ChiA Enzyme
20210309984 · 2021-10-07
Inventors
Cpc classification
International classification
Abstract
There is disclosed a peptide with mucolytic activity, The peptide comprising an amino acid sequence having at least 60% sequence identity to the amino add sequence defined in SEQ ID NO: 1, but does not consist of the amino sequence defined in SEQ ID NO: 2.
Claims
1. A peptide comprising an amino acid sequence having at least 60% sequence identity to the amino acid sequence defined in SEQ ID NO: 1, wherein the peptide has mucolytic activity, wherein the peptide does not consist of the amino sequence defined in SEQ ID NO: 2.
2. The peptide according to claim 1, wherein amino acids at positions equivalent to positions 81, 83, 121, 124, 160, 172, and 194 of SEQ ID NO: 1 are identical to or similar to positions 81, 83, 121, 124, 160, 172, and 194 of SEQ ID NO: 1.
3. The peptide according to claim 1, wherein the peptide consists of an amino acid sequence of no more than 1000 amino acids.
4. The peptide according to claim 1, wherein the peptide retains said mucolytic activity for at least four weeks at 25° C.
5. The peptide according to claim 1, wherein the peptide degrades MUC5AC.
6. The peptide according to claim 1, wherein the peptide is conjugated to at least one other moiety.
7. The peptide according to claim 1, wherein the peptide comprises an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 95% or 99% sequence identity to the amino acid sequence defined in SEQ ID NO: 1.
8. A nucleic acid comprising a nucleotide sequence which encodes the peptide according to claim 1.
9. The nucleic acid according to claim 8, wherein the nucleic acid comprises an nucleic acid sequence having at least 60% sequence identity to the nucleic acid sequence defined in SEQ ID NO: 3, wherein the nucleic acid does not consist of the nucleic acid sequence defined in SEQ ID NO: 4.
10. The nucleic acid according to claim 8, wherein the nucleic acid consists of an nucleic acid sequence having at least 70%, 75%, 80%, 85%, 90%, 95% or 99% sequence identity to the nucleic acid sequence defined in SEQ ID NO: 3.
11. A vector comprising a nucleic acid sequence according to claim 8.
12. A host cell comprising a vector according to claim 11 preferably wherein the host cell is E. coli.
13. A method of performing an in vitro assay, the method comprising using a peptide comprising an amino acid sequence having at least 60% sequence identity to the amino acid sequence defined in SEQ ID NO: 1, wherein the peptide has mucolytic activity, or a nucleic acid encoding a peptide having at least 60% sequence identity to the amino acid sequence defined in SEQ ID NO: 1, wherein the peptide has mucolytic activity.
14. A pharmaceutical composition comprising a peptide comprising an amino acid sequence having at least 60% sequence identity to the amino acid sequence defined in SEQ ID NO: 1 wherein the peptide has mucolytic activity, or a nucleic acid encoding a peptide having at least 60% sequence identity to the amino acid sequence defined in SEQ ID NO: 1, wherein the peptide has mucolytic activity, and at least one pharmaceutically acceptable carrier, diluent or excipient.
15. The pharmaceutical composition according to claim 14, wherein the peptide comprises an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 95% or 99% sequence identity to the amino acid sequence defined in SEQ ID NO: 1.
16. A method of treatment of a disease or condition characterised by an increased level of mucin, the method comprising the step of administering at least one selected from the group consisting of: (a) a peptide comprising an amino acid sequence having at least 60% sequence identity to the amino acid sequence defined in SEQ ID NO: 1 wherein the peptide has mucolytic activity, (b) a nucleic acid encoding a peptide having at least 60% sequence identity to the amino acid sequence defined in SEQ ID NO: 1, wherein the peptide has mucolytic activity, and (c) a pharmaceutical composition comprising a peptide comprising an amino acid sequence having at least 60% sequence identity to the amino acid sequence defined in SEQ ID NO: 1 wherein the peptide has mucolytic activity, or a nucleic acid encoding a peptide having at least 60% sequence identity to the amino acid sequence defined in SEQ ID NO: 1, wherein the peptide has mucolytic activity, and at least one pharmaceutically acceptable carrier, diluent or excipient, to a patient in need thereof.
17. The method according to claim 16, wherein amino acids at positions equivalent to positions 81, 83, 121, 124, 160, 172, and 194 of SEQ ID NO: 1 are identical to or similar to positions 81, 83, 121, 124, 160, 172, and 194 of SEQ ID NO: 1.
18. The method according to claim 16, wherein the disease or condition is characterised by an increased level of mucin.
19. The method according to claim 16, wherein the disease or condition is characterised by an increased level of MUC5AC.
20. The method according to claim 16, wherein the disease or condition is a chronic inflammatory lung disease, rhinosinusitis, extramammary Paget's disease, gallstone disease, pancreatic cancer or inflammatory bowel disease.
21. The method according to claim 20 wherein the disease or condition is asthma.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072] Surface representation of ChiA-CTD showing the spatial distribution of Zn.sup.2+ ions during MD simulations. The the spatial distribution function (sdf) is represented with isosurfaces connecting points with sdf=20 (mesh) and 30 (dark surface) x average sdf. Zn.sup.2+ high-density sites (dark spots) around the chitinase and peptidase active sites are numbered 1 to 8. Blow out boxes show representative structures from the MD simulations to illustrate Zn.sup.2+ binding in the eight regions, with Zn.sup.2+ ions shown as spheres, their coordinating residues as sticks and ChiA-CTD as cartoon.
[0073]
[0074]
[0075]
[0076]
[0077] ELISA analysis of binding between immobilised type II or III mucin extracts and His-tagged wild-type ChiA-CTD (WT), ChiA-CTD mutants (D504A, H506A, E543M, H544A, N547A, Q583A, Q595A, Q617A) and controls (SsIE, NttE). Anti-His-tag antibody conjugated to HRP was used to measure OD450 nm values. BSA-coated wells were used as controls. Data represent the mean and standard deviation for triplicate experiments. *, P<0.001; verses control empty well by two-tailed Student's test.
DETAILED DESCRIPTION OF THE INVENTION
[0078] Using chitin binding and chitinase activity assays, it is shown that ChiA-N1 is a chitin binding module and confirmed that ChiA-CTD (C-terminal chitinase domain) is a glycosyl hydrolase domain. Using binding assays, it is shown that ChiA-N1, ChiA-N2, ChiA-N3 domains and ChiA-CTD can associate with mucin glycoproteins. It is further shown through structural and biochemical studies that ChiA-CTD has novel peptidase activity against mucin glycoproteins, which is independent of its chitinase active site.
[0079] A novel molecular mechanism has been elucidated where the C-terminal chitinase domain of L. pneumophila ChiA (ChiA-CTD) has additional unique Zn.sup.2+-dependent peptidase activity against MUC5AC (
[0080] ChiA-CTD therefore has an application in disease where there is an increased level of mucus, such as asthma, in order to break down the excess and problematic mucus.
[0081] Unlike other M60-family or mucolytic enzymes, ChiA-CTD (SEQ ID NO: 40) is stable and active for at least four weeks at 25° C. and at least several months at −20° C. (>90% activity against MUC5AC). In contrast, full length ChiA (SEQ ID NO: 2) shows signs of breaking down into degraded individual domains after only a few days. Furthermore, with the described bacterial expression system, it is possible to produce high yields of recombinant ChiA-CTD (>20 mg per 1 L culture), which can be isolated in a single step affinity purification step.
[0082] As such, the present invention relates to a peptide comprising an amino acid sequence having at least 60% sequence identity to the amino acid sequence defined in SEQ ID NO: 1, wherein the peptide has mucolytic activity, wherein the peptide does not consist of the amino sequence defined in SEQ ID NO: 2. Preferably, the peptide comprises an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 95% or 99% sequence identity to the amino acid sequence defined in SEQ ID NO: 1.
[0083] Accordingly, in some embodiments, the peptide is not 100% identical to SEQ ID NO: 1, however the person skilled in the art will recognise that peptides having at least 60%, 70%, 75%, 80%, 85%, 90%, 95% or 99% sequence identity to SEQ ID NO: 1, will have the desired function of the invention, or in other words, will have mucolytic activity.
[0084] In alternative embodiments, the peptide comprises an amino acid sequence having at least 60%, 70%, 75%, 80%, 85%, 90%, 95% or 99% identity to SEQ ID NO: 40.
[0085] In some embodiments, the peptide consists of an amino acid sequence having at least 60%, 70%, 75%, 80%, 85%, 90%, 95% or 99% identity to SEQ ID NO: 1. In alternative embodiments, the peptide consists of an amino acid sequence having at least 60%, 70%, 75%, 80%, 85%, 90%, 95% or 99% identity to SEQ ID NO: 40. Thus in some embodiments, one or more amino acids of the peptides are omitted or are substituted for a different amino acid, preferably a similar amino acid. A similar amino acid is one which has a side chain moiety with related properties and the naturally occurring amino acids may be categorized into the following groups. The group having basic side chains: lysine, arginine, histidine. The group having acidic side chains: aspartic acid and glutamic acid. The group having uncharged polar side chains: aspargine, glutamine, serine, threonine and tyrosine. The group having non-polar side chains: glycine, alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan and cysteine.
[0086] Therefore, it is preferred to substitute amino acids within these groups and the substitution of a “similar” amino acid residue is a substitution within one of the aforementioned groups (this is also known as a “conservative substitution”).
[0087] In some embodiments, the amino acids at positions equivalent to positions 81, 83, 121, 124, 160, 172, and 194 of SEQ ID NO: 1 (or positions 504, 506, 544, 547, 583, 595 and 617 of SEQ ID NO: 2) are substituted for similar amino acids to those amino acids at positions 81, 83, 121, 124, 160, 172, and 194 of SEQ ID NO: 1 (or positions 504, 506, 544, 547, 583, 595 and 617 of SEQ ID NO: 2).
[0088] In some embodiments, the amino acids at positions equivalent to positions 81, 83, 121, 124, 160, 172, and 194 of SEQ ID NO: 1 (or positions 504, 506, 544, 547, 583, 595 and 617 of SEQ ID NO: 2) are identical to positions 81, 83, 121, 124, 160, 172, and 194 of SEQ ID NO: 1 (or positions 504, 506, 544, 547, 583, 595 and 617 of SEQ ID NO: 2). Or in other words, the amino acids at these positions are identical to the equivalent position in the wild type protein (SEQ ID NO: 2).
[0089] In some embodiments, the peptide further comprises an insertion, substitution or a deletion of 1, 2, 3, 4 or 5 amino acids in the sequence defined by SEQ ID NO: 1. In further embodiments, said insertion, substitution or deletion is not at positions equivalent to 81, 83, 121, 124, 160, 172, and 194 of SEQ ID NO: 1.
[0090] The term “the position equivalent to position 81 . . . of SEQ ID NO: 1”, as used herein, means an amino acid in the peptide of SEQ ID NO:1 located in the peptide's amino acid chain at a position corresponding to the 81.sup.st amino acid of the amino acid sequence of SEQ ID NO:1, counting from the N-terminal. Corresponding meanings are attributed to the amino acid equivalent to position 83, 121, 124, 160, 172 and 194. Accordingly, the term “the position equivalent to position 504 . . . of SEQ ID NO: 2”, as used herein, means an amino acid in a peptide of SEQ ID NO: 2 located in the peptide's amino acid chain at a position corresponding to the 504.sup.th amino acid of the amino acid sequence of SEQ ID NO: 2, counting from the N-terminal. Again, corresponding meanings are attributed to the amino acid equivalent to 506, 544, 547, 583, 595 and 617 of SEQ ID NO: 2.
[0091] In preferred embodiments, the term “the position equivalent to position . . . ” means that the positions immediately adjacent to a position are also identical or similar to the equivalent position in SEQ ID NO: 1 or 2. For example, if position 81 is identical or similar to the equivalent position in SEQ ID NO: 1, then positions 80 and 82 are also identical or similar to the equivalent position in SEQ ID NO: 1.
[0092] It is generally preferred that the polypeptide conforms with the chemistry of naturally occurring polypeptides (although it may be synthesized in vitro) but in some alternative embodiments the polypeptide is a peptidomimetic, that is to say a modification of a polypeptide in a manner that will not naturally occur. Such peptidomimetics include the replacement of naturally occurring amino acids with synthetic amino acids and/or a modification of the polypeptide backbone. For example in some embodiments, the peptide bonds are replaced with a reverse peptide bond to generate a retro-inverso peptidomimetic (see Méziére et al J Immunol. 1997 Oct. 1; 159(7):3230-7, which is incorporated herein by reference.) Alternatively, the amino acids are linked by a covalent bond other than a peptide bond but which maintains the spacing and orientation of the amino acid residues forming the polymer chain. In some embodiments, the peptide is bound to at least one zinc ion (Zn.sup.2+). In some embodiments, the peptides binds to at least one zinc ion (Zn.sup.2+) when in use. In all embodiments, the peptide will have a level of mucolytic activity as defined herein, or as described above, degrade at least one mucin. Mucolytic activity may be indiscriminate (i.e. degrade all mucins) or discriminate (i.e. degrade a particular mucin).
[0093] Mucins are high molecular weight glycoproteins that contain large numbers of heavily O-glycosylated serine/threonine rich repeat sequences. They exist as cell surface exposed transmembrane proteins or secreted gel-forming proteins of the mucosal barrier and act as the first line of defence against bacterial infection. However, overproduction of mucins can be problematic in disease, for example in chronic obstructive pulmonary disease (COPD) or asthma.
[0094] In further embodiments, the peptide consists of an amino acid sequence of no more than 400, 500, 600, 700, 800, 900 or 1000 amino acids. Peptides within the scope of the invention maintain the underlying function of the invention, i.e. mucolytic activity, but may have additional amino acids added to either side of SEQ ID NO: 1.
[0095] In some embodiments, the peptide retains said mucolytic activity for at least four weeks at 25° C. Stability at this temperature, which may be the temperature of a lab bench, is an advantageous feature to improve application of this peptide to the uses and methods described herein. In other words, the peptide may retain the mucolytic activity when it is left on a lab bench, or a storage shelf or the like, for a number of days or weeks.
[0096] Preferably the peptide degrades MUC5AC (SEQ ID NO: 39). MUC5AC is a major mucin expressed in the mammalian airway and lung and has been linked to mucus hypersecretion in the respiratory tract.
[0097] In some embodiments, the peptide is conjugated to at least one other moiety. For example, the peptide may be conjugated to at least one PEG or at least one glycan.
[0098] In yet another aspect of the invention, there is a nucleic acid comprising a nucleotide sequence which encodes the described peptide. Alternatively, there is a nucleic acid comprising an nucleic acid sequence having at least 60% sequence identity to the nucleic acid sequence defined in SEQ ID NO: 3, wherein the resulting peptide has mucolytic activity, and wherein the nucleic acid does not consist of the nucleic acid sequence defined in SEQ ID NO: 4. Preferably, the nucleic acid, consists of a nucleic acid sequence having at least 70%, 75%, 80%, 85%, 90%, 95% or 99% sequence identity to the nucleic acid sequence defined in SEQ ID NO: 3.
[0099] Similarly to above, the nucleic acid sequence may differ from the specific sequences disclosed herein, as such sequences may comprise an nucleic acid sequence having at least 60%, 70%, 75%, 80%, 85%, 90%, 95% or 99% sequence identity to SEQ ID NO: 3, which the person skilled in the art will understand can produce a peptide having the desired function of the invention, or in other words, a peptide having mucolytic activity as defined herein.
[0100] In addition to the sequence specifically encoding the protein of the invention, the nucleic acid molecule may contain other sequences such as primer sites, transcription factor binding sites, vector insertion sites and sequences which resist nucleolytic degradation (e.g. polyadenosine tails). The nucleic acid molecule may be DNA or RNA and may include synthetic nucleotides, provided that the polynucleotide is still capable of being translated in order to synthesize a protein of the invention. In another aspect, there is a vector comprising such a nucleic acid sequence; in a further aspect, there is a host cell comprising said vector, preferably wherein the host cell is E. coli.
[0101] In addition to the nucleic acid sequence described above, the plasmid comprises other elements such as a prokaryotic origin of replication (for example, the E. coli OR1 origin of replication) an autonomous replication sequence, a centromere sequence; a promoter sequence, upstream of the nucleic acid sequence, a terminator sequence located downstream of the nucleic acid sequence, an antibiotic resistance gene and/or a secretion signal sequence. A vector comprising an autonomous replication sequence is also a yeast artificial chromosome. In some alternative embodiments, the vector is a virus, such as a bacteriophage and comprises, in addition to the nucleic acid sequence of the invention, nucleic acid sequences for replication of the bacteriophage, such as structural proteins, promoters, transcription activators and the like.
[0102] The nucleic acid molecule of the invention may be used to transfect or transform host cells in order to synthesize the protein of the invention. Suitable host cells include prokaryotic cells such as E. coli and eukaryotic cells such as yeast cells, or mammalian or plant cell lines. Host cells are transfected or transformed using techniques known in the art such as electroporation; calcium phosphate base methods; a biolistic technique or by use of a viral vector.
[0103] After transfection, the nucleic acid molecule of the invention is transcribed as necessary and translated. In some embodiments, the synthesized protein is allowed to remain in the host cell and cultures of the recombinant host cell are subsequently used. In other embodiments, the synthesized protein is extracted from the host cell, either by virtue of its being secreted from the cell due to, for example, the presence of secretion signal in the vector, or by lysis of the host cell and purification of the protein therefrom.
[0104] In one aspect of the invention, there is a use of such a peptide, or a nucleic acid as defined herein, in an in vitro assay, alternatively, there is a use of such a peptide or nucleic acid in therapy. The person skilled in the art would be well aware of a variety of in vitro assays, but examples include: protein-based assays such as ELISAs, CBAs, ELISpots, immunoblotting, or nucleic acid based assays such as PCR, northern or southern blotting.
[0105] In a further aspect of the invention, there is a peptide or a nucleic acid as described above for use as a medicament. Such a medicament may be administered to a patient in need thereof in any way known to the person skilled in the art. In some embodiments, the medicament may be administered orally or nasally through an inhaler. In other embodiments, the medicament may be administered as a topical solution or spray.
[0106] A pharmaceutical composition may comprise a peptide or a nucleic acid of the invention, as well as at least one pharmaceutically acceptable carrier, diluent or excipient. In some embodiments, the at least one pharmaceutically acceptable carrier, diluent or excipient is physiological saline, phosphate buffered saline (PBS) and/or sterile water. In some embodiments, the pharmaceutical composition consists essentially of the peptide of the invention.
[0107] In another aspect of the invention, there is a peptide or a pharmaceutical composition as described above, for the treatment of a disease or condition characterised by increased level of mucin. Optionally, the disease or condition is further characterised by an increased level of MUC5AC. For example, the disease or condition may be asthma, which is associated with an increased level of MUC5AC (4). There may be an increased level due to increased production at the mRNA or the protein level and/or due to a reduction in natural degradation, recycling or inhibition of the mRNA or the protein. The level of mucin, or MUC5AC, may increase due to inflammation and/or an allergic response. In one example, there may be an increased level of mucin because of a decreased level of a natural inhibitor of mucin. In another example, there may be upregulation of the mRNA transcript for MUC5AC due to downregulation in a transcriptional regulator of MUC5AC. The person skilled in the art would be well aware of many scenarios in which there may be an increased level of an analyte, including mucin or specifically MUC5AC.
[0108] In one embodiment, the disease or condition is a chronic inflammatory lung disease, preferably asthma, chronic obstructive pulmonary disease, bronchiectasis and cystic fibrosis. Asthma is a respiratory condition marked by attacks of spasm in the bronchi of the lungs, causing difficulty in breathing. Mucus can play a role in asthma pathology by plugging and/or obstructing the airways. Chronic obstructive pulmonary disease (COPD), is a chronic inflammatory lung disease that causes obstructed airflow from the lungs. Bronchiectasis is a chronic lung condition where the airways of the lung become abnormally widened, leading to a build-up of excess mucus that can make the lungs vulnerable to infection. Cystic fibrosis is a hereditary disorder affecting the exocrine glands causing production of abnormally thick mucus which can block pancreatic ducts, intestines and bronchi, and often results in respiratory infection.
[0109] In another embodiment, the disease or condition is not a chronic inflammatory lung disease. For example, the disease or condition may be rhinosinusitis, extramammary Paget's disease (EMPD), gallstone disease, pancreatic cancer, or inflammatory bowel disease (IBD). The disease or condition may be any other disease or condition known to the skilled person that is associated with increased levels of mucus, and particularly increased levels of MUC5AC.
[0110] In one aspect, there is a method of treatment of a disease or condition characterised by an increased level of mucin, the method comprising the step of administering a peptide, pharmaceutical composition, or nucleic acid as described above.
[0111] In a preferred embodiment, the disease or condition is characterised by an increased level of MUC5AC as described above. In one embodiment, the disease or condition is a chronic inflammatory lung disease, preferably asthma, chronic obstructive pulmonary disease, bronchiectasis and cystic fibrosis.
[0112] In one embodiment, the peptide is delivered at a dose of 0.01 μg-100 μg per kg per day. The skilled person will understand that this represents a suitable dose to obtain a technical effect in an individual to be treated. For example, in the context of asthma, the suitable dose will provide a level of mucolytic activity which is beneficial for a patient suffering from an increased level of mucus, or specifically MUC5AC.
EXAMPLE
[0113] Material and Methods
[0114] Cloning, Expression and Purification
[0115] Full-length ChiA minus the N-terminal periplasmic signal sequence ChiA (SEQ ID NO: 4; resulting in peptide of SEQ ID NO: 2), the ChiA N-terminal region (SEQ ID NO: 6; resulting in peptide of SEQ ID NO: 5), the ChiA N1-domain (SEQ ID NO: 8; resulting in peptide of SEQ ID NO: 7), the ChiA N2-domain (SEQ ID NO: 10; resulting in peptide of SEQ ID NO: 9), the ChiA N3-domain (SEQ ID NO: 12; resulting in peptide of SEQ ID NO: 11) the ChiA C-domain (SEQ ID NO: 41; resulting in peptide of SEQ ID NO: 40) and NttE (residues 1-269) were amplified from the genomic DNA of L. pneumophila strain 130b and cloned into the N-terminal His6-tagged vector pET-46 Ek/LIC. SsIE (residues 90-1520), minus the N-terminal periplasmic signal sequence and mature SsIE N-terminal proline-rich region, were amplified from the genomic DNA of E. coli strain W and cloned into the C-terminal His6-tagged vector pOPINE. These were transformed into E. coli SHuffle cells (New England Biolabs) and grown at 37° C. in LB media with 100 μg/ml ampicillin. Expression was induced with 1 mM isopropyl-d-1-thiogalactopyranoside (IPTG) at an OD600nm of 0.6 and cells were harvested after growth overnight at 18° C. Cells were resuspended in 20 mM Tris-HCl pH 8, 200 mM NaCl, 5 mM MgCl2, 1 mg/ml DNase I, 5 mg/ml lysozyme, lysed by sonication and purified using nickel affinity chromatography. All samples were then gel filtered using a Superdex 200 column (GE Healthcare) equilibrated in 20 mM Tris-HCl pH 8, 200 mM NaCl.
[0116] Site-Directed Mutagenesis
[0117] E543M chiA-CTD mutant (SEQ ID NO: 18; resulting in peptide of SEQ ID NO: 17) was created using pET46chiA-CTD template DNA with a QuikChange II Site-Directed Mutagenesis Kit (Stratagene). D504A (SEQ ID NO: 14, resulting in peptide of SEQ ID NO: 13), H506A (SEQ ID NO: 16, resulting in peptide of SEQ ID NO: 15), H544A (SEQ ID NO: 20, resulting in peptide SEQ ID NO: 19), N547A (SEQ ID NO: 22, resulting in peptide of SEQ ID NO: 21), Q583A (SEQ ID NO: 26, resulting in peptide of SEQ ID NO: 25), Q595A (SEQ ID NO: 24, resulting in peptide of SEQ ID NO: 23), Q617A (SEQ ID NO: 28, resulting in peptide of SEQ ID NO: 27), E543M/D504A (SEQ ID NO: 30, resulting in peptide of SEQ ID NO: 29), E543M/H506A (SEQ ID NO: 32, resulting in peptide of SEQ ID NO: 31), E543M/H544A (SEQ ID NO: 34, resulting in peptide of SEQ ID NO: 33), E543M/N547A (SEQ ID NO: 36, resulting in peptide of SEQ ID NO: 35) and E543M/Q595A (SEQ ID NO: 38, resulting in peptide of SEQ ID NO: 37) chiA-CTD mutants were synthesized by Synbio Technologies and cloned into pET28b vector using NcoI and XhoI restriction sites. All resulting clones were verified by DNA sequencing and then expressed and purified as described for wild-type ChiA-CTD (SEQ ID NO: 40).
[0118] Chitinase Activity Assay
[0119] Enzyme activity was determined using 4-Nitrophenol β-D-N,N′,N″-triacetylchitotriose (Sigma) as a substrate. All experiments were performed in triplicate. 10 μl of ChiA-FL (i.e. full length ChiA) (SEQ ID NO: 2), ChiA-NT (SEQ ID NO: 5), ChiA-CTD (SEQ ID NO: 40), ChiA-CTD.sup.E543M (SEQ ID NO: 17), ChiA-CTD.sup.Q583A (SEQ ID NO: 25) or ChiA-CTD.sup.Q617A (SEQ ID NO: 27) at 10 μg/ml in PBS were mixed with 90 μl of substrate at 0.4 mg/ml dissolved in 20 mM sodium acetate pH 4.8. These samples and a 300 μl standard (50 μM ρ-nitrophenol, 100 mM sodium carbonate) were incubated at 37° C. for 30 min and then the ChiA reactions were quenched with the addition of 200 μl of 100 mM sodium carbonate. The release of the chromophore r-nitrophenol (pNP) was measured at 405 nm and ChiA samples were corrected for absorption in a control sample with added PBS instead of protein. 1 unit of activity per mg enzyme (U/mg) was defined as the release of 1 mmol of pNP/mg of ChiA/min.
[0120] Chitin Binding Assay 250 μl ChiA-FL (SEQ ID NO: 2), ChiA-NT (SEQ ID NO: 5), ChiA-N1 (SEQ ID NO: 7), ChiA-N2 (SEQ ID NO: 9), ChiA-N3 (SEQ ID NO: 11), ChiA-CTD (SEQ ID NO: 40), ChiA-CTD.sup.D504A (SEQ ID NO: 13), ChiA-CTDH.sup.506A (SEQ ID NO: 15), ChiA-CTD.sup.E543 (SEQ ID NO: 17), ChiA-CTD.sup.H544A (SEQ ID NO: 19), ChiA-CTD.sup.N547A (SEQ ID NO: 21), ChiA-CTD.sup.Q595A (SEQ ID NO: 23) and BSA (Sigma) at 10 μM in 20 mM Tris-HCl pH 8.0, 200 mM NaCl were incubated with 50 μl chitin-resin (Sigma) and incubated whilst shaking for 30 min. The resin was washed three times with 500 μl of the same buffer and then proteins were eluted by incubating the resin in 250 μl of 8 M urea, 1% (w/v) SDS for 30 min whilst shaking. Protein samples prior to incubation with chitin-resin and the eluted protein/chitin-resin slurry were then analysed with SDS-PAGE. Eluted samples underwent an upward shift compared to the input samples due to the large differences in buffer conditions.
[0121] Crystal Structure Determination
[0122] Crystallization of ChiA CTD-domain (SEQ ID NO: 1) (30 mg/ml) was performed using the sitting-drop vapour-diffusion method grown in 0.2 M ammonium acetate, 0.1 M Bis-Tris pH 5.5, 45% (v/v) 2-Methyl-2,4-pentanediol at 293K. Native crystals were flash cooled in liquid nitrogen and diffraction data were collected at 100K on beamline I04 at the Diamond Light Source (DLS), UK. Crystals were also soaked for 1 min in well solution containing 1.0 M NaI, flash cooled in liquid nitrogen and data were collected at 100K on beamline I02 at the Diamond Light Source (DLS), UK. Data were processed with the CCP4 suite of programs. The structure of ChiA CTD-domain was determined with I-SIRAS. Models were built and refined with the CCP4 suite of programs.
[0123] SAXS Data Collection and Analysis
[0124] SAXS data were collected on beamline B21 at the Diamond Light Source (DLS), UK at 20° C. Full-length ChiA (SEQ ID NO: 2) in 20 mM Tris-HCI pH 8, 200 mM NaCl were measured at 4, 2, 1 and 0.5 mg/ml concentrations, after gel filtration using a Superdex 200 column (GE Healthcare), over a momentum transfer range of 0.004<q<0.4 Å-1. A fresh sample of BSA was measured as a standard. Buffer subtraction, intensity normalization, and data merging for the different sample concentrations were performed in SCATTER (DLS, UK). ChiA data collected above 1 mg/ml showed signs of aggregation and were discarded. Further analysis was carried out with the 1 mg/ml data using a q range 0.008<q<0.2 Å-1. Data was processed using the ATSAS software. An initial model of ChiA was created from PHYRE2 models of the N1- and N3-domains (residues 7-132; 300-399), a ROBETTA model of the N2-domain (residues 138-290) (SEQ ID NO: 9) and our crystal structure of the C-domain (residues 424-762) (SEQ ID NO: 1), with domain linker sequences kept unstructured. Determination of molecular model ensembles that best fit the SAXS data was performed using EOM2.0 software.
[0125] Mucin Binding ELISA
[0126] Immulon 2-HB 96-well plates (VWR) were coated overnight at 4° C. with 50 μl of partially purified mucins from bovine submaxillary glands (type I-S; Sigma) and porcine stomachs (type II and III; Sigma) at 100 pg/ml in 50 mM Carbonate/Bicarbonate pH 9.6. Wells were blocked for 1 hr at 25° C. with 200 μl of 0.1% (w/v) bovine serum albumin (BSA) in PBS-0.05% Tween 20 and then washed once with 200 μl of incubation buffer (0.05% (w/v) BSA in PBS-0.05% Tween 20). Wells were then incubated for 3 hrs at 25° C. with 50 μl of ChiA-FL (SEQ ID NO: 2), ChiA-NT (SEQ ID NO: 5), ChiA-N1 (SEQ ID NO: 7), ChiA-N2 (SEQ ID NO: 9), ChiA-N3 (SEQ ID NO: 11), ChiA-CTD (SEQ ID NO: 40), ChiA-CTDD504A (SEQ ID NO: 13), ChiA-CTDH506A (SEQ ID NO: 15), ChiA-CTDE543M (SEQ ID NO: 17), ChiA-CTDH544A (SEQ ID NO: 19), ChiA-CTDN547A (SEQ ID NO: 21), ChiA-CTDQ583A (SEQ ID NO: 25), ChiA-CTDQ595A (SEQ ID NO: 23), ChiA-CTDQ617A (SEQ ID NO: 27), NttE and SsIE at 10 μM in incubation buffer. This was followed by four washes with 200 μl of incubation buffer and incubation with 50 μl of anti-His-HRP antibody (Sigma), diluted 1:2000 in incubation buffer for 1 hr at 24° C. After four washes with 200 μl of incubation buffer, 150 μl of o-Phenylenediamine dihydrochloride (Sigma) was added for 30 min and then data was recorded at 450 nm.
[0127] Immunoblot for Detecting Secreted Mucinase Activity
[0128] L. pneumophila strains that had been grown for three days on BCYE agar were suspended into 20 ml of BYE broth to an OD660 of 0.3 and grown overnight at 37° C. to an OD660 of 3.0-3.3. Bacteria were sub-cultured into fresh BYE medium to an OD660=0.3 and grown, with shaking, to an OD660 of 1.0, which corresponded to the mid-log phase. Supernatants were collected, filtered through a 0.22-μm filter, and concentrated using 10-kDa Amicon concentrators (EMD Millipore). 200 μl of concentrated supernatants were incubated with 200 or 400 μg of type II porcine stomach mucins. As controls, the mucins were either incubated in uninoculated BYE broth or in BYE broth containing 50 pl of a known mucinase cocktail, which consisted of 10 μl each of pepsin (0.5 mg/ml), pronase (10 mg/ml), β-N-acetylglucosaminidase (2.5 μM), fucosidase (5 U/ml), and DTT (1 mM) dissolved in 940 μl of ddH20. The various samples were incubated statically for 3 h at 25° C. and then subjected to electrophoresis prior to immunoblotting. Reactions were stopped by adding 200 μl of 2× Laemmli buffer and incubating for 5 min at 100° C., and 35 μl of each sample was electrophoresed through a Criterion 4-20% SDS-PAGE gel (Bio-Rad) for 1.5 h at 250 volts. The separated reaction products were transferred onto PVDF membrane over the course of 13 min using the semi-dry Invitrogen Power-Blotter and Power Blotter transfer blotting solution. Following incubation in 1% BSA in TBST for 1 h at room temperature, the membranes were incubated overnight at 4° C. with biotinylated wheat germ agglutinin that had been diluted 1:2000 (from a 1 mg/ml stock) in TBST with BSA. After three, 5-min washes with TBST buffer, the membranes were further incubated for 1 h at 37° C. with Avidin-HRP that had been diluted 1:2000 in BSA-containing TBST. Finally, subsequent to a series of washes, the blot was incubated for 1 min in 2 ml Amersham ECL reagent and then exposed to X-ray film.
[0129] Mucin Coated Transwell Penetration Assay
[0130] L. pneumophila wild-type 130b (WT) and chiA mutant NU318 (chiA) were grown for three days on BCYE agar and then resuspended into 20 ml of BYE broth to an OD660 of 0.3 and grown overnight at 37° C. to an OD660 of 3.0-3.3. Bacteria were sub-cultured into fresh BYE medium to an OD660 of 0.3 and grown, with shaking, to an OD660 of 1.0, which corresponded to the mid-log phase. Bacteria were then diluted in BYE broth to OD660 of 0.3. Transwell plates (Corning) were used for analysis of bacterial crossing of a mucin layer. 500 μl of sterile BYE broth was added to the bottom of either empty wells, or wells containing 3.0 μm transwells. Transwells were either kept uncoated or coated with 50 or 100 μg of type II porcine mucin in bicarbonate buffer. After 1 hr of coating transwells with either control BYE broth or type II mucin, 500 μl of 0.3 OD660 L. pneumophila (chiA or WT) was applied to either the empty well, or to the top of a transwell. Bacteria that were able to cross the transwell membrane to the bottom of the well were collected 2 hrs after application to wells, diluted and plated onto BCYE plates for CFU analysis. Each experiment had 3 technical replicates. N=3 experimental replicates were analyzed. Two-way ANOVA with Boneferri post-hoc statistical analysis was used.
[0131] Immunoblot for Detecting Recombinant ChiA MUC5AC Activity
[0132] Porcine type II stomach mucin (Sigma) was dissolved in PBS at 8 mg/ml and incubated for 5 min with 5 mM EDTA to remove divalent cations. This was then buffer exchanged into PBS using a 30-50 kDa MWCO concentrator (Generon). Recombinant ChiA-FL (SEQ ID NO: 2), ChiA-NT (SEQ ID NO: 5), ChiA-CTD (SEQ ID NO: 40), ChiA-CTD.sup.D504A (SEQ ID NO: 13), ChiA-CTD.sup.H506A (SEQ ID NO: 15), ChiA-CTD.sup.E543M (SEQ ID NO: 17), ChiA-CTD.sup.H544A (SEQ ID NO: 19), ChiA-CTD.sup.N547A (SEQ ID NO: 21), ChiA-CTD.sup.Q583A (SEQ ID NO: 25), ChiA-CTD.sup.Q595A (SEQ ID NO: 23), ChiA-CTD.sup.Q617A (SEQ ID NO: 27) and SsIE were incubated for 5 min with 5 mM EDTA to remove any bound metal ions. These were then dialyzed extensively against PBS with 1 mM ZnCl.sub.2 and the concentrations adjusted to 20 μM. Mucins were mixed with an equal volume of protein in either PBS, 1 mM ZnCl.sub.2 or PBS, 5 mM EDTA and incubated for 3 hr at 25° C. Reactions were stopped with the addition of an equal volume of 2× Laemmli buffer and incubated for 5 min at 100° C. Samples were then run on a Criterion 4-20% SDS-PAGE gel (Bio-Rad), followed by transfer onto a PVDF membrane using the semi-dry Invitrogen Power-Blotter and Power Blotter transfer blotting solution. The membrane was incubated in 1% BSA in TBST for 1 h at room temperature, and then overnight at 4° C. with biotin conjugated MUC5AC antibody (Thermo Fisher Scientific) that had been diluted 1:2000 in TBST with BSA. After three, 5-min washes with TBST buffer, membranes were incubated for 1 h at 37° C. with Avidin-HRP diluted 1:2000 in BSA-containing TBST and followed by three washes for 5-min each. This was then incubated with avidin-HRP (1:2000 dilution) for 1 hr at 25° C. and then treated with enhanced chemiluminescence substrate (ECL; Pierce) before detection by enhanced chemiluminescence.
[0133] Molecular Dynamics
[0134] MD simulations and analyses were performed using GROMACS 2016 v3 software. The protein was described using the Amber99SB*-ILDN force field and solvated using a truncated octahedral box of TIP3P water molecules. A minimal distance of 12 ∈ was set between the protein and the walls of the box. The charge of the ionisable residues was set to that of their standard protonation state at pH 7. Zn.sup.2+ ions were added by randomly replacing water molecules. A high Zn.sup.2+ concentration (0.75 M) was used to have a faster sampling of possible Zn.sup.2+ sites around the protein surface. Cl.sup.− counterions were added to neutralise the system.
[0135] Periodic boundary conditions were applied. The equations of motion were integrated using the leap-frog method with a 2-fs time step. The LINCS algorithm was chosen to constrain all covalent bonds in the protein, while SETTLE was used for water molecules. The Particle Mesh Ewald (PME) method was used for electrostatic interactions, with a 9-Å cut-off for the direct space sums, a 1.2-Å FFT grid spacing, and a 4-order interpolation polynomial for the reciprocal space sums. A 9-Å cut-off was used for van der Waals interactions. Long-range corrections to the dispersion energy were included.
[0136] Each system was minimised through 3 stages with 2000 (positional restraints on heavy atoms)+3000 steps of steepest descent, followed by 2000 steps of conjugate gradient. Positional restraints on heavy atoms were initially set to 4.8 kcal/mol/Å.sup.2 and they were gradually decreased to 0 in 1.5 ns, while the temperature was increased from 200 to 300 K at constant volume. The system was then allowed to move freely and was subjected to 1-ns equilibration in NVT conditions at T=300 K. This was followed by a 2-ns equilibration in NPT conditions with T=300 K and p=1 bar. For these equilibration steps, the Berendsen algorithm was used for both temperature and pressure regulation with coupling constants of 0.2 and 1 ps, respectively. At last, a 2-ns NPT equilibration was run after switching to the v-rescale thermostat with a coupling constant of 0.1 ps and the Parrinello-Rahman barostat with a coupling constant of 2 ps. Production NPT runs were then performed for 50 ns, saving the coordinates every 1 ps. Multiple replicas were run, with each replica starting from a different configuration of the ions around the protein, for an aggregated simulation time of 1.7 ps (34×50 ns). The spatial distribution function (sdf) of Zn.sup.2+ around the protein was calculated with the gmx spatial tool from GROMACS. Trajectories from the different replicas were first concatenated together and each frame was aligned through a best-fit superposition to the starting frame using the protein coordinates. A 0.5-Å grid spacing was used for the sdf calculation. The average of non-null sdf values was calculated and isosurfaces connecting points with sdf=20, 25 and 30× average sdf were considered.
[0137] Isothermal Calorimetry
[0138] ITC experiments were performed at 293 K using a MicroCal iTC200 calorimeter (Malvern). ChiA-CTD (SEQ ID NO: 40), ChiA-CTD.sup.E543M (SEQ ID NO: 17), ChiA-CTD.sup.E543M/D504A (SEQ ID NO: 29), ChiA-CTD.sup.E543M/H506A (SEQ ID NO: 31), ChiA-CTD.sup.E543M/H544A (SEQ ID NO: 33), ChiA-CTD.sup.N547A (SEQ ID NO: 21) and ChiA-CTD.sup.Q595A (SEQ ID NO: 23) were dialyzed into buffer containing 20 mM Tris pH 8.0, 200 mM NaCl. Experiments were performed by placing the solution containing ChiA proteins in the cell at 70 μM and the solution containing the zinc (dissolved in dialysis buffer) in the syringe at 2 mM. For each titration 18 injections of 2 μl were performed. Integrated data, corrected for heats of dilution, were fitted using a nonlinear least-squares algorithm to a 1:1 binding curve, using the MicroCal Origin 7.0 software package. Each experiment was repeated at least twice, and representative values are reported.
[0139] Results
[0140] ChiA is a Multi-Domain Protein
[0141] Full-length ChiA from L. pneumophila 130b (ChiA-FL; numbered 1-762 for the mature protein; NCBI accession WP_072401826.1) with an N-terminal His6-tag was produced in Escherichia coli K12 and purified by nickel-affinity and size exclusion chromatography. Despite extensive screening, ChiA-FL resisted crystallization and therefore bioinformatics analysis was used to produce a series of subdomain constructs for further characterization (
[0142] To examine the function of the ChiA N-terminal domains their endochitinase activity was examined. Each construct was expressed with an N-terminal His6-tag in E. coli K12 and purified by nickel-affinity and size exclusion chromatography. All reagents were well folded and ChiA-FL and ChiA-CTD were both active against p-nitrophenyl β-D-128 N,N′,N″ triacetylchitotriose (pNP-[GlcNAc].sub.3) but no activity was detected for ChiA-NT or an E543M ChiA-CTD chitinase active site mutant (ChiA-CTD.sup.E543M) (
[0143] Atomic Structure of ChiA-CTD
[0144] Crystallographic studies of the ChiA subdomains were then initiated. Crystals for ChiA-CTD were obtained and its structure was determined using iodide single isomorphous replacement with anomalous scattering (SIRAS) phasing. Electron-density maps were refined to 1.7 Å and the final model contains two identical chains, with all molecules built except for the N-terminal His6-tags and adjacent ChiA-CTD residues Val419 to Gly424. This indicates that residues 419 to 423 of the ChiA sequence may be deleted without losing protein function of ChiA-CTD, resulting in the sequence of SEQ ID NO: 1. Also indicated is that these five residues are not included in the crystal because they stay unstructured during crystallisation. Each chain forms an anticipated GH18 α/β-fold and is composed of 11 β-strands and 13 α-helices (
[0145] The overall structure of ChiA-CTD is highly similar to other GH18 chitinase domains, and the Dali server identified Bacillus cereus ChiNCTU2 enzyme inactive E145G/Y227F mutant in complex with chitotetraose (Protein Data Bank (PDB) ID code 3n18) as having the highest homology (Z score: 36.3; rmsd: 2.2 Å). The chitinase active sites of ChiNCTU2 and ChiA-CTD have high primary sequence identity and tertiary structure homology (
[0146] ChiA is an Elongated and Dynamic Structure in Solution
[0147] Small angle X-ray scattering (SAXS) was used to model the global structure of full-length ChiA in solution. Four different concentrations at 4, 2, 1, and 0.5 mg/ml were measured but signs of aggregation were apparent at concentrations above 1 mg/ml. All further analysis was carried out with the data from the 1 mg/ml sample. Guinier analysis suggested a radius of gyration (R.sub.g), the root mean square distance to the particles centre of mass, of 5.43 nm and analysis of the distance distribution function (P(r)) suggested a maximum particle dimension (D.sub.max) of 17.77 nm and R.sub.g of 5.45 nm. Using BSA as a standard, a particle molecular mass of 89.2 kDa was calculated, which is within the method error range for a monomeric 82.6 kDa ChiA.
[0148] The SAXS data indicated that ChiA is a highly dynamic particle in solution and this is likely due to flexibility within the ChiA inter-domain linkers. Therefore ensemble optimization method (EOM) was used to determine molecular model ensembles of ChiA that best fit the SAXS data. As it was not possible to obtain crystals for ChiA N-domains, an initial model of ChiA was created using a Phyre2 derived N1-domain (residues 22-147), a Robetta derived N2-domain (encompassing two further subdomains: residues 152-245 and 248-305), a Phyre2 derived ChiA N3-domain (residues 315-414) and the crystal structure of ChiA-CTD (residues 439-777), separated by flexible linkers (
[0149] ChiA is a Mucin Binding Protein
[0150] Some bacterial chitinases and chitin binding proteins are able to promote infection through adhesion to and/or degradation of host glycoconjugates (8) and it was hypothesized that ChiA may interact with exogenous mucins in the lungs and elsewhere. Therefore the binding capacity of recombinant ChiA-FL, ChiA domains, L. pneumophila NttE, another T2SS substrate (negative control) and E. coli SsIE, a known mucin binding protein and mucinase (9), to immobilized commercially available mucin extracts was examined by ELISA using anti-His antibodies (
[0151] ChiA Increases Penetration of L. pneumophila through the Mucin Layer
[0152] It was next examined whether secreted ChiA is able to degrade mucins. Porcine stomach type II mucin extract was incubated with supernatants from L. pneumophila 130b wild-type and NU318 (chiA) mutant strains or a cocktail of enzymes (pepsin, pronase, β-N-acetylglucosaminidase, fucosidase) with known activity against mucins, and then analysed by immunoblotting using wheat germ agglutinin (
[0153] Mucins are high molecular weight glycoproteins that contain large numbers of heavily O-glycosylated serine/threonine rich repeat sequences (10). They exist as cell surface exposed transmembrane proteins or secreted gel-forming proteins of the mucosal barrier and act as a first line of defence against bacterial infection. The normal stomach mucosa is characterised by expression of MUC1, MUC5AC, and MUC6 mucins, however, MUC1 and MUC5AC are also major mucins expressed in the mammalian airway and lung. Therefore, to determine whether ChiA can facilitate mucin penetration of L. pneumophila an artificial mucin penetration assay was performed. After a 2 hr incubation with either L. pneumophila wild-type 130b or chiA mutant NU318, it was observed that there was a 2.7- and 2.4-fold decrease in the number of colonies from the chiA mutant compared with wild-type in the presence of 50 and 100 μg type II mucin extract, respectively (
[0154] ChiA-CTD is a Zn2.sup.+-Dependent Peptidase
[0155] The ability of recombinant ChiA to specifically degrade MUC5AC within type II mucin extracts was then examined by immunoblotting and compared its profile to that of recombinant E. coli SsIE. Intact MUC5AC did not enter the gel in the buffer controls and this was likely due to its high carbohydrate content and large mass (>500 kDa before glycosylation). However, incubation of type II mucin extract with ChiA-FL and ChiA-CTD, but not ChiA-NT, resulted in the processing of MUC5AC into a new ˜70 kDa fragment (
[0156] To evaluate this further Molecular Dynamics (MD) simulations were performed and examined the ability of ChiA-CTD to bind Zn.sup.2+ in silico. The protein was ‘soaked’ in a water solution at high Zn.sup.2+ concentration and the system was then left to evolve over time to identify the regions on the protein surface where Zn.sup.2+ ions tend to bind. Multiple short simulations were run starting from different random placements of Zn.sup.2+ ions, for an aggregated simulation time of 1.7 μs. Analysis of the Zn.sup.2+ spatial distribution function (sdf) calculated on the concatenated trajectories highlighted multiple high Zn.sup.2+ density sites in the region around the chitinase active site, providing information on the different ways in which Zn.sup.2+ could bind to the protein in this region. The highest density was found at the chitinase active site (region 1), where Zn.sup.2+ is coordinated by Asp541, Glu543 and Gln617, with two other sites in close proximity (regions 2,3) coordinated by Glu543 and Q583 (
[0157] To verify these in silico observation isothermal titration calorimetry (ITC) was used and measured an equilibrium dissociation constant (KD) of 556 nM for approximately three Zn.sup.2+ ions (N=3.04) binding to wild-type ChiA-CTD (SEQ ID NO: 40) (
[0158] ChiA-CTD Uses a Novel Mechanism to Cleave Mucin-Like Glycoproteins
[0159] To assess the role of these residues in the degradation of MUC5AC, D504A (SEQ ID NO: 13), H506A (SEQ ID NO: 15), H544A (SEQ ID NO: 19), N547A (SEQ ID NO: 21) and Q595A (SEQ ID NO: 23) single site mutations were created in ChiA-CTD. All constructs were well folded and with our existing single site ChiA variants (ChiA-CTD.sup.E543M (SEQ ID NO: 17), ChiA-CTD.sup.Q583A (SEQ ID NO: 25) and CTDQ.sup.617A (SEQ ID NO: 27)), they were still able to bind immobilized type II and III mucin extracts in ELISA assays (
[0160] Discussion
[0161] Chitin is highly abundant in the environment and can function as a source of carbon and nitrogen but several chitinases have been identified as key virulence factors in bacterial disease (8). These include Enterococcus faecalis efChiA, E. coli ChiA, Vibrio cholerae ChiA2, Francisella tularensis ChiA, Listeria monocytogenes ChiA and ChiB, Pseudomonas aeruginosa ChiC, Salmonella Typhimurium ChiA and L. pneumophila ChiA. Although it is unclear how these enzymes perform these dual functions, there is strong evidence that they interact with host glycoconjugates and through their localization and/or enzymatic activity are able to modulate host defence mechanisms (8). It has been determined that L. pneumophila ChiA has activity against porcine stomach derived mucins, and the degradation of MUC5AC produces a similar degradation profile to the M60-family E. coli zinc-aminopeptidase SsIE (9). Recent structural analysis of Bacteroides thetaiotaomicron BT4244, Pseudomonas aeruginosa IMPa and Clostridium perfringens ZmpB M60 proteins has revealed unique structural adaptations that allow them to accommodate different glycan sequences while all cleaving the peptide bond immediately preceding the glycosylated residue (13). Similarly, E. coli StcE is an M66-family zinc metalloprotease that recognizes distinct peptide and glycan motifs in mucin-like proteins and then cleaves the peptide backbone using an extended HExxHxxGxxH motif (15). In StcE, three histidine residues in the conserved motif act as ligands for a single catalytic zinc, while in M60 enzymes two histidine and another residue perform this role. A nucleophilic water molecule is the fourth ligand for the zinc, and this is coordinated by a conserved glutamate, which acts as a general base during catalysis. It has been shown that L. pneumophila ChiA functions in a similar fashion to SsIE and StcE but as it does not contain a HExxH motif, ChiA represents a new class of peptidase that can degrade mammalian mucin-like proteins via a novel mechanism.
[0162] Four residues in ChiA that are significant for providing zinc binding in the peptidase active site have been identified (His506, His544, Asn547 and Gln595) and these likely coordinate a single zinc ion. These residues along with Asp504, Gln583 and Gln617 are also significant for providing peptidase activity. Examination of the ChiA-CTD structure suggests that His544, Asn547 and Gln595 are ligands for the zinc, with Asp504 the general base (
[0163] Mucins derived from the lung are not commercially available, but it has been shown that ChiA has specificity for and can degrade MUC5AC purified from the porcine stomach, which is also a major mucin expressed in the human airway and lung [2,4]. MUC5AC is composed of T-antigen (Galβ1-3GalNAcαSer/Thr), core 2 (GlcNAcβ1-6(Galβ1-3)GalNAcαSer/Thr) and sialyl T-antigen (NeuAcα2-6(Galβ1-3)GalNAcαSer/Thr) core glycan structures (12). While the T-antigen contains a linear array of carbohydrates, core 2 and sialyl T-antigen have branched structures. Our study suggests that the specificity of ChiA-CTD for O-glycosylated substrates is mediated by glycan recognition in the chitin binding groove, which then orientates the peptide backbone of the substrate towards the peptidase active site for proteolysis (
[0164] MUC5AC is a gel forming mucin and the mucin penetration assay indicates that one role for ChiA in the lung is to facilitate bacterial penetration of the alveolar mucosa, which would increase access to host tissue. However, the ability of ChiA-CTD to target and degrade MUC5AC could be beneficial in the context of, for example, asthma where this mucin is overproduced and may underlie the pathology of this disease.
[0165] Our finding that ChiA-CTD is capable of mucolytic activity, particularly against MUC5AC, provides a new therapeutic application of chitinase in mucus-driven diseases, such as asthma.
REFERENCES
[0166] 1) Hansson, G. C. (2019) Mucus and mucins in diseases of the intestinal and respiratory tracts. Journal of Internal Medicine 285, 479-490.
[0167] 2) Fahy, J. V. & Dickey, B. F. (2010) Airway mucus function and dysfunction. New. Engl. J. Med. 363, 2233-47.
[0168] 3) Kuyper, L. M., Pare, P. D., Hogg, J. C., Lambert, R. K., Ionescu, D., Woods, R. & Bai, T. R. (2003) Characterization of airway plugging in fatal asthma. Am. J. Med. 115, 6-11.
[0169] 4) Bonser, L. R. & Erle, D. J. (2017) Airway Mucus and Asthma: The Role of MUC5AC and MUC5B. J. Clin. Med. 6, pii: E112.
[0170] 5) Evans, C. M., Raclawska, D. S., Ttofali, F., Liptzin, D. R., Fletcher, A. A., Harper, D. N., McGing, M. A., McElwee, M. M., Williams, O. W., Sanchez, E., Roy, M. G., Kindrachuk, K. N., Wynn, T. A., Eltzschig, H. K., Blackburn, M. R., Tuvim, M. J., Janssen, W. J., Schwartz, D. A. & Dickey, B. F. (2015) The polymeric mucin Muc5ac is required for allergic airway hyperreactivity. Nature Communications 6, 6281.
[0171] 6) Fanta, C. H. Asthma. (2009) New. Engl. J. Med. 360, 1002-14.
[0172] 7) DebRoy, S., Dao, J., Soderberg, M., Rossier, O. & Cianciotto, N. P. (2006) Legionella pneumophila type II secretome reveals unique exoproteins and a chitinase that promotes bacterial persistence in the lung. Proc. Natl. Acad. Sci. U.S.A. 103, 19146-51.
[0173] 8) Frederiksen R F, Paspaliari D K, Larsen T, Storgaard B G, Larsen M H, Ingmer H, et al. Bacterial chitinases and chitin-binding proteins as virulence factors. Microbiology. 2013; 159(Pt 5):833-47. doi: 10.1099/mic.0.051839-0.
[0174] 9) Luo Q, Kumar P, Vickers T J, Sheikh A, Lewis W G, Rasko D A, et al. Enterotoxigenic Escherichia coli secretes a highly conserved mucin-degrading metalloprotease to effectively engage intestinal epithelial cells. Infect Immun. 2014; 82(2):509-21. doi: 10.1128/IAI.01106-13
[0175] 10) Baldus S E, Engelmann K, Hanisch F G. MUC1 and the MUCs: a family of human mucins with impact in cancer biology. Crit Rev Clin Lab Sci. 2004; 41(2):189-231. doi: 10.1080/10408360490452040.
[0176] 11) Evert C, Loesekann T, Bhat G, Shajahan A, Sonon R, Azadi P, et al. Generation of
[0177] 12) C-Labeled MUC5AC Mucin Oligosaccharides for Stable Isotope Probing of Host-Associated Microbial Communities. ACS Infect Dis. 2019;5(3):385-93. doi: 10.1021/acsinfecdis.8b00296.
[0178] 13) Noach I, Ficko-Blean E, Pluvinage B, Stuart C, Jenkins M L, Brochu D, et al. Recognition of protein-linked glycans as a determinant of peptidase activity. Proc Natl Acad Sci USA. 2017; 114(5):E679-E88.
[0179] 14) Hsieh Y C, Wu Y J, Chiang T Y, Kuo C Y, Shrestha K L, Chao C F, et al. Crystal structures of Bacillus cereus NCTU2 chitinase complexes with chitooligomers reveal novel substrate binding for catalysis: a chitinase without chitin binding and insertion domains. J Biol Chem. 2010; 285(41):31603-15.
[0180] 15) Yu A C, Worrall L J, Strynadka N C. Structural insight into the bacterial mucinase StcE essential to adhesion and immune evasion during enterohemorrhagic E. coli infection. Structure. 2012; 20(4):707-17.
TABLE-US-00001 (ChiA-CTD crystal structure amino acid sequence) SEQ ID NO: 1 GRIIGYVPGWKTPPAAQELASAGYTHVMIAFGVFSTNTPGVIVPAFET ITKEYIQSLHQAGIKVILSLGGALTSIPNTTVDFHQVLVASSSPEAFK QTFINSLKELISQYGFDGFDTDIEHGINASGSFSQPQGDIAVLASIIN TMYSQNSSLLITLTPQVANIAATSGFDQTWGNYASLIMQTHQSLAWVG IQLYNTGCAFGIDQVCYGPTPTDTPDFSVAMATDLLENWPATVNGRPT GFQPYISYLRPSQIVIGYPSPNASGGSDGSPVTPTTTIKRAIQCLKTA IAGNTSCGVYVPPRAYGNIGGVFNWEVTYDKNNQFKFAKELKNCAING VCE (ChiA amino acid sequence) SEQ ID NO: 2 NTSLKPSIAQPTACVNSLFTATGNQHWKSIVLKLTNNCNQAVDFQNST VSFQTTAALNTSFWGDFSPLSYPDNALNISSQPQSGGNYLATLNLHFP SYPGANSKLPVGSSISIKYGAVTDSHIEGTANVYLSTTVESGSIQLIN AAAKPTNVSQGYALVHVTMNGQSVSDVQLPWETSKTLSGFAAGNYAIS AETVTDSNGNLYLGQANPSMVNVIANQTTSSTINYARVQETGKIKIHV QNLPGELSNYNENPTVLITQSQSGNSRSQHAVWGNTTTVAELKEGSSY QFSTPAIQYNDYNCWPTFTPSSLVASAANVPTTNLTYQCAQIVKDNVT INVSGAPSSLASLKIILTPNDGSQTVEQTIDLANGVGSSAISLTDGVI YTLSSEGVPGYTVQFSPQPLTATENATVNITLSPVTAAKGRIIGYVPG WKTPPAAQELASAGYTHVMIAFGVFSTNTPGVIVPAFETITKEYIQSL HQAGIKVILSLGGALTSIPNTTVDFHQVLVASSSPEAFKQTFINSLKE LISQYGFDGFDTDIEHGINASGSFSQPQGDIAVLASIINTMYSQNSSL LITLTPQVANIAATSGFDQTWGNYASLIMQTHQSLAWVGIQLYNTGCA FGIDQVCYGPTPTDTPDFSVAMATDLLENWPATVNGRPTGFQPYISYL RPSQIVIGYPSPNASGGSDGSPVTPTTTIKRAIQCLKTAIAGNTSCGV YVPPRAYGNIGGVFNWEVTYDKNNQFKFAKELKNCAINGVCE (ChiA-CTD crystal structure nucleic acid sequence) SEQ ID NO: 3 GGGCGTATTATTGGTTACGTACCGGGATGGAAAACTCCACCTGCCGCT CAAGAGTTGGCTAGCGCGGGTTATACTCATGTCATGATTGCTTTCGGC GTATTTAGTACCAATACTCCGGGTGTTATTGTTCCTGCTTTTGAAACA ATAACCAAAGAATATATTCAGTCTCTTCATCAAGCCGGGATTAAAGTT ATTCTTTCTTTAGGTGGTGCGTTAACTAGTATTCCCAATACAACAGTA GATTTTCACCAGGTTTTAGTAGCTTCTTCTTCACCAGAGGCATTTAAA CAAACATTTATCAACTCTTTAAAGGAGTTAATTTCTCAATATGGTTTT GATGGGTTTGATACAGATATTGAGCATGGTATTAACGCTAGCGGTTCC TTTTCTCAACCACAGGGTGACATTGCTGTCTTAGCAAGCATTATCAAT ACGATGTACAGCCAAAATTCTTCTCTGCTAATTACTCTGACACCTCAA GTGGCTAATATTGCTGCAACAAGCGGTTTCGACCAAACCTGGGGGAAT TATGCCTCTTTAATTATGCAAACCCATCAGTCTTTAGCGTGGGTAGGT ATCCAGCTTTACAATACAGGATGTGCTTTCGGAATTGATCAAGTATGC TATGGTCCTACACCAACTGATACCCCTGATTTTTCAGTAGCTATGGCT ACCGATTTATTGGAGAATTGGCCAGCAACGGTCAATGGACGTCCTACA GGATTTCAACCTTATATTAGCTATTTAAGACCTTCCCAAATTGTCATT GGTTATCCATCTCCAAATGCTAGTGGTGGCAGTGACGGTTCACCGGTT ACTCCGACAACCACAATCAAGCGGGCTATTCAGTGCCTTAAGACAGCA ATTGCCGGTAATACCAGTTGTGGTGTTTATGTTCCGCCAAGAGCTTAT GGGAATATCGGTGGTGTATTTAACTGGGAAGTAACTTATGATAAGAAC AATCAATTCAAATTTGCAAAAGAATTGAAAAATTGTGCTATTAATGGT GTTTGTGAGTAA (ChiA nucleic acid sequence) SEQ ID NO: 4 AATACCTCTTTAAAACCCTCAATTGCCCAGCCTACAGCCTGTGTAAAC TCACTTTTTACAGCAACGGGAAATCAACACTGGAAATCAATCGTATTA AAGTTAACCAATAATTGCAATCAGGCAGTCGATTTTCAAAATTCAACT GTCTCCTTTCAAACAACAGCAGCTTTAAATACCTCTTTTTGGGGGGAT TTTTCTCCTTTATCTTACCCGGATAATGCTTTAAATATTTCTTCTCAA CCTCAATCTGGCGGAAACTATCTAGCCACTTTAAACCTGCATTTTCCC AGCTATCCGGGTGCTAATAGCAAGTTACCTGTCGGAAGTTCTATTTCA ATTAAATATGGGGCAGTCACTGATAGTCATATCGAGGGAACGGCTAAT GTTTATTTAAGCACAACGGTTGAATCAGGAAGCATCCAATTAATCAAT GCTGCTGCAAAACCAACAAATGTGTCACAAGGATATGCATTAGTTCAT GTCACAATGAATGGTCAATCAGTCAGTGATGTGCAATTACCATGGGAA ACTTCAAAGACTCTATCTGGGTTTGCTGCAGGTAATTATGCTATTTCT GCTGAAACGGTTACTGACAGTAATGGCAATCTTTATCTGGGACAGGCC AATCCCAGCATGGTGAATGTGATTGCAAACCAAACAACGAGCTCGACT ATTAATTATGCTCGGGTACAAGAGACAGGCAAGATCAAGATCCATGTG CAGAACCTCCCTGGCGAATTAAGCAACTACAATGAAAATCCAACTGTT CTAATTACCCAGAGTCAATCAGGAAATTCACGCTCACAGCATGCCGTT TGGGGGAACACAACGACTGTTGCTGAGTTGAAAGAGGGGAGTAGTTAC CAATTCTCAACTCCTGCAATTCAATATAACGATTACAATTGCTGGCCC ACTTTCACACCATCTTCCTTAGTGGCAAGTGCTGCAAATGTTCCAACT ACCAATTTAACCTATCAGTGTGCCCAGATTGTGAAAGATAATGTGACA ATTAATGTCAGTGGCGCTCCATCCTCCCTGGCTTCATTGAAAATTATT TTAACTCCCAACGATGGTTCACAAACAGTAGAACAGACAATAGATTTG GCCAATGGTGTTGGTTCATCTGCCATTTCTTTAACTGACGGGGTTATT TATACACTTTCAAGTGAAGGTGTTCCCGGCTATACAGTACAATTTTCG CCCCAACCTTTAACAGCAACAGAAAATGCAACAGTAAACATCACTTTA TCTCCGGTAACCGCTGCAAAAGGGCGTATTATTGGTTACGTACCGGGA TGGAAAACTCCACCTGCCGCTCAAGAGTTGGCTAGCGCGGGTTATACT CATGTCATGATTGCTTTCGGCGTATTTAGTACCAATACTCCGGGTGTT ATTGTTCCTGCTTTTGAAACAATAACCAAAGAATATATTCAGTCTCTT CATCAAGCCGGGATTAAAGTTATTCTTTCTTTAGGTGGTGCGTTAACT AGTATTCCCAATACAACAGTAGATTTTCACCAGGTTTTAGTAGCTTCT TCTTCACCAGAGGCATTTAAACAAACATTTATCAACTCTTTAAAGGAG TTAATTTCTCAATATGGTTTTGATGGGTTTGATACAGATATTGAGCAT GGTATTAACGCTAGCGGTTCCTTTTCTCAACCACAGGGTGACATTGCT GTCTTAGCAAGCATTATCAATACGATGTACAGCCAAAATTCTTCTCTG CTAATTACTCTGACACCTCAAGTGGCTAATATTGCTGCAACAAGCGGT TTCGACCAAACCTGGGGGAATTATGCCTCTTTAATTATGCAAACCCAT CAGTCTTTAGCGTGGGTAGGTATCCAGCTTTACAATACAGGATGTGCT TTCGGAATTGATCAAGTATGCTATGGTCCTACACCAACTGATACCCCT GATTTTTCAGTAGCTATGGCTACCGATTTATTGGAGAATTGGCCAGCA ACGGTCAATGGACGTCCTACAGGATTTCAACCTTATATTAGCTATTTA AGACCTTCCCAAATTGTCATTGGTTATCCATCTCCAAATGCTAGTGGT GGCAGTGACGGTTCACCGGTTACTCCGACAACCACAATCAAGCGGGCT ATTCAGTGCCTTAAGACAGCAATTGCCGGTAATACCAGTTGTGGTGTT TATGTTCCGCCAAGAGCTTATGGGAATATCGGTGGTGTATTTAACTGG GAAGTAACTTATGATAAGAACAATCAATTCAAATTTGCAAAAGAATTG AAAAATTGTGCTATTAATGGTGTTTGTGAGTAA