composition can be a lyophilized powder or aqueous or non-aqueous solution or suspensions, which may further contain antioxidants, buffers, bacteriostats and solutes. Other components that may be present in such compositions include water, surfactants (such as TWEEN™ detergent), alcohols, polyols, glycerin and vegetable oils, for example.

(143) Suitable diluents for nucleic acids include but are not limited to water, saline solutions and ethanol.

(144) Suitable diluents for polypeptides, including antibodies or fragments thereof and/or cells include but are not limited to saline solutions, pH buffered solutions and glycerol solutions or other solutions suitable for freezing polypeptides and/or cells.

(145) The composition can further comprise stabilizing agents, for example reducing agents, hydrophobic additives, and protease inhibitors which are added to physiological buffers.

III. Methods

(146) Another aspect of the disclosure is a method for isolating or producing an antibody and/or binding fragment thereof described herein with specific binding affinity to αKlotho and that binds an epitope of αKlotho that is different from the epitope recognized by the sb106 antibody.

(147) As previously mentioned, the sb106 antibody comprises a light chain variable region comprising CDR-L1, CDR-L2 and CDR-L3 having amino acid sequences SEQ ID NO: 9, 10 and 5, respectively, and a heavy chain variable region comprising CDR-H1, CDR-H2 and CDR-H3 having amino acid sequences SEQ ID NO: 6, 7 and 8, respectively.

(148) Additional αKlotho specific antibodies that bind different epitopes are desirable for example to establish detection assays. As described herein antibodies to αKlotho were identified by antibody-phase display selections performed on the extracellular domain (ECD) of human αKlotho while in the presence of saturating levels of the original sb106 Fab. Using this method, 31 antibodies were identified as recognizing a distinct epitope of αKlotho and as binding αKlotho in the presence and absence of sb106 (Example 10 and FIG. 9). The antibodies exhibit binding affinities (K.sub.D) less than 10 nM, as shown in Table 5. In one embodiment, the method comprises screening an antibody library for an antibody that binds soluble αKlotho polypeptide and isolating the antibody from an antibody library. For example, the antibody library can be an antibody phage-display library. In one embodiment, the antibody phage-display library is a human Fab phage-display library.

(149) In an embodiment, αKlotho polypeptide is used to isolate an antibody that specifically binds αKlotho polypeptide from the antibody library. In an embodiment, αKlotho complexed with an antibody or binding fragment that has CDR regions specific for epitope A, B or C is used to isolate an antibody that specifically binds αKlotho polypeptide from the antibody library.

(150) In another embodiment, the isolated and purified antibody and/or binding fragment thereof is affinity matured. Affinity maturation can be performed as described for the initial selection, with antigen adsorbed to plastic plates, using a for example a phage library comprising variants of the CDR sequences.

(151) A person skilled in the art will appreciate that several methods can be used to isolate and produce antibodies and/or binding fragments thereof with specific binding affinity to folded αKlotho. A method that can be used is a phage display method. For example, a binary αKlotho-FGF1Rc complex is produced in order to isolate and characterize the antibody and/or binding fragment thereof. Phage from a human Fab phage-displayed library are selected following several rounds of panning. Phage with specific binding affinity to the binary αKlotho-FGF1Rc complex, as determined by ELISA, are sequenced and cloned into vectors designed for production of light chain or heavy chain. The heavy chain can be for example an IgG, or an IgG isotype such as an IgG1 or an IgG4. Antigen binding fragments and IgG polypeptides are then affinity purified by using, for example, Protein A affinity columns.

(152) In another embodiment, a nucleic acid encoding an antibody described herein is expressed in a host cell to make the antibody and/or binding fragment thereof. In an embodiment, the method comprises: a. expressing in a host cell a nucleic acid encoding an antibody and/or binding fragment thereof herein disclosed; b. culturing the host cell to produce the antibody and/or binding fragment thereof; and c. isolating and/or purifying the antibody and/or binding fragment thereof from the host cell.

(153) In some embodiments, a nucleic acid encoding a single chain antibody is expressed. In other embodiments, multiple nucleic acids are expressed, for example encoding a nucleic acid, encoding an antibody light chain and a nucleic acid encoding an antibody heavy chain.

(154) Suitable host cells and vectors are described above. Vectors and nucleic acids encoding an antibody described herein may be introduced into mammalian cells via conventional techniques such as calcium phosphate or calcium chloride co-precipitation, DEAE-dextran mediated transfection, lipofectin and other liposome based transfection agents, electroporation or microinjection.

(155) Nucleic acid encoding an antibody described herein may be directly introduced into mammalian cells using delivery vehicles such as retroviral vectors, adenoviral vectors and DNA virus vectors.

(156) As described in Example 13, the antibodies were tested using an immunoprecipitation-immunoblot assay as Fabs on human urine samples. The results demonstrate (FIG. 13) that the antibodies have the ability to immunoprecipitate αKlotho. The antibodies were assayed for their ability to immunoprecipitate αKlotho from human patient urine samples as Fabs.

V. Assays

(157) The αKlotho specific antibodies disclosed herein bind different epitopes and can be used in a variety of assays for binding, detecting and measuring αKlotho in a sample. For example, the antibodies can be used in a proximity ligation assay (PLA) as well as immunoprecipitation optionally combined with immunoblot detection. The antibody based detection can also be combined with a mass spectrophometric assay, for example as in the case of a particle-based flow cytometric assay.

(158) Immunodetection methods as described herein generally involve the detection or measuring of antibody:αKlotho complexes using antibodies and/or binding fragments thereof disclosed herein. The detection of such complexes is well known in the art and may be achieved through different methods, for example by using a detectable label or marker, such as a radioactive, fluorescent or enzymatic tag. Detection of these complexes may also involve the use of a ligand such as a secondary antibody and/or binding fragment thereof specific for αKlotho or for the antibody:αKlotho complex.

(159) They can also be used to make detection assays, for example a sandwich ELISA, as one antibody can be used as a capture reagent to isolate the αKlotho while another antibody binding a distinct epitope can be used as a detection reagent.

(160) Epitopes A and B are located within amino acids 550-981 αKlotho and epitope C within amino acids 1-549 of αKlotho. As shown in Example 14, FIG. 14, three antibodies binding different epitopes were incubated with two different portions of αKlotho, amino acids 1-549 and amino acids 34-981 of αKlotho. Clone 48 (sb106) which binds epitope A and clone 4808 which binds epitope B both bind within amino acids 550-981 of αKlotho whereas clone 4831 which binds epitope C binds within amino acids 1-549.

(161) Accordingly, another aspect is an immunoassay comprising one or more antibodies and/or binding fragments thereof herein disclosed (e.g. specific for epitope B or C).

(162) In an embodiment, the immunoassay is an enzyme linked immunosorbent assay (ELISA). Antibodies and/or binding fragments thereof may be used in the context of detection assays such as ELISAs, for example sandwich ELISAs. As shown in Example 14 and FIG. 15, the antibodies were used as capture and detection antibodies for the detection of αKlotho in solution. Full length IgGs recognizing epitopes A (sb106), B (sb177) or C (sb200) were immobilized and incubated with αKlotho. The samples were then incubated with biotinylated IgGs recognizing epitopes A, B or C.

(163) In an embodiment, the ELISA is a sandwich ELISA comprising a capture antibody and a detection antibody, wherein the capture antibody is an antibody or binding fragment thereof that has CDRs identified herein and which specifically binds αKlotho, for example which specifically binds epitope A, B or C and/or the detection antibody is an antibody or binding fragment thereof that has CDRs identified herein and which specifically binds αKlotho, for example which specifically binds epitope A, B or C, wherein the capture antibody and the detection antibody bind different epitopes.

(164) In one embodiment, the capture antibody and the detection antibody are selected from an antibody and/or binding fragment thereof herein disclosed, and the sb106 antibody having light and heavy chain variable regions comprising the amino acid sequences of SEQ ID NO: 11 and 12.

(165) In another embodiment, one of the capture and detection antibodies is an antibody and/or binding fragment thereof herein disclosed having CDRs identified in Table 3 and the other of the capture and detection antibodies is an antibody with CDRs identified for sb106 antibody or a variant thereof, optionally having light and heavy chain variable regions comprising the amino acid sequences of SEQ ID NO: 11 and 12, respectively.

(166) In one embodiment, the immunoassay comprises an antibody and/or binding fragment thereof having CDRs described herein which binds epitope B or C of αKlotho herein as well as an antibody with the CDRs of sb106 antibody or a variant thereof identified as binding epitope A.

(167) For example, the capture antibody binds epitope A and the detection antibody binds epitope B. For example, the capture antibody binds epitope A and the detection antibody binds epitope C. For example, the capture antibody binds epitope B and the detection antibody binds epitope A. For example, the capture antibody binds epitope B and the detection antibody binds epitope C. For example, the capture antibody binds epitope C and the detection antibody binds epitope A. For example, the capture antibody binds epitope C and the detection antibody binds epitope B.

(168) In one embodiment, the antibody or variant thereof is sb106-Fab (Fsb106).

(169) In one embodiment, the immunoassay is for the detection and/or measuring of αKlotho polypeptide in a sample, wherein the method of making the immunoassay comprises: a) coating a solid support with the capture antibody; b) contacting the capture antibody with the sample under conditions to form a capture antibody:αKlotho complex; c) removing unbound sample; d) contacting the capture antibody:αKlotho complex with the detection antibody; e) removing unbound detection antibody; and f) detecting and/or measuring the capture antibody:αKlotho complex.

(170) In an embodiment, the ELISA is a competitive ELISA. In an embodiment, the ELISA is a direct ELISA. In an embodiment, the ELISA is an indirect ELISA.

(171) As used herein, “solid supports” include any material to which αKlotho polypeptide and antibodies and/or binding fragments thereof herein disclosed are capable of binding to. For example, the solid support can include plastic, glass, polystyrene, nylon, polypropylene, nylon, polyethylene, dextran, amylases, natural and modified celluloses and polyacrylamides. For example, the solid support is a microtiter plate, magnetic beads, latex beads or array surfaces.

(172) For example, the sample is contacted with an antibody and/or binding fragment thereof under appropriate conditions, for example, at a given temperature and for a sufficient period of time, to allow effective binding of αKlotho to the antibody, thus forming an antibody:αKlotho complex, such as a capture antibody:αKlotho complex. For example, the contacting step is carried out at room temperature for about 30 minutes, about 60 minutes, about 2 hours or about 4 hours. For example, the contacting step is carried out at about 4° C. overnight.

(173) For example, the antibody and/or binding fragment thereof disclosed herein is complexed with αKlotho in a suitable buffer. For example, the buffer has a pH of about 5.0 to about 10.0. For example, the buffer has a pH of 4.5, 6.5 or 7.4. For example, the buffer is a HBS-EP buffer, a KRH buffer or Tris-buffered saline. For example, the buffer comprises BSA and/or TWEEN™20 detergent.

(174) For example, any unbound sample may be removed by washing so that only the formed antibody:αKlotho complex remains on the solid support. For example, the unbound sample is washed with phosphate-buffered saline, optionally comprising bovine serum albumin (BSA).

(175) In an embodiment, the detection antibody is labelled and/or conjugated to a tag.

(176) For example, the detection antibody directly labelled and/or conjugated. For example, the detection antibody is indirectly labelled and/or conjugated. Indirect labels include for example fluorescent or chemiluminescent tags, metals, dyes or radionuclides attached to the antibody. Indirect labels include for example horseradish peroxidase, alkaline phosphatase (AP), beta-galactosidase and urease. For example, HRP can be used with a chromogenic substrate, for example tetramethybenzidine, which produces a soluble product in the presence of hydrogen peroxide that is detectable at 450 nm.

(177) Yet another aspect is an assay for detecting and/or measuring level of αKlotho polypeptide in a sample, the assay comprising: a) contacting a sample with the antibody and/or binding fragment thereof herein described under conditions to form an antibody:αKlotho complex; and b) detecting and/or measuring the antibody:αKlotho complex.

(178) A further aspect is an assay for detecting and/or measuring soluble αKlotho the method comprising: a) contacting a sample, the sample being a biological fluid, with the antibody and/or binding fragment thereof herein described under conditions to form an antibody:soluble αKlotho complex; and b) detecting and/or measuring the antibody:soluble αKlotho complex.

(179) In an embodiment, the assay is for detecting folded αKlotho and the assay is performed under non-denaturing or mildly denaturing conditions.

(180) In an embodiment, the complex is detected directly for example wherein the antibody is labeled with a detectable tag or fusion moiety. In an embodiment, the complex is detected indirectly using a secondary antibody specific for the antibody:αKlotho complex.

(181) In an embodiment, the assay is an immunoprecipitation, immunoblot, immunohistochemistry or immunocytochemistry proximity ligation assay (PLA), mass spectroscopy-based techniques and fluorescence-activated cell sorting (FACS), proximity ligation assay (PLA), and mass spectroscopy-based techniques.

(182) In an embodiment, the method is for detecting soluble αKlotho, for example wherein the sample is a biological fluid.

(183) Detecting can be performed using methods that are qualitative or measured using quantitative methods, for example by comparing to a standard or standard curve.

(184) In an embodiment, the biological fluid sample is blood, or a part thereof such as serum or plasma, or urine.

(185) Yet another aspect relates to a method forscreening, for diagnosing orfordetecting kidney insufficiency condition selected from chronic kidney disease (CKD) and acute kidney injury (AKI) in a subject, the method comprising: a. measuring the level of αKlotho in a sample from a subject optionally using an antibody or assay herein disclosed; and b. comparing the level of αKlotho in the sample with a control, wherein a decreased level of αKlotho in the sample compared to the control is indicative that the subject has a kidney condition selected from CKD or AKI.

(186) In an embodiment, the control is a control value derived from a group of subjects without CKD or AKI e.g. normal controls.

(187) In an embodiment, the CKD is early CKD, optionally stage 1, stage 2, or stage 3, stage 4, stage 5 or stage 6 CKD.

(188) An additional aspect of the disclosure is a method for prognosing CKD progression or AKI progression or lack thereof (e.g. recovery or worsening of disease), or extra-renal complication in CKD, which is assessed by measuring the level of αKlotho deficiency.

(189) Accordingly an aspect is a method of prognosing a likelihood of recovery after AKI, the method comprising: a. measuring a level of αKlotho in a sample from a subject; and b. comparing the level of αKlotho in the sample with a control, for example a control value derived from a group of subjects that did not recover or progressed, wherein an increased level of αKlotho in the sample compared to the control is indicative that the subject has an increased likelihood of recovery after AKI.

(190) In an embodiment, the control is a control value derived from a group of subjects that did recover and a decreased level of αKlotho in the sample compared to the control is indicative that the subject has a decreased likelihood of recovery after AKI and/or an increased likelihood of disease progression.

(191) Another aspect is a method for prognosing a likelihood of long term complications after AKI, the method comprising: a. measuring a level of αKlotho in a sample from a subject; and b. comparing the level of αKlotho in the sample with a control, for example a control value derived from a group of subjects with long term complications or with increased number of long term complications, wherein an increased level of αKlotho in the sample compared to the control is indicative that the subject has an increased likelihood of having fewer long term complications after AKI.

(192) In an embodiment, wherein the control is a control value derived from a group of subjects without long term complications or with fewer long term complications, a decreased level of αKlotho in the sample compared to the control is indicative that the subject has an increased likelihood of having long term complications or an increased number of long term complications after AKI.

(193) A further aspect is a method for prognosing the likelihood of progression of CKD, the method comprising: a. measuring a level of αKlotho in a sample from a subject; and b. comparing the level of αKlotho in the sample with a control, wherein an increased level of αKlotho in the sample compared to the control, for example wherein the control is a control value derived from a group of subjects that did not recover or progressed is indicative that the subject has an increased likelihood of recovering from CKD.

(194) In an embodiment, the control is a control value derived from a group of subjects that did recover and a decreased level of αKlotho in the sample compared to the control is indicative that the subject has a decreased likelihood of recovery after CKD and/or an increased likelihood of disease progression.

(195) Yet another aspect is a method for prognosing extra-renal complications in CKD, the method comprising: a. measuring a level of αKlotho in a sample from a subject; and b. comparing the level of αKlotho in the sample with a control, wherein an increased level of αKlotho in the sample compared to the control is indicative that the subject has a higher likelihood of having fewer extra-renal complications related to CKD.

(196) In an embodiment, wherein the control is a control value derived from a group of subjects without extra-renal complications or with fewer extra-renal complications, an decreased level of αKlotho in the sample compared to the control is indicative that the subject has a increased likelihood of having long term complications or an increased number of extra-renal complications after CKD.

(197) A further aspect is a method for monitoring a subject with a kidney insufficiency condition such as CKD or AKI, the method comprising: a. measuring a level of αKlotho in a sample from a subject; and b. comparing the level of αKlotho in the sample with a previous reference sample other control, wherein an increased level of αKlotho in the sample compared to the previous reference sample or other control is indicative that the subject has an ameliorating kidney condition and a decreased level of αKlotho in the sample compared to the previous reference sample or other control is indicative that the subject has a worsening kidney condition.

(198) The sample can for example be taken after the subject has received a treatment and compared for example to a pre-treatment sample. Alternatively the patient can be monitored after a repeating interval to assess for example if treatment or other intervention is necessary. In an embodiment, the test is repeated and plotted to assess the subject's progression.

(199) In an embodiment, the sample is a biological fluid such as blood, or a fraction thereof such as plasma or serum and the method is for example detecting soluble αKlotho. In an embodiment the biological fluid is urine.

(200) In another embodiment, the sample is selected from a fresh sample such as a fresh biological fluid sample or tissue sample (e.g. including not frozen or one time frozen (e.g. frozen a single time at the time of obtaining the sample)) and a repeat frozen sample (e.g. frozen and thawed and frozen biological fluid sample or repeat frozen tissue sample). In an embodiment, the sample is a fixed sample such as a mildly fixed sample wherein the fixation induces limited denaturation and/or unfolding.

(201) In an embodiment, the level of αKlotho is measured using an antibody or binding fragment described herein.

(202) The methods disclosed herein to diagnose, detect or monitor a kidney disease or prognose a kidney disease complication, can be used in addition to or in combination with traditional diagnostic techniques for kidney disease.

(203) Any antibody or combination of antibodies described herein or in the examples can be used in the assays.

IV. Kits

(204) A further aspect relates to a kit comprising i) an antibody and/or binding fragment thereof, ii) a nucleic acid, iii) a composition or iv) a recombinant cell herein disclosed, comprised in a vial such as a sterile vial or other housing and optionally a reference agent and/or instructions for use thereof.

(205) In an embodiment, the kit further comprises an additional antibody and/or binding fragment thereof having a light chain variable region comprising CDR-11, CDR-L2 and CDR-L3 having amino acid sequences SEQ ID NO: 9, 10 and 5, respectively, and a heavy chain variable region comprising CDR-H1, CDR-H2 and CDR-H3 having amino acid sequences SEQ ID NO: 6, 7 and 8, respectively. For example, the additional antibody and/or binding fragment thereof is an sb106 antibody and/or binding fragment thereof.

(206) In an embodiment, the kit comprises components and/or is for use in performing an assay described herein.

(207) For example, the kit is an ELISA kit and can comprise a first antibody, e.g. a capture antibody, for example attached to a solid support, and a second antibody, e.g. a detection antibody, that binds to αKlotho and/or the capture antibody: αKlotho complex, and that is conjugated to a detectable label.

(208) Any combination of antibodies described herein can be used.

(209) In an embodiment, the kit is a diagnostic kit and the instructions are directed to a method described herein.

(210) The above disclosure generally describes the present application. A more complete understanding can be obtained by reference to the following specific examples. These examples are described solely for the purpose of illustration and are not intended to limit the scope of the application. Changes in form and substitution of equivalents are contemplated as circumstances might suggest or render expedient. Although specific terms have been employed herein, such terms are intended in a descriptive sense and not for purposes of limitation.

(211) The following non-limiting examples are illustrative of the present disclosure:

EXAMPLES

Example 1

(212) A synthetic antibody library was screened and an antigen-binding fragment (Fab) with high affinity for human and rodent αKlotho was generated. This novel antibody, sb106, was characterized using recombinant proteins, cultured cells, and body fluids and tissues from humans and rodents. αKlotho levels in serum and urine in human and rodents can be accurately quantified, and it is demonstrated that both serum and urine αKlotho are dramatically reduced in early human CKD. The sb106 antibody is specific to the α-form of Klotho and is the first known one to successfully pull down αKlotho from patient serum samples, in a clean and specific manner, as compared to currently commercially available αKlotho detection reagents. In cells, it can immunoprecipitate αKlotho and label it by immunocytochemistry. In animals, the antibody is efficient at immunoprecipitating αKlotho from plasma. The ability of the sb106 antibody to detect small quantities of αKlotho from biological fluids makes it a valuable reagent for diagnosis of diseases where the level of αKlotho is abnormal. Moreover, sb106 antibody is valuable as a research reagent in studies of physiologic and pathologic states that involve any FGF23-mediated signaling pathways. It can be used in specific assays for soluble αKlotho in human and rodent samples such as serum using a variety of techniques such as enzyme-linked immunosorbent assay (ELISA), proximity ligation assay (PLA), and mass spectroscopy-based techniques.

Example 2

Preparation of the Binary αKlotho-FGFR1c Complex

(213) The ligand-binding domain of human FGFR1c (D142 to R365) was expressed in E. coli, refolded in vitro from inclusion bodies, and purified by published methods [72,73]. The extracellular domain of murine αKlotho (A35 to K982) was expressed in HEK293 cells with a C-terminal FLAG tag, and the binary complex of the αKlotho ectodomain and the FGFR1c ligand-binding domain was prepared as described [9].

(214) Isolation and Characterization of Sb106

(215) Sb106 was isolated from a synthetic human Fab phage-displayed library (Library F) [74]. Binding selections, phage ELISAs and Fab protein purification were performed as described [67,75,76]. Briefly, phage from library F were cycled through rounds of panning with the binary complex of αKlotho extracellular domain and FGFR1c ligand-binding domain on 96-well Maxisorp Immunoplates (Fisher Scientific, Nepean, ON, Canada) as the capture target. After 5 rounds of selection, phage were produced from individual clones grown in a 96-well format and phage ELISAs were performed to detect specific binding clones. Clones that showed binding were subjected to DNA sequencing. A competitive binding ELISA was performed by pre-incubating sb106-phage with serial dilutions of soluble human αKlotho (50-0.0005 nM×1 hour) prior to binding to an ELISA plate coated with human αKlotho. The genes encoding for variable heavy and light chain domains of sb106 were cloned into vectors designed for production of light chain or IgG1 heavy chain, respectively, and sb106-IgG was expressed from 293F cells (Invivogen, San Diego, Calif. USA). Fab and IgG proteins were affinity-purified on Protein A affinity columns (GE Healthcare, Mississauga, ON, Canada).

(216) Purification of Proteins

(217) The binary complex of FGFR1c ligand-binding domain and murine αKlotho ectodomain (referred to as αKlotho-FGFR1c complex) was prepared by a published protocol [9]. The N-terminally hexahistidine tagged, mature form of human FGF23 (Y25 to 125I) was expressed in E. coli and purified by published protocols [73,74,77].

(218) Analysis of Fab Binding to αKlotho-FGFR1c Complex by SPR Spectroscopy

(219) Real time protein-protein interactions were measured using a BIACORE™ 2000 surface plasmon resonance (SPR) spectrometer (Biacore AB/GE Healthcare) at 25° C. in HBS-EP buffer (10 mM HEPES-NaOH, pH 7.4, 150 mM NaCl, 3 mM EDTA, 0.005% (v/v) polysorbate 20). Proteins were covalently coupled through their free amino groups to carboxymethyl (CM) dextran of research grade CM5 biosensor chips (Biacore AB/GE Healthcare). Proteins were injected over a biosensor chip at a flow rate of 50 μl min.sup.−1, and at the end of each protein injection (180 s), HBS-EP buffer (50 μl min.sup.−1) was flowed over the chip to monitor dissociation for 180 s. Injecting 2.0 M NaCl in 10 mM sodium acetate, pH 4.5, or 10 mM sodium/potassium phosphate, pH 6.5 regenerated the chip surface in between protein injections. The data were processed with BiaEvaluation software version 4.1 (Biacore AB/GE Healthcare). For each protein injection, the non-specific SPR responses recorded for the control flow channel were subtracted from the responses recorded for the sample flow channel.

(220) To examine whether Fabs selected by ELISA bind to the αKlotho-FGFR1c complex, the binary receptor complex was immobilized on a CM5 chip (˜42 fmol mm.sup.−2 of chip flow channel). To control for non-specific binding, bovine β-glucuronidase (Sigma-Aldrich), which is structurally related to each of the two extracellular glycosidase-like domains of αKlotho, was coupled to the control flow channel of the chip (˜45 fmol mm.sup.−2 of flow channel). 100 nM of each Fab were injected over the chip. As a control, binding of FGF23 to the immobilized αKlotho-FGFR1c complex was examined.

(221) To test if the Fabs can compete with FGF23 and/or binding to the αKlotho-FGFR1c complex, FGF23 was immobilized on a CM5 chip (˜16 fmol mm.sup.−2 of chip flow channel). FHF1B, which is structurally similar to FGFs but has no FGFR binding [77], was used as control for non-specific binding (˜15 fmol mm.sup.−2 of control flow channel). 100 nM of Fab mixed with 10 nM of αKlotho-FGFR1c complex (HBS-EP buffer) was injected over the chip. For control, the binding competition was carried out with FGF23 as the competitor in solution.

(222) Cell Culture, Animal and Human Studies

(223) Cell lines: normal rat kidney (NRK) cells with native αKlotho expression (ATCC, Manassas, Va., USA), and HEK293 cells transfected with vector only, full-length transmembrane murine αKlotho, extracellular domain of murine αKlotho with C-terminal FLAG tag, or full-length murine βKlotho[78]. Cells were cultured at 37° C. in a 95% air, 5% CO.sub.2 atmosphere, passed in high-glucose (450 mg/dl) DMEM supplemented with 10% fetal bovine serum, penicillin (100 U/ml), and streptomycin (100 mg/ml).

(224) Animal studies were approved by the University of Texas Southwestern Medical Center Institutional Animal Care and Care Committee. All animals were housed in the Animal Resource Center and experiments were performed in fully approved laboratories. Species used include: Sprague-Dawley rats (Harlan. Indianapolis, Ind.), Klotho transgenic overexpressors (Tg-Klotho; EFmKL46 line)[79], homozygous αKlotho hypomorphic mice (KI/KI)[80], and their wild type littermates (129sv background).

(225) Clinical history and routine lab data were obtained from electronic charts. Blood samples from antecubital venipuncture were spun, and the serum was frozen at −80° C. Fresh urine was spun at 4,000 g and the supernatant was frozen at −80° C.

(226) Immunocytochemistry and Immunohistochemistry

(227) HEK293 cells transfected with vector or the stated αKlotho plasmids and seeded (1.8×10.sup.5 cells/ml) on 12-well glass cover slips pre-treated with poly-lysine and grown overnight. The cells were washed (4° C. PBS×3), fixed with 3% paraformaldehyde (4° C.×10 min), washed (ice cold PBS×3), blocked with 1% BSA (PBS 44° C.×10 min), incubated with sb106-Fab (5 ug/ml in 1% BSA, PBS) washed (PBS 4° C.×5), incubated with anti-FLAG-Alexa488 (Cell Signaling; diluted 1:400 in PBS containing 1% BSA; 1 hour; 20° C.), washed (PBS; 4° C.×4), and then inverted onto glass slides containing a drop of antifade with DAPI (Invitrogen) and dried at room temperature in the dark. After 24 hours, the slides were stored at −20° C. Images were obtained on a WaveFX spinning disc confocal microscope.

(228) The parathyroid and thyroid (en bloc with the trachea) were from adult Sprague Dawley rats. For non-fixed fresh parathyroids, tissues were embedded in OCT medium and frozen with isopentane pre-cooled in liquid N.sub.2 immediately. For fixed parathyroid samples, tissue was immersed in 4% paraformaldehyde in PBS pH 7.4 at 4° C. overnight, washed with PBS, and embedded in OCT medium and frozen with isopentane pre-cooled in liquid N.sub.2. Four μm thick cryostat sections were made, washed in PBS (15 min), and permeabilized in 0.1% TritonX-100 (10 min). For labeling, sections were blocked (PBS, 1.5% BSA, 10% goat serum; 40 min) and incubated with the primary antibody sb106 (21 μg/ml in blocking solution; 4° C. overnight). After washing (PBS), sections were incubated with the Alexa 546 goat anti-human IgG (1:800 dilution, Invitrogen) for 1 hour at room temperature. After additional washes with PBS, the sections were fixed with 4% paraformaldehyde in PBS, washed with PBS, and mounted and visualized with a Zeiss LSM510 microscope.

Example 3: αKlotho Assays and Detailed Methods

(229) The ELISA was performed as instructed by the manufacturer (Immuno-Biological Laboratory, Japan). For the IP-IB assay, typically 50 μl of serum or urine were diluted with KRH buffer [25 mM Hepes-NaOH (pH 7.4), 120 mM NaCl, 5 mM KCl, 1.2 mM MgSO4, 1.3 mM CaC2, 1.3 mM KH2PO4] to a final volume of 0.5 ml incubated with 2 μg of sb106-Fab overnight at 4° C. in low binding, siliconized tubes. Sepharose beads (50 μL) conjugated with anti-FLAG antibody (50% v/v) prewashed 3× with KRH buffer were added, incubated (4° C.×2 h), and washed (KRH—500 μl per tube ×3; 22° C.). The immune complex was eluted with 2×SDS sample loading buffer (50 μl; 100° C.×3 min; 4° C.×3 min; spun), and fractionated by SDS-PAGE, transferred to nitrocellulose membranes and blotted with anti-KL1 antibody (KM2076, 1:4000 or 3.1 mg/mL, 1:10000 dilution) and diluent (Dako #S3022, Carpinteria, Calif., USA) overnight (4° C., rocker). The membrane was washed (×3, Tris-buffered saline with 0.1% TWEEN™ detergent; TBS-T), exposed to anti-rat IgG2A (LSBio cat #LS-C59051, 1:20000 in 5% milk/2% goat serum/TBS-T×1 h) and washed (×3 TBS-T). For chemiluminescence, the membrane was covered with SuperSignal West Femto Maximum Sensitivity substrate (Thermo Scientific, Rockford, Ill., USA) and exposed for 30-90 s. The 130-kD bands were scanned, and density was compared with internal control samples of know amount of Klotho using Adobe Photoshop CS4.

Example 4: Identification of an Anti-αKlotho Synthetic Fab

(230) After rounds of biopanning of a phage-displayed synthetic Fab library on recombinant αKlotho ectodomain complexed with the ligand-binding domain of fibroblast growth factor receptor (FGFR)1c, several binding phages were identified. Clone sb106 (FIG. 1A) was chosen for further characterization. In phage ELISA (FIG. 1B), sb106-phage bound to both human and mouse αKlotho, demonstrating cross species reactivity, and to either αKlotho alone or in complex with FGFR1c, indicating that its epitope is not obscured by co-receptor complex formation. Sb106-phage did not bind to FGFR1c alone, neutravidin (NAV) or bovine serum albumin (BSA). Sb106 binds to human αKlotho with affinity in the single-digit nanomolar range (IC50=1.7 nM, FIG. 1C). Sb106-Fab also binds with high affinity to the binary αKlotho-FGFR1c complex immobilized on a biosensor chip (FIG. 7A) and it does not interfere with ternary complex formation between FGF23, αKlotho and FGFR1c (FIG. 7B).

Example 5: Characterization of the Anti-αKlotho Fab Sb106

(231) Using the unique CDR sequences of sb106 (FIG. 1A), both Fab and full-length IgG proteins were produced (e.g. Fab was produced in bacterial cells and IgG proteins in 293F cells). Sb106 was highly reactive against αKlotho under native conditions. Immunoblot signals under denaturing conditions against mouse, rat, and human kidney tissue were weak, but in samples from transgenic mice overexpressing αKlotho [79], sb106-Fab detected a band corresponding to the full-length extracellular domain of αKlotho (FIG. 2A). In cultured cells, sb106-Fab was not able to detect αKlotho in immunoblots under denaturing conditions with lysates from NRK cells expressing native αKlotho but it was able to detect overexpressed antigen in cell lysates from HEK293 cells transfected with αKlotho (FIG. 2B). In immunohistochemistry with freshly frozen unfixed rat parathyroid tissue (and other tissues known to express αKlotho, sb106-IgG detected αKlotho but the same tissue was negative when fixed (FIG. 2C), suggesting that sb106 binds to the natively folded FGFR1-αKlotho complex (FIG. 1B). In immunocytochemical stains with freshly fixed cells, unequivocal staining was obtained in HEK293 cells heterologously overexpressing αKlotho but not in cells overexpressing βKlotho (FIG. 2D). The cells were seeded at 1.8×10.sup.5/ml on 12-well glass cover slips treated with poly-lysine and grown overnight. Cells were washed 3 times with ice cold PBS, fixed for 10 min on ice (3% paraformaldehyde), washed 3 times with cold PBS, blocked for 10 min (1% BSA in cold PBS). Cells were then incubated with sb106-Fab (5 μg/ml in 1% BSA in PBS) for 1 hr. Cells were washed 5 times with cold PBS (2 min each) and then incubated with anti-FLAG-Alexa488 (the C-terminus of the Fab light chain contains a Flag epitope tag) (1:400 in 1% BSA in PBS) for 1 hr, while being protected from light. Cells were washed 4 times with cold PBS (5 min each). The glass coverslips were then inverted onto glass slides containing a drop of antifade reagent with DAPI. Images were collected on a spinning disc confocal microscope. Even in cells overexpressing αKlotho, prolonged fixation greatly diminished or abolished the staining with sb106. These data indicate that sb106 reacts specifically with natively folded human, rat, and mouse αKlotho but not with denatured αKlotho protein.

Example 6: Immunoprecipitation of αKlotho

(232) The ability of sb106-Fab to precipitate soluble αKlotho was tested using a sequential immunoprecipitation-immunoblot (IP-IB) assay. Sb106-Fab pulled down αKlotho from total cell lysates and conditioned cell culture medium and from αKlotho-overexpressing cells (FIG. 3A). The sb106-Fab pull-down was compared with that of an anti-FLAG antibody using soluble αKlotho with a C-terminal FLAG tag in HEK293 cells. Sb106-Fab and anti-FLAG precipitated proteins with the exact same electrophoretic mobilities.

(233) Sb106-Fab precipitated a −130 kDa protein from human, mouse, and rat sera that reacted with the anti-αKlotho antibody KM2076 (FIG. 3B). IP from urine also showed a ˜130 kDa band (FIG. 3B), whereas the post-IP urine samples did not show such a band in immunoblot. To further support the authenticity of the IP-IB band by sb106, the intensity of this band was examined in human sera from a normal individual vs. a patient with CKD stage 5, and sera from a wild type mouse vs. a homozygous αKlotho hypomorph (FIG. 3C). Only the −130 kDa band (FIG. 3C) was reduced in human advanced CKD and was absent in the αKlotho-deficient mice (kl/kl)[80].

Example 7: αKlotho Levels in Human CKD

(234) The IP-IB method was tested to determine whether it can reliably determine serum αKlotho levels from a single center database of CKD patients. Recombinant human αKlotho was spiked in known amounts to test the linearity of the assay as well as the extrapolated y-intercept. IP-IB was performed with sera from a normal healthy volunteer and a patient with stage 5 CKD spiked with a range of different concentrations of recombinant αKlotho (FIG. 4A). There was graded increase in signal with the incrementally inoculated exogenous αKlotho. The serum from the CKD patient also showed increases in signal with increasing exogenous αKlotho but, at any given concentration of αKlotho, the signal intensity was lower than the normal serum.

(235) Interestingly, the serum from the healthy volunteer gave the same signal in the absence or presence of a protease inhibitor cocktail, whereas the serum from the CKD patient displayed a marked increase in measured αKlotho levels in the presence of a protease inhibitor (FIG. 4B). These findings suggest that while endogenous αKlotho exists in a stable steady state in uremia, the exogenously added αKlotho may undergo proteolysis in uremic serum but not in normal serum. A quantitative summary of the spiking experiment is shown in FIG. 4C. Both healthy and CKD sera showed linear responses to αKlotho inoculation but the signal from CKD sera has a lower slope. When protease inhibitors were included, the slope of the CKD line approached that of the healthy subject without affecting its intercept. Extrapolation to zero inoculation showed that the serum from the normal individual had 31.1 μM αKlotho while that from the CKD patient had 8.5 μM αKlotho. Similar extrapolations were obtained from a number of other subjects with normal renal function or with CKD.

(236) The nature of patients recruited from the CKD clinic resembles the national profile of CKD where diabetes and hypertension predominate (Table 1). Despite the scatter, there is a clear progressive decline of αKlotho with stages of CKD (FIG. 5A). The decrease in serum αKlotho occurred early in CKD, and preceded high FGF23, high PTH, and hyperphosphatemia (Table 1). The IP-IB assay was directly compared with a commercial αKlotho ELISA kit with the same samples (FIG. 5B). Overall, there is a correlation between the two but there is separation on both sides of the line of identity. In fresh samples, the ELISA shows higher values than IP-lB (grey diamonds to the left of the line of identity, FIG. 5B) but in samples that have been through one or more cycles of freeze-thaw, the ELISA values are much lower (black diamonds to the right of the line of identity, FIG. 5B). When the exact same samples were tested by the two methods before and after repeated freeze-thaw, the IP-IB assay gave more stable results while the ELISA values dropped rapidly (FIG. 5C).

(237) Low urinary αKlotho in human CKD patients by directly immunoblotting urine was previously described[12]. The IP-IB assay with sb106-Fab showed dramatic reduction of urinary αKlotho in CKD patients (FIG. 6A). In contradistinction from serum, the ELISA yielded more comparable values to the IP-IB assay in the urine but the magnitude of decrease in αKlotho concentration is more dramatic when detected by the IP-IB assay than by ELISA (FIG. 6B). These results show that human CKD is a state of αKlotho deficiency in both serum and urine.

(238) Hence using an immunoprecipitation-immunoblot (IP-IB) assay, both the serum and urinary levels of full-length soluble αKlotho was measured in humans and it was established that human CKD is associated with αKlotho deficiency in serum and urine. αKlotho levels were detectably lower in early CKD preceding disturbances in other parameters of mineral metabolism and levels progressively declined with CKD stages. Exogenously added αKlotho is inherently unstable in the CKD milieu.

(239) Antibody-based reagents are valuable tools in both research and clinical settings for detection of proteins, protein isolation and purification, and numerous downstream applications. The commercial reagents available for αKlotho detection are limiting; for example there are no antibodies for specifically detecting natively folded αKlotho protein. Moreover, the commercial ELISA kit for αKlotho detection yields highly variable results.

(240) Synthetic antibodies with designed antigen-binding sites can be fine-tuned and tailored for molecular recognition of vast repertoires of targets. Coupled with in vitro phage-display, selections are performed in the absence of tolerance mechanisms that eliminate self-reactive antibodies. Selections with an antibody library yielded sb106, an antibody with specificity for natively folded human, mouse and rat αKlotho.

(241) In addition to its role in mineral metabolism, soluble αKlotho circulates in many bodily fluids and has multiple “house-keeping” functions that maintain cellular integrity throughout the body. Although the mechanism of action of soluble αKlotho remains poorly understood, the biologic impact of αKlotho deficiency is unequivocally shown [81]. αKlotho transcripts are present in multiple organs but the kidney by far has the highest expression [80]. CKD is a state of multiple metabolic derangements and is a complex syndrome from accumulation of under-excreted endogenous and exogenous toxins as well as deficiency in substances responsible for health maintenance.

(242) There is evidence in experimental animals that both AKI and CKD are states of systemic αKlotho deficiency. Not only is this an early and sensitive biomarker, restoration of αKlotho can ameliorate the renal dysfunction. Independent from its renoprotective effects, αKlotho can also reduce the extrarenal complications in CKD [12,82]. Based on the preclinical data, anti-αKlotho antibody may have both diagnostic and prognostic value.

(243) Validation of the IP-IB Assay and Comparison with the Commercial ELISA

(244) Available commercial assays for αKlotho have no consistent correlation between them [46, 83]. Studies in healthy humans and CKD patients based on one ELISA [58] have yielded contradictory results. The absolute levels of αKlotho in normal and CKD ranged from 0.4[47] to over 2000 μg/ml [41] with most readings in the mid to high hundreds [48, 50, 55, 58-60, 83]. Based on this assay, αKlotho levels have been described to be low [48, 52, 54, 57-60], no relationship to [40, 41, 50, 51, 53] or even increased [44, 47] with decreasing glomerular filtration rate (GFR). Likewise, αKlotho levels have been reported as not changed or decreasing with age [42, 53, 58, 59]. This renders the interpretation of human αKlotho data nearly impossible, and the collective data derived from different centers will have no value.

(245) A high affinity synthetic antibody that recognizes αKlotho in its natively folded conformation (FIGS. 1-3) was generated. Sb106-Fab or IgG pulls down αKlotho from cell lysate, culture medium, serum, and urine. Additional bands may be shorter fragments of αKlotho but the intensity of these bands did not decrease in the kl/kl mice arguing against this possibility. The ˜130 kDa band has been analyzed which is full length soluble αKlotho; something that the ELISA cannot achieve.

(246) The linearity of the spiking experiment indicates that all the inoculated αKlotho is detected (FIG. 4). An unexpected finding was that exogenously added recombinant αKlotho is proteolytically degraded in uremic serum whereas no such phenomenon was observed in normal sera. This challenges the view that the low αKlotho in kidney disease stems solely from decreased production and opens up additional mechanisms and new avenues for investigation. In addition to uncovering new mechanisms of αKlotho deficiency in CKD, this may have significant implications in terms of recombinant αKlotho replacement.

(247) There is graded reduction in serum αKlotho with advancing CKD (FIG. 5A). The coefficient of variation of the IP-IB assay was 4% for serum and 7% for urine. The IP-IB assay also showed very low urinary αKlotho in advanced CKD (FIG. 6). In fact, the reduction in urinary αKlotho is more dramatic than that in serum and may represent a more sensitive marker for CKD.

(248) Both IP-IB and the commercial ELISA detected the low urine αKlotho in CKD, although the absolute levels of αKlotho are much higher with the ELISA assay and the percent reduction is not the same as with the IP-IB assay. With drastic reduction in urinary αKlotho levels in CKD, the two assays yielded the same conclusion with quantitative differences. The situation in serum is different. Although there is overall positive correlation, the comparison of the two assays completely segregated into two groups (FIG. 5B). The fresh samples showed higher readings for the ELISA while the stored samples yielded extremely low results with the ELISA. One possibility is that the ELISA is measuring αKlotho and some other reacting proteins in fresh samples. While the IP-IB assay did lose some efficacy with repeated freeze-thaw, this is a much more serious problem with the ELISA.

(249) Another advantage of the IP-IB assay is that it can measure αKlotho in both humans and rodents equally well, whereas the use of the currently available ELISA in rodent can potentially be problematic as it detects very high circulating αKlotho levels in rats with CKD which is a state of pan-αKlotho deficiency. [68]

Example 8

(250) Additional CDR sequences are provided in Table 2. Homologous mutations were introduced at each amino acid position, meaning that for each position either the original amino acid was retained or the closest “homolog” to that amino acid (e.g. conservative amino acid change) was introduced and a new Fab-phage library was constructed. Selections were performed using the new library using the alphaKlotho-FGFR1c complex as an antigen. Clones that bound to the antigen were isolated and sequenced and are shown in Table 2. The binding affinity is expected to be similar or better than Sb106.

Example 9

(251) Human Studies

(252) Nine human subjects (49.066.2 years) who underwent right heart catheterization were enrolled for this study. During right heart catheterization, suprarenal and infrarenal vena caval blood samples were obtained and sera were immediately separated after centrifugation at 4° C. and stored at −80° C. for future study. Serum αKlotho was determined by immunoprecipitation-immunoblot assay described herein. Briefly, 0.1 ml serum was immunoprecipitated with a synthetic anti-αKlotho Fab (sb106) and immune complex was eluted with Laemmli sample buffer, and subject to immunoblot with KM2076 antibody. The specific signals on the autoradiograms based on 130 kD mobility were quantified with ImageJ Program (National Institutes of Health (NIH), Bethesda, Md.).

(253) Animal Studies

(254) αKlotho hypomorphic (kl/kl) mice, kl/kl mice and their wild-type (WT) littermates were maintained at the Animal Research Center at the University of Texas Southwestern Medical Center. Currently all mice are 129 S1/SVImJ (129 SV) background age from 6 to 8 weeks. Normal Sprague-Dawley (SD) rats (220-250 g body weight) were purchased from Charles River Laboratories (Wilmington, Mass.). For αKlotho clearance study, rats underwent bilateral nephrectomy (anephric rats) or laparotomy with manual manipulation of the kidneys (sham rats). Rats or mice were intravenously or intraperitoneally injected once with labeled full extracellular domain of recombinant mouse αKlotho protein (rMKI) (R&D Systems, Minneapolis, Minn.) at a dose of 0.1 mg/kg body weight. To examine if secretases modulate blood αKlotho, doxycline hyclate (Sigma-Aldrich, St. Louis, Mo.), an α-secretase inhibitor at 25 mg/kg/day, and/or β-secretase inhibitor III (Calbiochem, Billerica, Mass.) at 2.5 mg/kg/day were intraperitoneally injected into normal WT mice daily for 2 days, blood and kidneys were harvested at 48 hours to determine serum and renal αKlotho.

(255) Antibodies

(256) Rat monoclonal anti-human Klotho antibody, KM20761,2 was used for immunoblotting and immunoelectron microscopy; and the synthetic anti-αKlotho antibody sb10663 was used for immunoprecipitation of serum Klotho.

(257) Clearance of Labeled αKlotho in Rats and Mice

(258) Normal Munich Wistar rats (220-250 g BW) were anesthetized with Inactin (100 mg/kg BW), and a bonus of labeled αKlotho was injected through the jugular vein (0.1 mg/kg BW). For the experiment of injection of 125I-labeled αKlotho or 125I-labeled albumin, fluid collection by free-flow micropuncture of Bowman's space, and proximal convoluted tubules was performed using published methods. In brief, the left kidney was exposed, and the left ureter was catheterized for urine collection. Proximal tubules were identified by their characteristic configuration after lissamine green dye injection and punctured with glass capillaries. The volume of fluid was measured in a calibrated constant-bore glass capillary. The radioactivity of fluids was determined by scintillation accounting and normalized to fluid volume. At specified time points, blood was drawn from retro-orbital venous sinus, and spot urine was collected. 125I-labeled αKlotho or 125I-labeled albumin in collected urine and serum was quantified by scintillation counting. Homogenates of different organs were made and radioactivity in organ homogenates was measured by scintillation counting, and normalized to protein in organ homogenates. Organ sections (10 mm) were subjected to autoradiography.

(259) Immunoelectron Microscopy

(260) Mouse recombinant Klotho protein (0.1 mg/kg BW) was intraperitoneally injected once into kl/kl mice and mice were sacrificed 24 hours after injection. Kidneys were harvested and fixed with 2.5% paraformaldehyde via aortic perfusion, removed, and post-fixed in 4% paraformaldehyde (4° C. for 4 hours). Immunogold labeling of ultrathin frozen tissue sections was performed as described.21 Kidney cortex was infiltrated with 2.3 M sucrose overnight, frozen in liquid nitrogen, and 70-80-nm-thick sections were made (Ultramicrotome Reichert Ultracut E; Leica Microsystems, Wetzlar, Germany) and mounted on Formvar-coated nickel grids. The sections were incubated with KM2076 antibody and followed by incubation with gold conjugated protein A (10-nm gold particles, Sigma-Aldrich) for 60 minutes. After staining with uranyl acetate, sections were visualized with Jeol 1200 EX transmission electron microscope (Jeol Ltd., Akishima, Japan).

(261) Results

(262) The role of the kidney in circulating αKlotho production and handling was examined. Serum levels of αKlotho protein in suprarenal and infrarenal vena cava of normal rats by direct puncture and human subjects who underwent right heart catheterization. All patients had eGFR>60 ml/min/1.73 m.sup.2. Similar infrarenal-to-suprarenal increment in caval αKlotho level was observed in both rat and human serum samples. Serum αKlotho levels were plotted against serum erythropoietin, a well-known renal-derived hormone, and it was found that as serum erythropoietin rose, and serum creatinine (SCr) decreased from infrarenal-to-suprarenal inferior vena cava, whereas αKlotho increased indicating that the kidney secretes αKlotho into the circulation.

(263) When both kidneys were removed from rats, serum αKlotho level dropped significantly to about half the normal level in one day. The anephric state did not permit studies to continue for longer than 40-50 hours.

(264) The method of αKlotho clearance from circulation was investigated. The levels of circulating exogenous αKlotho protein in anephric rats were similar to those in normal rats immediately after injection, but the half-life of exogenous αKlotho protein in normal rats was much shorter than that in anephric rats and the half-life of endogenous αKlotho upon nephrectomy closely approximates that of exogenous αKlotho in the anephric rats. Further experiments examining the anatomic fate of intravenous injected exogenous labeled αKlotho supported that the kidney may be a major organ of αKlotho uptake as well as its excretion.

(265) Injected labeled αKlotho protein was prominently distributed in the kidney and spleen, sparsely in the heart, and not detectable in aorta, brain, and muscle. Further experiments tracking clearance of radioactively labelled exogenous αKlotho in serum and urine, supported that αKlotho protein is cleared from blood through the kidney to the urine.

(266) Based on these and further experiments, it was determined that the (1) the kidney produces and releases soluble αKlotho into the systemic circulation by secretases-mediated shedding of the ectodomain of αKlotho, (2) the kidney is an important organ to clear soluble αKlotho from the circulation, (3) αKlotho traffics across renal tubules from basolateral to intracellular location and is then secreted across the apical membrane into the urinary lumen.

Example 10: Identification of Additional Antibodies that Bind αKlotho

(267) The original antibody reagent to αKlotho, sb106 (clone 48), as well as CDR variants derived from sb106, all bind to a single common epitope. To establish a detection assay, one needs antibodies with different epitopes, as one surface/epitope is used to isolate or capture the protein while a second, distinct epitope is needed for the detection reagent. Thus another selection campaign was undertaken to identify antibodies which bind to epitopes different and distinct from that of sb106. These antibodies to αKlotho were identified by antibody-phage display selections performed on the extracellular domain (ECD) of human αKlotho while in the presence of saturating levels of sb106 Fab (50 μg/ml). The protein purchased from R&D Systems (5334-KL) covers amino acids E34-S981 with a 6-His tag attached at the C-terminus.

(268) In total, 31 new antibodies from a synthetic antibody library (Persson et al, 2013 J Mol Biol) were identified and shown to bind αKlotho, in the presence and absence of the first αKlotho antibody, sb106 (FIG. 9). CDRs of these clones are shown in Table 3 (amino acid sequence in 3A and nucleotide sequences in 3B & 3C) and examples of full-length sequences in Table 4. The clones were first given a name, and then ID numbers. Both are shown here for reference.

(269) All sequences were sub-cloned into the Fab expression vector (RH2.2), expressed and purified. As was with the phage, all Fab clones bound to the target antigen by ELISA (FIG. 10).

Example 11: Epitope Grouping

(270) There are at least 2 new epitopes on αKlotho within this set of additional antibodies. Epitope grouping experiments were performed using a competition ELISA strategy. Given the large number of clones within this set, preliminary studies revealed 2 distinct epitopes separate from the epitope that sb106 (48) binds. Representatives of these epitopes (4804 and 4819) were then used alongside sb106 (48) for assessment of each of the clones within the set (FIG. 11). Where sb106 (48) represents epitope A, 23 of the new clones were grouped into epitope B, and 4 clones were found for epitope C (FIG. 11 and summarized in Table 5). For 3 clones (4806, 4810 and 4817) no determination was made due to problems with the phage. Clone 4828 did not show competition with any of the 3 represented epitopes.

Example 12: Affinity Estimates

(271) Affinity estimates for each of the antibodies were determined by surface plasmon resonance (SPR). Fabs were immobilized using an anti-H+L antibody and serial dilutions of αKlotho were injected. Binding curves are shown in FIG. 12 and the binding affinities (KDs) are summarized in Table 5. The affinities range from 240 μM to 8.7 nM.

Example 13: Immunoprecipitation

(272) The antibodies were assayed for their ability to immunoprecipitate αKlotho from human patient urine samples as Fabs (FIG. 13). 50 ul of human urine samples from normal volunteers where incubated within 400 ul KRH buffer with 1 μg/ml of Fab (sb173-203, sb106) overnight at 4° C. 50 ul of M2 anti-FLAG Sepharose beads were then added, and incubated for 2 hrs at 4° C. (the C-terminus of the Fab light chains contains a FLAG epitope tag). The beads were washed 3 times with 500 ul KRH buffer, and bound proteins were eluted with 2×LDS sample loading buffer containing 100 mM DTT. Immunoblot was performed with a commercial primary rat anti-Klotho antibody (KM2076) followed by a standard anti-rat IgG secondary for visualization. Super Signal West Femto substrate was used as the chemiluminescent substrate. More than half of the clones behaved as well or better than sb106.

Example 14: ELISAs

(273) Select clones, representing the new epitopes (4808 for B, and 4831 for C) were subcloned into full length IgGs, expressed and purified and further characterized alongside sb106 (48). Full length IgGs were immobilized at 1 ug/ml (capture), blocked with buffer containing 1% BSA, then incubated with either 20 ng of biotinylated αKlotho (aa34-981), 20 ng of biotinylated αKlotho (aa1-549) in capture buffer (Tris buffered saline pH 7.4+0.1% BSA+0.05% TWEEN™20 detergent) or capture buffer only (BSA) at room temperature for 1 hour. After washing with PBS+0.05% TWEEN™20 detergent, the captured biotinylated αKlotho was detected using an HRP-streptavidin reagent. Colorimetric HRP reagents allow for absorbance readings at 450 nm. All three IgGs predictably captured αKlotho from solution (FIG. 14), however only 4831 was able to detect a truncated version of ECD of αKlotho, further characterizing the difference in epitope recognition from sb106.

(274) Finally, a matrix of ELISA experiments were performed such that each of the 3 distinct epitope clones were used as capture and detection antibodies pairwise which each other for the detection of αKlotho in solution (FIG. 15). Full length IgGs were immobilized at 1 ug/ml (capture), blocked with PBS+5% BSA, then incubated with 5 nM of αKlotho at room temperature for 1 hour. After washing with PBS+0.05% TWEEN™20 detergent, the samples where then incubated with biotinylated preps of the same IgGs (dectrion, *b) for 30 minutes at room temperature. After washing again, bound IgGs were detected using an HRP-streptavidin reagent. Colorimetric HRP reagents allow for absorbance readings at 450 nm. Duplicate data points are shown. Grey highlights self against self. These experiments show that the 3 epitopes the antibodies bind are suitably compatible with each other for the desired purpose of using in a diagnostic kit.

Example 15: Cross-Reactivity to Human and Mouse αKlotho

(275) Fab ELISA using both human and mouse αKlotho was carried out for assessing cross-reactivity to human and mouse αKlotho (FIG. 16). Fabs (5 ug/ml) were incubated with immobilized αKlotho human, mouse, or neutravidin (NA) and SBA as negative controls. After washing off unbound Fab, bound Fab were detected using an HRP-conjugated anti-Flag antibody (Fabs have Falg tag on the end of their light chains). Colorimetric HRP reagents allow for absorbance readings at 450 nm.

(276) Estimated affinities against human and mouse antigen for select αKlotho Fabs were obtained by surface plasmon resonance on a ProteOn XPR36 (FIG. 17). Fabs were captured using an anti-IgG(H+L) antibody and serial dilutions of αKlotho were injected. Binding curves were fitted to the Langmuir model. (A) Determined Kon, Koff and KD values. (B) and (C) Binding curves for human and mouse antigen respectively.

Example 16: Fab Binding to αKlotho-FGFR1c Complex

(277) Fab proteins (clones 4804-4824, 4826-4834) were adsorbed to an ELISA plate (Maxisorb) at a concentration of 15 ug/ml, for 1 hour at room temperature, and then blocked with PBS+0.5% BSA for 1 hour at room temperature. The plate was washed with PBS+0.05% TWEEN™20 detergent and then incubated with 2 ug/ml of the following proteins: αKlotho (Fc dimer), complex of αKlotho-FGFR1c (Fc complex), Fc only, or PBS, at room temperature for 1 hour. Unbound antigen was washed away, with 6 washes of PBS+0.05% TWEEN™20 detergent, and then the wells were incubated with a goat-anti-mouse (mG2a, Jackson ImmunoResearch Laboratories) for 30 minutes at room temperature. Unbound anti-mouse antibody was washed away, with 6 washes of PBS+0.05% TWEEN™20 detergent, and then the wells were incubated with an anti-goat-HRP reagent for 30 minutes at room temperature. Unbound anti-goat-HRP antibody was washed away, with 6 washes of PBS+0.05% TWEEN™20 detergent, and then colourmetric HRP reagents (TMB substrate and stop solution) were used and absorbance was read at 450 nm.

(278) The results show that the αKlotho antibodies (clones 4804-4824, 4826-4834) bind αKlotho alone and in complex (αKlotho-FGFR1c). sb106 (clone 48) was used as a control for binding to both αKlotho alone and in complex (αKlotho-FGFR1c).

(279) TABLE-US-00006 TABLE 1 Characteristics of human subjects Serum Gender PCr Serum Pi HCO.sub.3.sup.− Serum PTH FGF23 25(OH)Vitamin D Etiology of CKD Subject n Age (M/F) (mg/dl) (mg/dl) (mM) (pg/ml) (pg/ml) (ng/ml) (number subjects*) Healthy 34 50 ± 17 14/20 0.8 ± 0.2.sup.  3.6 ± 0.6 23 ± 2 59 ± 25 30 ± 10.sup.   32 ± 10 None CKD1 10 43 ± 10 7/3 0.8 ± 0.1.sup.  3.9 ± 0.5 25 ± 2 47 ± 19 61 ± 23.sup.  26 ± 7 DM (1) HTN (3) GN (7) CKD2 11 50 ± 22 4/7 1.1 ± 0.2.sup.  3.6 ± 0.5 26 ± 2 56 ± 22 70 ± 27.sup.   21 ± 13 DM (2), HTN (4), GN (4), RK (3) CKD3 10 57 ± 17 5/5 1.7 ± 0.4.sup.# 3.2 ± 0.8 25 ± 3 86 ± 51 79 ± 18.sup.# 25 ± 8 DM (3), HTN (7), GN (3), IN (1) CKD4 14 62 ± 13 8/6 2.7 ± 0.6.sup.# 3.5 ± 0.9 24 ± 3 .sup. 202 ± 101.sup.# 204 ± 173.sup.# 21 ± 8 DM (4), HTN (10), GN (3), RK (1) CKD5 11 62 ± 12 5/6 4.7 ± 2.0.sup.# .sup. 5.1 ± 3.5.sup.# 21 ± 3 .sup. 223 ± 188.sup.# 580 ± 427.sup.# .sup. 21 ± 9.sup.# DM (7), HTN (7), GN (2) Dialysis 14 50 ± 12 6/8 11.9 ± 15.6.sup.# .sup. 4.8 ± 1.7.sup.# 22 ± 5 .sup. 500 ± 650.sup.# 760 ± 286.sup.# 26 ± 8 DM (7), HTN (10), GN (5), PKD (1) n = number of subjects; PCr = plasma creatinien; GFR = estimated glomerular filtration rate; Serum Pi = serum phosphorus; Serum HCO3− = serum bicarbonate PTH = parathyroid hormone; FGF23+ Fibroblast growth factor 23; DM = Diabetes mellitus; HTN = hypertension; GN = glomerulonephritis; RK = Remnant kidney; IN = Interstitial nephritis; PKD = Polycystic kidney disease. *Some patients carry more than one diagnosis. Results are shown as mean ± standard deviation. .sup.#p < 0.05 compared to healthy volunteers. ANOVA

(280) TABLE-US-00007 TABLE 2 CDR sequence variations (Sequences shown correspond to  positions which are variable in the selection library. Sequences listed under column L3 refer to CDR-L3 but omit the   first and second amino terminal amino acid residues and  the carboxy terminal amino acid residue of IMGT CDR-L3. Sequences listed under column H1 refer to CDR-H1 but omit the first 3 amino terminal amino acid residues of IMGT CDR-H1 and the carboxy terminal amino acid residue thereof corresponds to IMGT VH domain position 39. Sequences listed under  column H2 correspond to IMGT VH domain positions 55-66, which includes CDR-H2 and framework region residues  at positions 55 and 66. Sequences listed under column H3 refer to IMGT CDR-H3, but are lacking the first two amino  terminal and the last two carboxy terminal amino acids of IMGT CDR-H3. IMGT CDR amino acid residues per se are underlined.  Variable FR amino acid residues are not underlined.) L3 ID H1 ID H2 ID sb106 A G Y S P I 5 I S Y Y S I 6 Y I S P S Y G Y T S 7 E12 A G Y A P I 15 I A Y Y A V 16 F I A P S Y G Y S S 17 E2 A G F A P I 19 I S Y F S V 20 F I S P A Y G F T A 21 C12 A A F A P V 23 I A F Y A V 24 F V S A S Y G Y T S 25 E3 S A F S P V 27 V S F Y S I 28 Y V A P A Y G Y S A 29 D7 A A F S P V 31 V S F F S I 32 Y I S P S Y G Y S S 33 E4 A G F A P I 35 I S Y Y A V 36 F V S P A Y G F S S 37 E6 A A F A P V 39 F S S S S I 40 F V S P A Y G F T A 41 E10 A G Y A P V 43 I S Y Y S I 44 Y I S P S F G Y T A 45 C9 A A F A P V 47 I S Y Y S I 48 F I A P A F G Y S S 49 Dll A A F S P I 51 I A Y F S I 52 Y V S P A Y G Y T S 53 El A G Y A P I 55 I A F Y S I 56 Y V S P A Y A Y T A 57 D5 A G F A P I 59 V S F Y S I 60 S I S S S Y G Y T Y 61 D12 A G F A P V 63 V S F F S I 64 S I S S S Y G Y T Y 65 E8 S A Y A P V 67 V A F Y S I 68 F I A P S Y G Y S A 69 Ell A G F A P V 71 I A F F S I 72 F V S P A Y G Y T A 73 Fl S A Y S P V 75 I A F Y S I 76 F V S P A Y A Y S A 77 D1 A A F A P V 79 F S S S S I 80 Y I S P A Y G Y S A 81 C10 V S Y Y S I 83 S I S S S Y G Y T S 84 D6 S A F S P V 86 I A F F A V 87 F V S P S F G Y S S 88 D8 A A F A P V 90 V A F Y S I 91 Y I S P A Y A Y S A 92 C11 I S Y F S V 94 Y V S P S F A F S S 95 F2 A A Y A P V 97 V A F Y S V 98 S I S S S Y G Y T A 99 D9 A A Y A P V 101 I A Y Y A V 102 F V S P A Y G F T S 103 E5 A A F A P V 105 I A F Y A V 106 Y V A P P Y A Y S A 107 D10 A A Y A P V 109 V S F Y S I 110 Y I S P A Y G Y T S 111 D3 S A Y S P V 113 V A Y Y S I 114 Y I S P A F G Y S S 115 D4 A A Y A P I 117 V A F Y A V 118 S I S S S Y G Y T Y 119 H3 ID sb106 Y Y V Y A S H G W A G Y G M 8 E12 F Y V Y A S N A W A G Y G M 18 E2 F Y V Y A A N G W A G Y G M 22 C12 F Y V Y A A N G W A G Y G M 26 E3 F Y V Y A A H G W A G Y G M 30 D7 F Y V Y A A N G W A G Y G M 34 E4 F F V Y A A H G W A G Y G M 38 E6 F F V Y S S H G W A G Y G M 42 E10 F Y V Y S S H G W A G Y G M 46 C9 F Y V Y A A N G W A G Y G M 50 D11 F Y V Y S A N G W A G Y G M 54 El F Y V Y A A H G W A G Y G M 58 D5 F Y V Y A S N G W A G Y G M 62 D12 F Y V Y S S H G W A G Y G M 66 E8 F F V Y A A H G W A G Y G M 70 Ell F Y V Y S A N G W A G Y G M 74 Fl F Y V Y S A N G W A G Y G M 78 D1 F F V Y S A N A W S G Y G M 82 C10 F F V Y A A H G W A G Y G M 85 D6 F Y V Y A A H G W A G Y G M 89 D8 Y F V Y A S N G W A G Y G M 93 C11 F F V Y S A H G W A G Y G M 96 F2 F Y V V A A H G W A G Y G M 100 D9 F Y V V S S H G W A G F G M 104 E5 F Y V V S A H G W A G Y G M 108 D10 F Y V V S A H G W A G Y G M 112 D3 F Y V V A A N G W A G Y G M 116 D4 Y Y V V A A H G W A G Y G M 120

(281) TABLE-US-00008 TABLE 2A SEQ ID NO: 1 X.sub.1X.sub.2X.sub.3X.sub.4PX.sub.5 wherein X.sub.1 is A or S, X.sub.2 is G or A, X.sub.3 is Y or F, X.sub.4 is S or A, X.sub.5 is I or V SEQ ID NO: 2 X.sub.6X.sub.7X.sub.8X.sub.9X.sub.10X.sub.11 wherein X.sub.6 is I or V, X.sub.7 is S or A, X.sub.8 is Y, F or S, X.sub.9 is Y, F or S, X.sub.10 is S or A and X.sub.11 is I or V SEQ ID NO: 3 X.sub.12X.sub.13X.sub.14X.sub.15X.sub.16X.sub.17X.sub.18X.sub.19X.sub.20X.sub.21 wherein X.sub.12 is Y, F or S, X.sub.13 is I or V, X.sub.14 is S or A, X.sub.15 is P or S, X.sub.16 is S or A, X.sub.17 is Y or F, X.sub.18 is G or A, X.sub.19 is Y or F, X.sub.20 is T or Sand X.sub.21 is S, A or Y SEQ ID NO: 4 X.sub.22X.sub.23VYX.sub.24X.sub.25X.sub.26X.sub.27WX.sub.28GX.sub.29GM wherein X.sub.22 is Y or F, X.sub.23 is Y or F, X.sub.24 is A or S, X.sub.25 is S or A, X.sub.26 is H or N, X.sub.27 is G or A, X.sub.28 is A or S and X.sub.29 is Y or F

(282) TABLE-US-00009 TABLE 3A CDR amino acid sequences for additional aKlotho antibodies  (The carboxy terminal amino acid residue of the sequences listed under column CDR-H1 corresponds to IMGT  VH domain position 39; and the amino terminal residue and the carboxy terminal residue of the sequences listed  under column CDR-H2 correspond to IMGT VH domain positions 55 and 66, respectively. Amino acid residues of IMGT CDRs  are underlined, amino acid residues of IMGT framework regions are not underlined, and residues at IMGT positions  which were randomized in the selection library are bold.) clone SEQ CDR SEQ SEQ  SEQ  SEQ  SEQ Epit- ID ID ID ID ID ID ID name ome CDR-L1 NO: L2 NO: CDR-L3 NO: CDR-H1 NO: CDR-H2 NO: CDR-H3 NO: 4804 sb173 B QSVSSA 140 SAS 141 QQSSYSLIT 142 GFNLYSYSI 157 YISSSSGSTY 175 ARGWGGGYWFYPVYGIDY 196 4805 sb174 g QSVSSA 140 SAS 141 QQSSGWYHFLFT 143 GFNLSYYSM 158 SISSYYGSTY 176 ARGGGYYSGPYAGFDY 197 4806 sb175 ND QSVSSA 140 SAS 141 QQSSYSLIT 142 GFNISSSSI 159 YISSSYSSTS 177 ARSSGGGYYHWWVVPYAMDY 198 4807 sb176 g QSVSSA 140 SAS 141 QQSSYSLIT 142 GFNLSSSYM 160 SIYPSYGSTS 178 ARGVVPSYYYWFWPYGAIDY 199 4808 sb177 g QSVSSA 140 SAS 141 QQSSYSLIT 142 GFNFSSSSI 161 SISSSYGYTY 179 ARPYSAYYWAWYGPGGALDY 200 4809 sb178 g QSVSSA 140 SAS 141 QQSGWAYHPIT 144 GFNIYSYYI 162 SIYSYYGSTS 180 ARSGPWAWYGLDY 201 4810 sb179 ND QSVSSA 140 SAS 141 QQSSYSLIT 142 GFNLSSSSI 163 YISPSYGSTS 181 ARSGYYSGAYWHWWVVPYAMDY 202 4811 sb180 g QSVSSA 140 SAS 141 QQGYALFT 145 GFNLYYSYM 164 SIYSSSSYTS 182 ARSPSWWVSYHSALDY 203 4812 sb181 g QSVSSA 140 SAS 141 QQGYWLFT 146 GFNLSSYSM 165 SISSYSGYTS 183 ARSYSWWWSVSYAMDY 204 4813 sb182 g QSVSSA 140 SAS 141 QQAAWGGAPIT 147 GFNLYSSSI 166 SISPYSGYTY 184 ARYYSGWYSPAWWYGIDY 205 4814 sb183 C QSVSSA 140 SAS 141 QQSSPPIT 148 GFNLYSYSM 167 SISPYSGYTY 184 ARSFFPYSYWVYGGGMDY 206 4815 sb184 g QSVSSA 140 SAS 141 QQSSYSLIT 142 GFNFSSSSI 161 SISSSYGYTY 179 ARGFSSSAHWYWSWYGPGGGFDY 207 4816 sb185 g QSVSSA 140 SAS 141 QQSSYSLIT 142 GFNFSSSSI 161 SISSSYGYTY 179 ARGWYAAYSVYWFGGHASYGLDY 208 4817 sb186 ND QSVSSA 140 SAS 141 QQSSYSLIT 142 GFNFSSSSI 161 SISSSYGYTY 179 ARGYPSSGAAWFWFSHPGSAMDY 209 4818 sb187 g QSVSSA 140 SAS 141 QQPYSPIT 149 GFNISYSSI 168 SISPYSGYTY 184 ARSGHSVYWWWSHFGMDY 210 4819 sb188 C QSVSSA 140 SAS 141 QQGSYYWWSPIT 150 GFNIYSYSM 169 SIYPSSSYTY 185 ARAGYFSAYYSSWGAMDY 211 4820 sb189 g QSVSSA 140 SAS 141 QQSPWGAYLIT 151 GFNISSYYM 170 SIYSSYSSTY 186 ARGAWAMDY 212 4821 sb190 g QSVSSA 140 SAS 141 QQSSYSLIT 142 GFNLYYSYM 164 SISPYSGSTY 187 ARSGFSSWWWVVSYAFDY 213 4822 sb191 g QSVSSA 140 SAS 141 QQSSYSLIT 142 GFNFSSSSI 161 SISSSYGYTY 179 ARAGWYSSWWWSAWGAGGGLDY 214 4823 sb192 g QSVSSA 140 SAS 141 QQSSYSLIT 142 GFNFSSSSI 161 YIYSSYGYTY 188 ARAAHYGYYVHSGLDY 215 4824 sb193 g QSVSSA 140 SAS 141 QQSSYSLIT 142 GFNLSSSSI 163 SISSSYGYTY 179 ARHGYGYFFWGYYGPGSAMDY 216 4825 sb194 g QSVSSA 140 SAS 141 QQSSYSLIT 142 GFNLYSSSI 166 SISPYYSYTY 189 ARSVYSWYWSSWGPGSALDY 217 4826 sb195 g QSVSSA 140 SAS 141 QQAGFFSYPIT 152 GFNISSYYM 170 SISSSYGYTY 179 ARGYPASSYYYPSSALDY 218 4827 sb196 g QSVSSA 140 SAS 141 QQSSYSLIT 142 GFNFSSSSI 161 YISSSSGSTS 190 ARAYHSYFYGSYWSYGWAGALDY 219 4828 sb197 ND QSVSSA 140 SAS 141 QQSSYSLIT 142 GFNFSSSSI 161 SISSSYGYTY 179 ARYVVGGWWYHYGMDY 220 4829 sb198 g QSVSSA 140 SAS 141 QQGGGLIT 153 GFNISSYYI 171 SIYSSYGYTS 191 ARYSWSPYWWWAYSGLDY 221 4830 sb199 C QSVSSA 140 SAS 141 QQYSWYWYSPIT 154 GFNIYYSSI 172 SIYPYYSYTY 192 ARSVASALDY 222 4831 sb200 C QSVSSA 140 SAS 141 QQYSYYYASPIT 155 GFNIYSSSI 173 SIYPYSGYTY 193 ARYSWGSSFWPGYGFDY 223 4832 sb201 B QSVSSA 140 SAS 141 QQSSYSLIT 142 GFNFSSSSI 161 YISSSYGYTS 194 ARASGWFSHFYPAAVSGMDY 224 4833 sb202 B QSVSSA 140 SAS 141 QQSSHGHYPIT 156 GFNLSSYYM 174 SIYPSYSSTY 195 ARSSYSVYFWWYVSAMDY 225 4834 sb203 B QSVSSA 140 SAS 141 QQSSYSLIT 142 GFNFSSSSI 161 SISSSYGYTY 179 ARAVSFYYWAWYGPGFAMDY 226

(283) TABLE-US-00010 TABLE 3B Light chain CDR nucleotide sequences for additional αKlotho antibodies SEQ  SEQ  SEQ  ID ID ID clone ID name Epitome CDR-L1 NO: CDR-L2 NO: CDR-L3 NO: 4804 sb173 B CAGTCCGTGTCCAGCGCT 227 TCGGCATCC 228 CAGCAATCTTCTTATTCTCTGATCACG 229 4805 sb174 B CAGTCCGTGTCCAGCGCT 227 TCGGCATCC 228 CAGCAATCTTCTGGTTGGTACCATTTCCTGTTCACG 230 4806 sb175 ND CAGTCCGTGTCCAGCGCT 227 TCGGCATCC 228 CAGCAATCTTCTTATTCTCTGATCACG 229 4807 sb176 B CAGTCCGTGTCCAGCGCT 227 TCGGCATCC 228 CAGCAATCTTCTTATTCTCTGATCACG 229 4808 sb177 B CAGTCCGTGTCCAGCGCT 227 TCGGCATCC 228 CAGCAATCTTCTTATTCTCTGATCACG 229 4809 sb178 B CAGTCCGTGTCCAGCGCT 227 TCGGCATCC 228 CAGCAATCTGGTTGGGCTTACCATCCGATCACG 231 4810 sb179 ND CAGTCCGTGTCCAGCGCT 227 TCGGCATCC 228 CAGCAATCTTCTTATTCTCTGATCACG 229 4811 sb180 B CAGTCCGTGTCCAGCGCT 227 TCGGCATCC 228 CAGCAAGGTTACGCTCTGTTCACG 232 4812 sb181 B CAGTCCGTGTCCAGCGCT 227 TCGGCATCC 228 CAGCAAGGTTACTGGCTGTTCACG 233 4813 sb182 B CAGTCCGTGTCCAGCGCT 227 TCGGCATCC 228 CAGCAAGCTGCTTGGGGTGGTGCTCCGATCACG 234 4814 sb183 C CAGTCCGTGTCCAGCGCT 227 TCGGCATCC 228 CAGCAATCTTCTCCGCCGATCACG 235 4815 sb184 B CAGTCCGTGTCCAGCGCT 227 TCGGCATCC 228 CAGCAATCTTCTTATTCTCTGATCACG 229 4816 sb185 B CAGTCCGTGTCCAGCGCT 227 TCGGCATCC 228 CAGCAATCTTCTTATTCTCTGATCACG 229 4817 sb186 ND CAGTCCGTGTCCAGCGCT 227 TCGGCATCC 228 CAGCAATCTTCTTATTCTCTGATCACG 229 4818 sb187 B CAGTCCGTGTCCAGCGCT 227 TCGGCATCC 228 CAGCAACCGTACTCTCCGATCACG 236 4819 sb188 C CAGTCCGTGTCCAGCGCT 227 TCGGCATCC 228 CAGCAAGGTTCTTACTACTGGTGGTCTCCGATCACG 237 4820 sb189 B CAGTCCGTGTCCAGCGCT 227 TCGGCATCC 228 CAGCAATCTCCGTGGGGTGCTTACCTGATCACG 238 4821 sb190 B CAGTCCGTGTCCAGCGCT 227 TCGGCATCC 228 CAGCAATCTTCTTATTCTCTGATCACG 229 4822 sb191 B CAGTCCGTGTCCAGCGCT 227 TCGGCATCC 228 CAGCAATCTTCTTATTCTCTGATCACG 229 4823 sb192 B CAGTCCGTGTCCAGCGCT 227 TCGGCATCC 228 CAGCAATCTTCTTATTCTCTGATCACG 229 4824 sb193 B CAGTCCGTGTCCAGCGCT 227 TCGGCATCC 228 CAGCAATCTTCTTATTCTCTGATCACG 229 4825 sb194 B CAGTCCGTGTCCAGCGCT 227 TCGGCATCC 228 CAGCAATCTTCTTATTCTCTGATCACG 229 4826 sb195 B CAGTCCGTGTCCAGCGCT 227 TCGGCATCC 228 CAGCAAGCTGGTTTCTTCTCTTACCCGATCACG 239 4827 sb196 B CAGTCCGTGTCCAGCGCT 227 TCGGCATCC 228 CAGCAATCTTCTTATTCTCTGATCACG 229 4828 sb197 ND CAGTCCGTGTCCAGCGCT 227 TCGGCATCC 228 CAGCAATCTTCTTATTCTCTGATCACG 229 4829 sb198 B CAGTCCGTGTCCAGCGCT 227 TCGGCATCC 228 CAGCAAGGTGGTGGTCTGATCACG 240 4830 sb199 C CAGTCCGTGTCCAGCGCT 227 TCGGCATCC 228 CAGCAATACTCTTGGTACTGGTACTCTCCGATCACG 241 4831 sb200 C CAGTCCGTGTCCAGCGCT 227 TCGGCATCC 228 CAGCAATACTCTTACTACTACGCTTCTCCGATCACG 242 4832 sb201 B CAGTCCGTGTCCAGCGCT 227 TCGGCATCC 228 CAGCAATCTTCTTATTCTCTGATCACG 229 4833 sb202 B CAGTCCGTGTCCAGCGCT 227 TCGGCATCC 228 CAGCAATCTTCTCATGGTCATTACCCGATCACG 243 4834 sb203 B CAGTCCGTGTCCAGCGCT 227 TCGGCATCC 228 CAGCAATCTTCTTATTCTCTGATCACG 229

(284) TABLE-US-00011 TABLE 3C Heavy chain CDR nucleotide sequences for additional αKlotho antibodies (sequences encoding IMGT CDR residues are underlined, sequences encoding IMGT framework region residues are not underlined) SEQ SEQ SEQ clone ID ID ID ID name Epitome CDR-H1 NO: CDR-H2 NO: CDR-H3 NO: 4804 sb173 B GGCTTCAACCTCTATTCTTATTC 244 TATATTTCTTCTTCTTCTGGCTCTACTTAT 263 GCTCGCGGTTGGGGTGGTGGTTACTGGTTCTACCCGGTTTACGGTATT 286 TATC GACTAC 4805 sb174 B GGCTTCAACCTCTCTTATTATTC 245 TCTATTTCTTCTTATTATGGCTCTACTTAT 264 GCTCGCGGTGGTGGTTACTACTCTGGTCCGTACGCTGGTTTTGACTAC 287 TATG 4806 sb175 ND GGCTTCAACATCTCTTCTTCTTC 246 TATATTTCTTCTTCTTATAGCTCTACTTCT 265 GCTCGCTCTTCTGGTGGTGGTTACTACCATTGGTGGGTTGTTCCGTAC 288 TATC GCTATGGACTAC 4807 sb176 B GGCTTCAACCTCTCTTCTTCTTA 247 TCTATTTATCCTTCTTATGGCTCTACTTCT 266 GCTCGCGGTGTTGTTCCGTCTTACTACTACTGGTTCTGGCCGTACGGT 289 TATG GCTATTGACTAC 4808 sb177 B GGCTTCAACTTTTCTTCTTCTTC 248 TCTATTTCTTCTTCTTATGGCTATACTTAT 267 GCTCGCCCGTACTCTGCTTACTACTGGGCTTGGTACGGTCCGGGTGGT 290 TATA GCTTTGGACTAC 4809 sb178 B GGCTTCAACATCTATTCTTATTA 249 TCTATTTATTCTTATTATGGCTCTACTTCT 268 GCTCGCTCTGGTCCGTGGGCTTGGTACGGTTTGGACTAC 291 TATC 4810 sb179 ND GGCTTCAACCTCTCTTCTTCTTC 250 TATATTTCTCCTTCTTATGGCTCTACTTCT 269 GCTCGCTCTGGTTACTACTCTGGTGCTTACTGGCATTGGTGGGTTGTTC 292 TATC CGTACGCTATGGACTAC 4811 sb180 B GGCTTCAACCTCTATTATTCTTA 251 TCTATTTATTCTTCTTCTAGCTATACTTCT 270 GCTCGCTCTCCGTCTTGGTGGGTTTCTTACCATTCTGCTTTGGACTAC 293 TATG 4812 sb181 B GGCTTCAACCTCTCTTCTTATTC 252 TCTATTTCTTCTTATTCTGGCTATACTTCT 271 GCTCGCTCTTACTCTTGGTGGTGGTCTGTTTCTTACGCTATGGACTAC 294 TATG 4813 sb182 B GGCTTCAACCTCTATTCTTCTTC 253 TCTATCTCTCCTTATTCTGGCTATACTTAT 272 GCTCGCTACTACTCTGGTTGGTACTCTCCGGCTTGGTGGTACGGTATT 295 TATC GACTAC 4814 sb183 C GGCTTCAACCTCTATTCTTATTC 254 TCTATTTCTCCTTATTCTGGCTATACTTAT 273 GCTCGCTCTTTCTTCCCGTACTCTTACTGGGTTTACGGTGGTGGTATGG 296 TATG ACTAC 4815 sb184 B GGCTTCAACTTTTCTTCTTCTTC 248 TCTATTTCTTCTTCTTACGGTTACACTTAC 274 GCTCGCGGTTTCTCTTCTTCTGCTCATTGGTACTGGTCTTGGTACGGTC 297 TATA CGGGTGGTGGTTTTGACTAC 4816 sb185 B GGCTTCAACTTTTCTTCTTCTTC 248 TCTATTTCTTCTTCTTATGGCTATACTTAT 267 GCTCGCGGTTGGTACGCTGCTTACTCTGTTTACTGGTTCGGTGGTCAT 298 TATA GCTTCTTACGGTTTGGACTAC 4817 sb186 ND GGCTTCAACTTTTCTTCTTCTTC 248 TCTATTTCTTCTTCTTATGGCTATACTTAT 267 GCTCGCGGTTACCCGTCTTCTGGTGCTGCTTGGTTCTGGTTCTCTCATC 299 TATA CGGGTTCTGCTATGGACTAC 4818 sb187 B GGCTTCAACATTTCTTACTCTTC 255 TCTATTTCTCCTTATTCTGGCTATACTTAT 273 GCTCGCTCTGGTCATTCTGTTTACTGGTGGTGGTCTCATTTCGGTATGG 300 TATT ACTAC 4819 sb188 C GGCTTCAACATCTATTCTTATTC 256 TCTATTTATCCTTCTTCTAGCTATACTTAT 275 GCTCGCGCTGGTTACTTCTCTGCTTACTACTCTTCTTGGGGTGCTATGG 301 TATG ACTAC 4820 sb189 B GGCTTCAACATCTCTTCTTATTA 257 TCTATTTATTCTTCTTATAGCTCTACTTAT 276 GCTCGCGGTGCTTGGGCTATGGACTAC 302 TATG 4821 sb190 B GGCTTCAACCTCTATTATTCTTA 251 TCTATTTCTCCTTATTCTGGCTCTACTTAT 277 GCTCGCTCTGGTTTCTCTTCTTGGTGGTGGGTTGTTTCTTACGCTTTTG 303 TATG ACTAC 4822 sb191 B GGCTTCAACTTTTCTTCTTCTTC 248 TCTATTTCTTCTTCTTATGGCTATACTTAT 267 GCTCGCGCTGGTTGGTACTCTTCTTGGTGGTGGTCTGCTTGGGGTGCT 304 TATA GGTGGTGGTTTGGACTAC 4823 sb192 B GGCTTCAACTTTTCTTCTTCTTC 248 TATATTTATTCTTCTTATGGCTATACTTAT 278 GCTCGCGCTGCTCATTACGGTTACTACGTTCATTCTGGTTTGGACTAC 305 TATA 4824 sb193 B GGCTTCAACCTCTCTTCTTCTTC 258 TCTATTTCTTCTTCTTATGGCTATACTTAT 267 GCTCGCCATGGTTACGGTTACTTCTTCTGGGGTTACTACGGTCCGGGT 306 TATA TCTGCTATGGACTAC 4825 sb194 B GGCTTCAACCTCTATTCTTCTTC 253 TCTATTTCTCCTTATTATAGCTATACTTAT 279 GCTCGCTCTGTTTACTCTTGGTACTGGTCTTCTTGGGGTCCGGGTTCTG 307 TATC CTTTGGACTAC 4826 sb195 B GGCTTCAACATCTCTTCTTATTA 257 TCTATTTCTTCTTCTTATGGCTATACTTAT 267 GCTCGCGGTTACCCGGCTTCTTCTTACTACTACCCGTCTTCTGCTTTGG 308 TATG ACTAC 4827 sb196 B GGCTTCAACTTTTCTTCTTCTTC 248 TATATTTCTTCTTCTTCTGGCTCTACTTCT 280 GCTCGCGCTTACCATTCTTACTTCTACGGTTCTTACTGGTCTTACGGTT 309 TATA GGGCTGGTGCTTTGGACTAC 4828 sb197 ND GGCTTCAACTTTTCTTCTTCTTC 248 TCTATTTCTTCTTCTTATGGCTATACTTAT 267 GCTCGCTACGTTGTTGGTGGTTGGTGGTACCATTACGGTATGGACTAC 310 TATA 4829 sb198 B GGCTTCAACATCTCTTCTTATTA 259 TCTATTTATTCTTCTTATGGCTATACTTCT 281 GCTCGCTACTCTTGGTCTCCGTACTGGTGGTGGGCTTACTCTGGTTTG 311 TATC GACTAC 4830 sb199 C GGCTTCAACATCTATTATTCTTC 260 TCTATTTATCCTTATTATAGCTATACTTAT 282 GCTCGCTCTGTTGCTTCTGCTTTGGACTAC 312 TATC 4831 sb200 C GGCTTCAACATCTATTCTTCTTC 261 TCTATTTATCCTTATTCTGGCTATACTTAT 283 GCTCGCTACTCTTGGGGTTCTTCTTTCTGGCCGGGTTACGGTTTTGACT 313 TATC AC 4832 sb201 B GGCTTCAACTTTTCTTCTTCTTC 248 TATATTTCTTCTTCTTATGGCTATACTTCT 284 GCTCGCGCTTCTGGTTGGTTCTCTCATTTCTACCCGGCTGCTGTTTCTG 314 TATA GTATGGACTAC 4833 sb202 B GGCTTCAACCTCTCTTCTTATTA 262 TCTATTTATCCTTCTTATAGCTCTACTTAT 285 GCTCGCTCTTCTTACTCTGTTTACTTCTGGTGGTACGTTTCTGCTATGG 315 TATG ACTAC 4834 sb203 B GGCTTCAACTTTTCTTCTTCTTC 248 TCTATTTCTTCTTCTTATGGCTATACTTAT 267 GCTCGCGCTGTTTCTTTCTACTACTGGGCTTGGTACGGTCCGGGTTTC 316 TATA GCTATGGACTAC

(285) TABLE-US-00012 TABLE 3D Light chain CDR-L3 amino acid sequences - antibodies binding epitope B of αKlotho clone ID name CDR-L3 SEQ ID NO. Generic formula 4804 sb173 QQSSYSLIT 142 4807 sb176 QQSSYSLIT 142 4808 sb177 QQSSYSLIT 142 4815 sb184 QQSSYSLIT 142 4816 sb185 QQSSYSLIT 142 4821 sb190 QQSSYSLIT 142 4822 sb191 QQSSYSLIT 142 4823 sb192 QQSSYSLIT 142 4824 sb193 QQSSYSLIT 142 4825 sb194 QQSSYSLIT 142 4827 sb196 QQSSYSLIT 142 4832 sb201 QQSSYSLIT 142 4834 sb203 QQSSYSLIT 142 4811 sb180 QQGYALFT 145 QQGX.sub.1X.sub.2LX.sub.3T (SEQ ID NO. 126) 4812 sb181 QQGYVVLFT 146 wherein X.sub.1 is Y or G; X.sub.2 is W, A or G and X.sub.3 is F or I 4829 sb198 QQGGGLIT 153 4813 sb182 QQAAWGGAPIT 147 QQAX.sub.1X.sub.2X.sub.3X.sub.4X.sub.5PIT (SEQ ID NO. 127) 4826 sb195 QQAGFFSYPIT 152 wherein X.sub.1 is A or G; X.sub.2 is W or F; X.sub.3 is G or F; X.sub.4 is G or  S and X.sub.5 is A or Y 4820 sb189 QQSPWGAYLIT 151 QQSX.sub.1X.sub.2GX.sub.3YX.sub.4IT (SEQ ID NO. 129) 4833 sb202 QQSSHGHYPIT 156 wherein X.sub.1 is S or P; X.sub.2 is H or W; X.sub.3 is H or A and X.sub.4 is P or L 4809 sb178 QQSGWAYHPIT 144 QQSX.sub.1X.sub.2X.sub.3YHX.sub.4X.sub.5X.sub.6T (SEQ ID NO. 130) 4805 sb174 QQSSGVVYHFLFT 143 wherein X.sub.1 is S or G; X.sub.2 is G or W; X.sub.3 is W or A; X.sub.4 is F or P; X.sub.5  is L or I and X.sub.6 is For absent 4818 sb187 QQPYSPIT 149

(286) TABLE-US-00013 TABLE 3E Heavy chain CDR-H1 amino acid sequences - antibodies binding epitope B of αKlotho (The carboxy terminal amino acid residue of the sequences listed under column CDR-H1 correspond to IMGT VH domain  position 39. Amino acid residues of IMGT CDRs are underlined  and amino acid residues of IMGT framework regions are not underlined. Residues at IMGT positions which were randomized in the selection library are bold.) clone ID name CDR-H1 SEQ ID NO. Generic formula A Generic formula B 4813 sb182 GFNLYSSSI 166 GFNX.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6 (SEQ ID NO. 121) 4825 sb194 GFNLYSSSI 166 wherein X.sub.1 is L, F or I; X.sub.2   4811 sb180 GFNLYYSYM 164 is Y or S; 4821 sb190 GFNLYYSYM 164 X.sub.3 is S or Y; X.sub.4 is S or Y; X.sub.5 is S 4808 sb177 GFNFSSSSI 161 or Y and X.sub.6 is I or M 4815 sb184 GFNFSSSSI 161 4816 sb185 GFNFSSSSI 161 4822 sb191 GFNFSSSSI 161 4823 sb192 GFNFSSSSI 161 4827 sb196 GFNFSSSSI 161 4832 sb201 GFNFSSSSI 161 4834 sb203 GFNFSSSSI 161 4820 sb189 GFNISSYYM 170 4826 sb195 GFNISSYYM 170 4809 sb178 GFNIYSYYI 162 GFNIX.sub.1X.sub.2X.sub.3X.sub.4I(SEQ ID NO. 133) 4818 sb187 GFNISYSSI 168 wherein X.sub.1 is Y or S; X.sub.2 is Y or S;  4829 sb198 GFNISSYYI 171 X.sub.3 is Y or S and X.sub.4 is Y or S 4804 sb173 GFNLYSYSI 157 GFNLX.sub.1X.sub.2X.sub.3X.sub.4X.sub.5(SEQ ID NO. 134) 4805 sb174 GFNLSYYSM 158 Wherein X.sub.1 is Y or S; X.sub.2 is Y or S; X.sub.3 4807 sb176 GFNLSSSYM 160 is Y or S; X.sub.4 is Y or S and X.sub.5 is M  4812 sb181 GFNLSSYSM 165 or I 4833 sb202 GFNLSSYYM 174 4824 sb193 GFNLSSSSI 163

(287) TABLE-US-00014 TABLE 3F Heavy chain CDR-H2 amino acid sequences - antibodies  binding epitope B of αKlotho (The amino terminal residue and the carboxy terminal residue of the  sequences listed under column CDR-H2 correspond to IMGT VH domain positions 55 and 66, respectively. Amino acid residues  of IMGT CDRs are underlined and amino acid residues of IMGT framework regions are not underlined.) clone ID name CDR-H2 SEQ ID NO. Generic formula A Generic formula B 4804 sb173 YISSSSGSTY 175 YIX.sub.1SSX.sub.2GX.sub.3TX.sub.4(SEQ ID NO. 135) X.sub.1IX.sub.2X.sub.3X.sub.4X.sub.5X.sub.6X.sub.7TX.sub.8 (SEQ ID NO. 122) 4823 sb192 YIYSSYGYTY 188 wherein X.sub.1 is S or Y; X.sub.2 is  wherein X.sub.1 is Y or S; X.sub.2 is Y or  4827 sb196 YISSSSGSTS 190 S or Y; X.sub.3 is S S; X.sub.3 is S or P; X.sub.4 4832 sb201 YISSSYGYTS 194 or Y; X.sub.4 is S or Y is S or Y; X.sub.5 is S or Y; 4808 5b177 SISSSYGYTY 179 X.sub.6 is G or S; X.sub.7 is Y or S 4815 5b184 SISSSYGYTY 179 and X.sub.8 is Y or S 4816 5b185 SISSSYGYTY 179 4822 sb191 SISSSYGYTY 179 4824 5b193 SISSSYGYTY 179 4826 5b195 SISSSYGYTY 179 4834 5b203 SISSSYGYTY 179 4813 5b182 SISPYSGYTY 184 4818 5b187 SISPYSGYTY 184 4805 5b174 SISSYYGSTY 176 SIX.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6TX.sub.7(SEQ ID NO. 136) 4807 sb176 SIYPSYGSTS 178 wherein X.sub.1 is S or Y; X.sub.2  4809 5b178 SIYSYYGSTS 180  is S or P; X.sub.3 is Y 4811 sb180 SIYSSSSYTS 182 or S; X.sub.4 is Y or S; X.sub.5 is 4812 sb181 SISSYSGYTS 183 G or S; X.sub.6 is S or Y 4820 5b189 SIYSSYSSTY 186 and X.sub.7 = Y or S 4821 sb190 SISPYSGSTY 187 4825 5b194 SISPYYSYTY 189 4829 5b198 SIYSSYGYTS 191 4833 5b202 SIYPSYSSTY 195

(288) TABLE-US-00015 TABLE 3G Liqht chain CDR-L3 amino acid sequences - antibodies bindinq epitope C of αKlotho (Residues at IMGT  positions which were randomized in the selection library are bold). clone ID name CDR-L3 SEQ ID NO. Generic formula 4819 sb188 QQGSYYWWSPIT 150 QQX.sub.1SX.sub.2YX.sub.3X.sub.4SPIT (SEQ ID NO. 123) 4830 sb199 QQYSVVYWYSPIT 154 wherein X.sub.1 is G or Y; X.sub.2 is Y or W; X.sub.3 is W or Y and  X.sub.4 is W, Y or A 4831 sb200 QQYSYYYASPIT 155 4814 sb183 QQSSPPIT 148

(289) TABLE-US-00016 TABLE 3H Heavy chain CDR-H1 amino acid sequences - antibodies binding epitope C of αKlotho (The carboxy terminal amino acid residue of the sequences listed under column CDR-H1 corresponds  to IMGT VH domain position 39. Amino acid residues of IMGT CDR-H1 are underlined and amino acid residues of IMGT framework regions are not underlined. Residues at IMGT positions which were randomized in the selection library are bold.) clone ID name CDR-H1 SEQ ID NO. Generic formula 4830 sb199 GFNIYYSSI 172 GFNX.sub.1YX.sub.2X.sub.3SX.sub.4(SEQ ID NO. 124) 4831 sb200 GFNIYSSSI 173 wherein X.sub.1 is I or L, X.sub.2 is Y or S; X.sub.3 is S or Y and X.sub.4 is I or M 4819 sb188 GFNIYSYSM 169 4814 sb183 GFNLYSYSM 167

(290) TABLE-US-00017 TABLE 3I Heavy chain CDR-H2 amino acid sequences - antibodies binding epitope C of αKlotho (The amino terminal residue and the carboxy terminal residue of the sequences listed under column CDR-H2  correspond to IMGT VH domain positions 55 and 66, respectively.  Amino acid residues of IMGT CDR-H2 are underlined and amino acid residues of IMGT framework regions are not underlined.) clone ID name CDR-H2 SEQ ID NO. Generic formula 4819 sb188 SIYPSSSYTY 185 SIX.sub.1PX.sub.2X.sub.3X.sub.4YTY (SEQ ID NO. 125) 4830 sb199 SIYPYYSYTY 192 wherein X.sub.1 is S or Y, X.sub.2 is S or Y; X.sub.3 is S or Y and X.sub.4 is S or G 4831 sb200 SIYPYSGYTY 193 4814 sb183 SISPYSGYTY 184

(291) TABLE-US-00018 TABLE 4 Example of full length sequences for additional αKlotho antibodies Light chain (hK) amino acid sequence: SEQ ID NO: 317 DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAVVYQQKPGKAPKLLIYSASSLYSGVPSRFSGSRSGTDF TLTISSLQPEDFATYYCQQSSYSLITFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREA KVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Light Chain (hK) nucleic acid sequence: SEQ ID NO: 318 GATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCCGCCTCTGTGGGCGATAGGGTCACCATCACCTGCCGTGCCAGTCAGTC CGTGTCCAGCGCTGTAGCCTGGTATCAACAGAAACCAGGAAAAGCTCCGAAGCTTCTGATTTACTCGGCATCCAGCCTCTAC TCTGGAGTCCCTTCTCGCTTCTCTGGTAGCCGTTCCGGGACGGATTTCACTCTGACCATCAGCAGTCTGCAGCCGGAAGACTT CGCAACTTATTACTGTCAGCAATCTTCTTATTCTCTGATCACGTTCGGACAGGGTACCAAGGTGGAGATCAAACGTACGGT GGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGAACTGCCTCTGTTGTGTGCCTGCTGAATAACT TCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGAC AGCAAGGACAGCACCTACAGCCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAGTCTACGCCTGCGAAGT CACCCATCAGGGCCTGAGCTCGCCCGTCACAAAGAGCTTCAACAGGGGAGAGTGT Heavy chain (hG1) amino acid sequence: SEQ ID NO: 319 EVQLVESGGGLVQPGGSLRLSCAASGFNLYSYSIHVVVRQAPGKGLEVVVAYISSSSGSTYYADSVKGRFTI SADTSKNTAYLQMNSLRAEDTAVYYCARGWGGGYWFYPVYGIDYWGQGTLVTVSSASTKGPSVFPLA PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNV NHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNVVYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP REPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Heavy chain (hG1) nucleic acid sequence: SEQ ID NO: 320 GAGGTTCAGCTGGTGGAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTGTCCTGTGCAGCTTCTGGCTTCA ACCTCTATTCTTATTCTATCCACTGGGTGCGTCAGGCCCCGGGTAAGGGCCTGGAATGGGTTGCATATATTTCTTCTTCT TCTGGCTCTACTTATTATGCCGATAGCGTCAAGGGCCGTTTCACTATAAGCGCAGACACATCCAAAAACACAGCCTACCTA CAAATGAACAGCTTAAGAGCTGAGGACACTGCCGTCTATTATTGTGCTCGCGGTTGGGGTGGTGGTTACTGGTTCTACCC GGTTTACGGTATTGACTACTGGGGTCAAGGAACCCTGGTCACCGTCTCCTCGGCTAGCACCAAGGGCCCATCGGTCTTCCCCC TGGCACCCTCCTCCAAGAGCACCTCTGGGGGCACAGCGGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAACCGGTGACGGTG TCGTGGAACTCAGGCGCCCTGACCAGCGGCGTGCACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCAGCGTG GTGACCGTGCCCTCCAGCAGCTTGGGCACCCAGACCTACATCTGCAACGTGAATCACAAGCCCAGCAACACCAAGGTGGACAAGAA AGTTGAGCCCAAATCTTGTGACAAAACTCACACATGCCCACCGTGCCCAGCACCTGAACTCCTGGGGGGACCGTCAGTCTTCCTCT TCCCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCT GAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCACGT ACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTC CCAGCCCCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGA GATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGC AGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAG AGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCT GTCTCCGGGTAAA Underlined identifies CDR sequence; Bold identifies residues at IMGT positions which were randomized in the selection library (Antibody #4804 shown as example here); Italics represent constant domain sequence

(292) TABLE-US-00019 TABLE 5 Summary of binding characteristics of additional αKlotho antibodies ID name affinity epitope group 48 sb106 1.9 nM A 4804 sb173 770 pM B 4805 sb174 240 pM B 4806 sb175 2.7 nM nd 4807 sb176 6.1 nM B 4808 sb177 1.6 nM B 4809 sb178 845 pM B 4810 sb179 1.9 nM nd 4811 sb180 2.3 nM B 4812 sb181 885 pM B 4813 sb182 5.2 nM B 4814 sb183 4.7 nM C 4815 sb184 360 pM B 4816 sb185 3.7 nM B 4817 sb186 4.1 nM nd 4818 sb187 2.1 nM B 4819 sb188 550 pM C 4820 sb189 2.7 nM B 4821 sb190 5.1 nM B 4822 sb191 8.7 nM B 4823 sb192 1.6 nM B 4824 sb193 3.5 nM B 4825 sb194 nd B 4826 sb195 3.3 nM B 4827 sb196 5.6 nM B 4828 sb197 4.9 nM nd 4829 sb198 1.8 nM B 4830 sb199 2.9 nM C 4831 sb200 1.6 nM C 4832 sb201 515 pM B 4833 sb202 1.4 nM B 4834 sb203 1.1 nM B

(293) While the present application has been described with reference to what are presently considered to be the preferred examples, it is to be understood that the application is not limited to the disclosed examples. To the contrary, the application is intended to cover various modifications and equivalent arrangements included within the spirit and scope of the appended claims.

(294) All publications, patents and patent applications are herein incorporated by reference in their entirety to the same extent as if each individual publication, patent or patent application was specifically and individually indicated to be incorporated by reference in its entirety. Specifically, the sequences associated with each accession numbers provided herein including for example accession numbers and/or biomarker sequences (e.g. protein and/or nucleic acid) provided in the Tables or elsewhere, are incorporated by reference in its entirely.

CITATIONS FOR REFERENCES REFERRED TO IN THE SPECIFICATION

(295) 1. Kuro-o M, Matsumura Y, Aizawa H, et al. (1997) Mutation of the mouse klotho gene leads to a syndrome resembling ageing. Nature 390: 45-51. 2. Nabeshima Y. (2002) Klotho: a fundamental regulator of aging. Ageing Res Rev 1: 627-638. 3. Matsumura Y, Aizawa H, Shiraki-lida T, Nagai R, Kuro-o M, Nabeshima Y. (1998) Identification of the human klotho gene and its two transcripts encoding membrane and secreted klotho protein. Biochem Biophys Res Commun 242: 626-630. 4. Ben-Dov I Z, Galitzer H, Lavi-Moshayoff V, Goetz R, Kuro-o M, Mohammadi M, Sirkis R, Naveh-Many T, Silver J. (2007) The parathyroid is a target organ for FGF23 in rats. J Clin Invest 117: 4003-4008. 5. Ito S, Kinoshita S, Shiraishi N, Nakagawa S, Sekine S, Fujimori T, Nabeshima Y. (2000) Molecular cloning and expression analyses of mouse betaklotho, which encodes a novel Klotho family protein. Mech Dev 98: 115-119. 6. Kuro-o M. (2012) Klotho and betαKlotho. Adv Exp Med Biol 728: 25-40. 7. Hu M C, Shi M, Zhang J, et al. Klotho: a novel phosphaturic substance acting as an autocrine enzyme in the renal proximal tubule. FASEB J 2010; 24(9):3438-3450 8. Kato Y, Arakawa E, Kinoshita S, et al. Establishment of the anti-Klotho monoclonal antibodies and detection of Klotho protein in kidneys. Biochem Biophys Res Commun 2000; 267(2):597-602 9. Goetz R, Nakada Y, Hu M C, et al. Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Proc Natl Acad Sci USA 2010; 107(1):407-412 10. Kurosu H, Ogawa Y, Miyoshi M, et al. Regulation of fibroblast growth factor-23 signaling by klotho. J Biol Chem 2006; 281(10):6120-6123 11. Urakawa I, Yamazaki Y, Shimada T, et al. Klotho converts canonical FGF receptor into a specific receptor for FGF23. Nature 2006; 444(7120):770-774 12. Hu M C, Shi M, Zhang J, et al. Klotho deficiency causes vascular calcification in chronic kidney disease. J Am Soc Nephrol 2011; 22(1):124-136 13. Imura A, Iwano A, Tohyama O, et al. Secreted Klotho protein in sera and CSF: implication for post-translational cleavage in release of Klotho protein from cell membrane. FEBS Lett 2004; 565 (1-3):143-147 14. Bloch L, Sineshchekova O, Reichenbach D, et al. Klotho is a substrate for alpha-, beta- and gamma-secretase. FEBS Lett 2009; 583(19):3221-3224 15. Chen C D, Podvin S, Gillespie E, et al. Insulin stimulates the cleavage and release of the extracellular domain of Klotho by ADAM10 and ADAM17. Proc Natl Acad Sci USA 2007; 104(50):19796-19801 16. Hu M C, Shi M, Zhang J, et al. Renal production and metabolism of circulating Klotho. Submitted 17. Hu M C, Kuro-o M, Moe O W. Secreted klotho and chronic kidney disease. Adv Exp Med Biol 2012; 728:126-157 18. Aizawa H, Saito Y, Nakamura T, et al. Downregulation of the Klotho gene in the kidney under sustained circulatory stress in rats. Biochem Biophys Res Commun 1998; 249(3):865-871 19. Cheng M F, Chen L J, Cheng J T. Decrease of Klotho in the kidney of streptozotocin-induced diabetic rats. J Biomed Biotechnol 2010; 2010:513853 20. Haruna Y, Kashihara N, Satoh M, et al. Amelioration of progressive renal injury by genetic manipulation of Klotho gene. Proc Natl Acad Sci USA 2007; 104(7):2331-2336 21. Koh N, Fujimori T, Nishiguchi S, et al. Severely reduced production of klotho in human chronic renal failure kidney. Biochem Biophys Res Commun 2001; 280(4):1015-1020 22. Mitani H, Ishizaka N, Aizawa T, et al. In vivo klotho gene transfer ameliorates angiotensin II-induced renal damage. Hypertension 2002; 39(4):838-843 23. Wang Y, Sun Z. Klotho gene delivery prevents the progression of spontaneous hypertension and renal damage. Hypertension 2009; 54:810-817 24. Zhao Y, Banerjee S, Dey N, et al. Klotho depletion contributes to increased inflammation in kidney of the db/db mouse model of diabetes via ReIA (serine) 536 phosphorylation. Diabetes 2011; 60(7):1907-1916 25. Hu M C, Shi M, Zhang J, et al. Klotho deficiency is an early biomarker of renal ischemia-reperfusion injury and its replacement is protective. Kidney Int 2010; 78(12):1240-1251 26. Hu M C, Moe O W. Klotho as a potential biomarker and therapy for acute kidney injury. Nat Rev Nephrol 2012; 8(7):423-429 27. Goetz R, Beenken A, Ibrahimi O A, et al. (2007) Molecular insights into the klotho-dependent, endocrine mode of action of fibroblast growth factor 19 subfamily members. Mol Cell Biol 27: 3417-3428. 28. Shimada T, Kakitani M, Yamazaki Y, Hasegawa H, Takeuchi Y, Fujita T, Fukumoto S, Tomizuka K, Yamashita T. (2004) Targeted ablation of Fgf23 demonstrates an essential physiological role of FGF23 in phosphate and vitamin D metabolism. J Clin Invest 113: 561-568. 29. Ichikawa S, Imel E A, Kreiter M L, et al. (2007) A homozygous missense mutation in human KLOTHO causes severe tumoral calcinosis. J Clin Invest 117: 2684-2691. 30. Kuro-o M. (2010) Overview of the FGF23-Klotho axis. Pediatr Nephrol 25: 583-590. 31. Kurosu H, Kuro O M. (2009) The Klotho gene family as a regulator of endocrine fibroblast growth factors. Mol Cell Endocrinol 299: 72-78. 32. Ayodele O E, Alebiosu C O. (2010) Burden of chronic kidney disease: an international perspective. Adv Chronic Kidney Dis 17: 215-224. 33. Soni R K, Weisbord S D, Unruh M L. (2010) Health-related quality of life outcomes in chronic kidney disease. Curr Opin Nephrol Hypertens 19: 153-159. 34. Trivedi H. (2010) Cost implications of caring for chronic kidney disease: are interventions cost-effective? Adv Chronic Kidney Dis 17: 265-270. 35. Ganesh S K, Stack A G, Levin N W, Hulbert-Shearon T, Port F K. (2001) Association of elevated serum PO(4), Ca×PO(4) product, and parathyroid hormone with cardiac mortality risk in chronic hemodialysis patients. J Am Soc Nephrol 12: 2131-2138. 36. Tonelli M, Curhan G, Pfeffer M, Sacks F, Thadhani R, Melamed M L, Wiebe N, Muntner P. (2009) Relation between alkaline phosphatase, serum phosphate, and all-cause or cardiovascular mortality. Circulation 120: 1784-1792. 37. Gutierrez O, Isakova T, Rhee E, Shah A, Holmes J, Collerone G, Juppner H, Wolf M. (2005) Fibroblast growth factor-23 mitigates hyperphosphatemia but accentuates calcitriol deficiency in chronic kidney disease. J Am Soc Nephrol 16: 2205-2215. 38. Asai O, Nakatani K, Tanaka T, et al. Decreased renal alpha-Klotho expression in early diabetic nephropathy in humans and mice and its possible role in urinary calcium excretion. Kidney Int 2012; 81(6):539-547 39. Akimoto T, Kimura T, Watanabe Y, et al. The impact of nephrectomy and renal transplantation on serum levels of soluble Klotho protein. Transplant Proc 2013; 45(1):134-136 40. Akimoto T, Shiizaki K, Sugase T, et al. The relationship between the soluble Klotho protein and the residual renal function among peritoneal dialysis patients. Clin Exp Nephrol 2012; 16(3):442-447 41. Akimoto T, Yoshizawa H, Watanabe Y, et al. Characteristics of urinary and serum soluble Klotho protein in patients with different degrees of chronic kidney disease. BMC Nephrol 2012; 13:155 42. Carpenter T O, Insogna K L, Zhang J H, et al. Circulating Levels of Soluble Klotho and FGF23 in X-Linked Hypophosphatemia: Circadian Variance, Effects of Treatment, and Relationship to Parathyroid Status. J Clin Endocrinol Metab 2010; 95 (11):E352-357 43. Crasto C L, Semba R D, Sun K, et al. Relationship of low-circulating “anti-aging” klotho hormone with disability in activities of daily living among older community-dwelling adults. Rejuvenation Res 2012; 15(3):295-301 44. Devaraj S, Syed B, Chien A, et al. Validation of an immunoassay for soluble klotho protein: decreased levels in diabetes and increased levels in chronic kidney disease. Am J Clin Pathol 2012; 137(3):479-485 45. Fliser D, Seiler S, Heine G H, et al. Measurement of serum soluble Klotho levels in CKD 5D patients: useful tool or dispensable biomarker? Nephrol Dial Transplant 2012; 27(5):1702-1703 46. Heijboer A C, Blankenstein M A, Hoenderop J, et al. Laboratory aspects of circulating alpha-Klotho. Nephrol Dial Transplant 2013; 28(9):2283-2287 47. Kacso I M, Bondor Cl, Kacso G. Soluble serum Klotho in diabetic nephropathy: relationship to VEGF-A. Clin Biochem 2012; 45 (16-17):1415-1420 48. Kim H R, Nam B Y, Kim D W, et al. Circulating alpha-Klotho levels in CKD and relationship to progression. Am J Kidney Dis 2013; 61(6):899-909 49. Kitagawa M, Sugiyama H, Morinaga H, et al. A decreased level of serum soluble Klotho is an independent biomarker associated with arterial stiffness in patients with chronic kidney disease. PLoS One 2013; 8(2):e56695 50. Komaba H, Koizumi M, Tanaka H, et al. Effects of cinacalcet treatment on serum soluble Klotho levels in haemodialysis patients with secondary hyperparathyroidism. Nephrol Dial Transplant 2012; 27(5):1967-1969 51. Pavik I, Jaeger P, Ebner L, et al. Soluble klotho and autosomal dominant polycystic kidney disease. Clin J Am Soc Nephrol 2012; 7(2):248-257 52. Pavik I, Jaeger P, Ebner L, et al. Secreted Klotho and FGF23 in chronic kidney disease Stage 1 to 5: a sequence suggested from a cross-sectional study. Nephrol Dial Transplant 2013; 28(2):352-359 53. Seiler S, Wen M, Roth H J, et al. Plasma Klotho is not related to kidney function and does not predict adverse outcome in patients with chronic kidney disease. Kidney Int 2013; 83(1):121-128 54. Shimamura Y, Hamada K, Inoue K, et al. Serum levels of soluble secreted alpha-Klotho are decreased in the early stages of chronic kidney disease, making it a probable novel biomarker for early diagnosis. Clin Exp Nephrol 2012; 16(5):722-729 55. Siahanidou T, Garatzioti M, Lazaropoulou C, et al. Plasma soluble alpha-Klotho protein levels in premature and term neonates: correlations with growth and metabolic parameters. Eur J Endocrinol 2012; 167(3):433-440 56. Sugiura H, Tsuchiya K, Nitta K. Circulating levels of soluble alpha-Klotho in patients with chronic kidney disease. Clin Exp Nephrol 2011; 15(5):795-796 57. Wan M, Smith C, Shah V, et al. Fibroblast growth factor 23 and soluble klotho in children with chronic kidney disease. Nephrol Dial Transplant 2013; 28(1):153-161 58. Yamazaki Y, Imura A, Urakawa I, et al. Establishment of sandwich ELISA for soluble alpha-Klotho measurement: Age-dependent change of soluble alpha-Klotho levels in healthy subjects. Biochem Biophys Res Commun 2010; 398(3):513-518 59. Yokoyama K, Imura A, Ohkido I, et al. Serum soluble alpha-Klotho in hemodialysis patients. Clin Nephrol 2012; 77(5):347-351 60. Semba R D, Cappola A R, Sun K, et al. Plasma klotho and mortality risk in older community-dwelling adults. J Gerontol A Biol Sci Med Sci 2011; 66(7):794-800 61. Doi S, Zou Y, Togao O, et al. Klotho inhibits transforming growth factor-beta1 (TGF-beta1) signaling and suppresses renal fibrosis and cancer metastasis in mice. J Biol Chem 2011; 286(10):8655-8665 62. Ohyama Y, Kurabayashi M, Masuda H, et al. Molecular cloning of rat klotho cDNA: markedly decreased expression of klotho by acute inflammatory stress. Biochemical And Biophysical Research Communications 1998; 251(3):920-925 63. Sugiura H, Yoshida T, Mitobe M, et al. Klotho reduces apoptosis in experimental ischaemic acute kidney injury via HSP-70. Nephrol Dial Transplant 2010; 25(1):60-68 64. Sugiura H, Yoshida T, Tsuchiya K, et al. Klotho reduces apoptosis in experimental ischaemic acute renal failure. Nephrol Dial Transplant 2005; 20(12):2636-2645 65. Moreno J A, Izquierdo M C, Sanchez-Nino M D, et al. The inflammatory cytokines TWEAK and TNFalpha reduce renal klotho expression through NFkappaB. J Am Soc Nephrol 2011; 22(7):1315-1325 66. Goldstein S L. Acute kidney injury biomarkers: renal angina and the need for a renal troponin I. BMC Med 2011; 9:135 67. Fellouse F A, Esaki K, Birtalan S, et al. High-throughput generation of synthetic antibodies from highly functional minimalist phage-displayed libraries. J Mol Biol 2007; 373(4):924-940 68. Gao J, Sidhu S S, Wells J A. Two-state selection of conformation-specific antibodies. Proc Natl Acad Sci USA 2009; 106(9):3071-3076 69. Koellhoffer J F, Chen G, Sandesara R G, et al. Two synthetic antibodies that recognize and neutralize distinct proteolytic forms of the ebola virus envelope glycoprotein. Chembiochem 2012; 13(17):2549-2557 70. Li B, Russell S J, Compaan D M, et al. Activation of the proapoptotic death receptor DR5 by oligomeric peptide and antibody agonists. J Mol Biol 2006; 361(3):522-536 71. Uysal S, Vasquez V, Tereshko V, et al. Crystal structure of full-length KcsA in its closed conformation. Proc Natl Acad Sci USA 2009; 106(16):6644-6649 72. Ibrahimi O A, Zhang F, Eliseenkova A V, et al. Biochemical analysis of pathogenic ligand-dependent FGFR2 mutations suggests distinct pathophysiological mechanisms for craniofacial and limb abnormalities. Hum Mol Genet 2004; 13(19):2313-2324 73. Plotnikov A N, Hubbard S R, Schlessinger J, et al. Crystal structures of two FGF-FGFR complexes reveal the determinants of ligand-receptor specificity. Cell 2000; 101(4):413-424 74. Persson H, Ye W, Wernimont A, et al. CDR-H3 diversity is not required for antigen recognition by synthetic antibodies. J Mol Biol 2013; 425(4):803-811 75. Rajan S, Sidhu S S. Simplified synthetic antibody libraries. Methods Enzymol 2012; 502:3-23 76. Colwill K, Graslund S. A roadmap to generate renewable protein binders to the human proteome. Nat Methods 2011; 8(7):551-558 77. Olsen S K, Garbi M, Zampieri N, et al. Fibroblast growth factor (FGF) homologous factors share structural but not functional homology with FGFs. J Biol Chem 2003; 278(36):34226-34236 78. Kurosu H, Choi M, Ogawa Y, et al. Tissue-specific expression of betαKlotho and fibroblast growth factor (FGF) receptor isoforms determines metabolic activity of FGF19 and FGF21. J Biol Chem 2007; 282(37):26687-26695 79. Kurosu H, Yamamoto M, Clark J D, et al. Suppression of aging in mice by the hormone Klotho. Science 2005; 309(5742):1829-1833 80. Kuro-o M, Matsumura Y, Aizawa H, et al. Mutation of the mouse klotho gene leads to a syndrome resembling ageing. Nature 1997; 390(6655):45-51 81. Hu M C, Shiizaki K, Kuro-o M, et al. Physiology and pathophysiology of an endocrine network of mineral metabolism. Ann Rev Phys 2013; 75:503-533 82. Hu M C, Kuro-o M, Moe O W. Renal and extrarenal actions of Klotho. Semin Nephrol 2013; 33(2):118-129 83. Pedersen L, Pedersen S M, Brasen C L, et al. Soluble serum Klotho levels in healthy subjects. Comparison of two different immunoassays. Clin Biochem 2013; 46(12):1079-1083 84. Grams M E, Chow E K, Segev D L, Coresh J. Lifetime incidence of CKD stages 3-5 in the United States. Am J Kidney Dis. 2013 August; 62(2):245-52. 85. Lefranc et al. IMGT unique numbering for immunoglobulin and T cell receptor variable domains and Ig superfamily V-like domains. Development and Comparative Immunology. 2003; 27:55-77. 86. Barker S L, Pastor J, Carranza D, et al. The demonstration of Klotho deficiency in human chronic kidney disease with a novel synthetic antibody. Nephrology Dialysis Transplantation. 2015 February; 30(2):223-33.