RANDOMIZED PEPTIDE LIBRARIES PRESENTED BY HUMAN LEUKOCYTE ANTIGENS
20210309993 · 2021-10-07
Assignee
Inventors
Cpc classification
C40B40/10
CHEMISTRY; METALLURGY
A61K39/39
HUMAN NECESSITIES
A61K39/00
HUMAN NECESSITIES
C40B40/02
CHEMISTRY; METALLURGY
C12N15/1086
CHEMISTRY; METALLURGY
C12N15/1037
CHEMISTRY; METALLURGY
C07K2319/40
CHEMISTRY; METALLURGY
C07K14/4748
CHEMISTRY; METALLURGY
C07K2319/035
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
Abstract
Described herein is an antigen screening library comprising a plurality of Human Leukocyte Antigen (HLA)-antigen polypeptide complexes, the HLA-antigen polypeptide complexes comprising: (a) an HLA polypeptide; (b) a randomized antigen polypeptide comprising an amino acid sequence set forth in any one of SEQ ID NOs: 1 to 209, wherein the randomized antigen polypeptide is selected to specifically bind to peptide binding cleft of the HLA polypeptide; and (c) a β2 microglobulin polypeptide. These libraries can be used to determine antigenic polypeptides capable of interacting and stimulating a selected T cell receptor (TCR).
Claims
1. An antigen screening library comprising a plurality of Human Leukocyte Antigen (HLA)-antigen polypeptide complexes, the HLA-antigen polypeptide complexes comprising: a) an HLA polypeptide, the HLA polypeptide comprising a peptide binding cleft; b) a randomized antigen polypeptide comprising an amino acid sequence set forth in any one of SEQ ID NOs: 1 to 209, wherein the randomized antigen polypeptide specifically binds to the peptide binding cleft of the HLA polypeptide; and c) a Beta-2 (β2) microglobulin polypeptide.
2. The antigen screening library of claim 1, wherein the plurality of HLA-antigen complexes comprises an HLA polypeptide selected from the list consisting of A3, A11, A23, A24, A26, A30, A31, A33, A68, B7, B8, B15, B27, B40, B44, B51, B53, B57, C1, C2, C3, C4, C5, C6, C7, C8, and E.
3. The antigen screening library of claim 1, wherein the plurality of HLA-antigen complexes comprises at least five, ten, fifteen, twenty, or twenty-five different HLA polypeptides selected from the list consisting of A3, A11, A23, A24, A26, A30, A31, A33, A68, B7, B8, B15, B27, B40, B44, B51, B53, C1, C2, C3, C4, C5, C6, C7, C8, and E.
4. The antigen screening library of claim 1, wherein the plurality of HLA-antigen complexes comprises all of A3, A11, A23, A24, A26, A30, A31, A33, A68, B7, B8, B15, B27, B40, B44, B51, B53, C1, C2, C3, C4, C5, C6, C7, C8, and E HLA polypeptides.
5. The antigen screening library of claim 1, wherein the plurality of HLA-antigen complexes comprises an HLA polypeptide comprising an amino acid sequence at least 87.5%, 90%, 95%, 97%, 98%, 99%, or 100% identical to an amino acid sequence set forth in any one of SEQ ID NOs: 427 to 455.
6. The antigen screening library of any one of claims 1 to 5, wherein the plurality of the HLA-antigen polypeptide complexes comprises at least about 10.sup.5 different HLA-antigen polypeptide complexes comprising at least about 10.sup.5 different randomized antigen polypeptides.
7. The antigen screening library of any one of claims 1 to 6, wherein the HLA polypeptide, the randomized antigen polypeptide, and the β2-microglobulin polypeptide comprise a single polypeptide.
8. The antigen screening library of claim 7, wherein the single polypeptide further comprises a first flexible polypeptide linker and a second flexible polypeptide linker.
9. The antigen screening library of claim 8, wherein the randomized antigen polypeptide is N-terminal to the HLA polypeptide on the single polypeptide, and the HLA polypeptide is N-terminal to the β2-microglobulin polypeptide on the single polypeptide.
10. The antigen screening library of claim 9, wherein the first flexible polypeptide linker separates the HLA polypeptide from the randomized antigen polypeptide, and a second flexible polypeptide linker separates the HLA polypeptide from the β2-microglobulin polypeptide.
11. The antigen screening library of claim 8, wherein the randomized antigen polypeptide is C-terminal to the HLA polypeptide on the single polypeptide, and the HLA polypeptide is N-terminal to the β2-microglobulin polypeptide on the single polypeptide.
12. The antigen screening library of claim 11, wherein the first flexible polypeptide linker separates the HLA polypeptide from the randomized antigen polypeptide, and a second flexible polypeptide linker separates the HLA polypeptide from the β2-microglobulin polypeptide.
13. The antigen screening library of claim 8, wherein the randomized antigen polypeptide is N-terminal to the HLA polypeptide on the single polypeptide, and the HLA polypeptide is C-terminal to the β2-microglobulin polypeptide on the single polypeptide.
14. The antigen screening library of claim 13, wherein the first flexible polypeptide linker separates the randomized antigen polypeptide from the β2-microglobulin polypeptide, and a second flexible polypeptide linker separates the β2-microglobulin polypeptide from the HLA polypeptide.
15. The antigen screening library of claim 8, wherein the randomized antigen polypeptide is C-terminal to the HLA polypeptide on the single polypeptide, and the HLA polypeptide is C-terminal to the β2-microglobulin polypeptide on the single polypeptide.
16. The antigen screening library of claim 15, wherein the first flexible polypeptide linker separates the HLA polypeptide from the β2-microglobulin polypeptide, and a second flexible polypeptide linker separates the randomized antigen polypeptide from the HLA polypeptide.
17. The antigen screening library of claim 8, wherein the β2-microglobulin polypeptide is C-terminal to the HLA polypeptide on the single polypeptide, and the HLA polypeptide is N-terminal to the randomized antigen polypeptide on the single polypeptide.
18. The antigen screening library of claim 17, wherein the first flexible polypeptide linker separates the HLA polypeptide from the randomized antigen polypeptide, and a second flexible polypeptide linker separates the randomized antigen polypeptide from the β2-microglobulin polypeptide.
19. The antigen screening library of claim 8, wherein the randomized antigen polypeptide is C-terminal to the β2-microglobulin on the single polypeptide, and the HLA polypeptide is C-terminal to the randomized antigen polypeptide on the single polypeptide.
20. The antigen screening library of claim 19, wherein the first flexible polypeptide linker separates the β2-microglobulin polypeptide from the randomized antigen polypeptide, and a second flexible polypeptide linker separates the randomized antigen polypeptide from the HLA polypeptide.
21. The antigen screening library of any one of claims 1 to 20, wherein each of the HLA-antigen complexes of the plurality of the HLA-antigen complexes do not comprise an epitope tag.
22. The antigen screening library of any one of claims 1 to 20, wherein at least one of the HLA-antigen complexes of the plurality of HLA-antigen complexes comprise an epitope tag.
23. The antigen screening library of any one of claims 1 to 20, wherein at least one of the HLA-antigen complexes of the plurality of HLA-antigen complexes does not comprise an epitope tag and at least one of the HLA-antigen complexes of the plurality of HLA-antigen complexes does comprise an epitope tag.
24. The antigen screening library of claim 22 or 23, wherein the epitope tag comprises a FLAG tag, a c-Myc tag, a HIS-tag, a hemagglutinin (HA) tag, a VSVg tag, or a V5 tag.
25. The antigen screening library of any one of claims 1 to 24, wherein the HLA-antigen complexes each comprise a membrane tethering domain.
26. The antigen screening library of claim 25, wherein the membrane tethering domain comprises Aga2.
27. The antigen screening library of any one of claims 1 to 26, wherein the antigen screening library is expressed on a plurality of cells.
28. The antigen screening library of claim 27, wherein the plurality of cells are a plurality of yeast cells.
29. The antigen screening library of claim 28, wherein the plurality of yeast cells are a plurality of yeast cells of the EBY100 strain of Saccharomyces cerevisiae.
30. The antigen screening library of any one of claims 27 to 29, wherein each cell of the plurality of cells expresses a specific HLA-antigen complex.
31. An antigen screening library comprising a plurality of Human Leukocyte Antigen (HLA)-antigen polypeptide complexes, the HLA-antigen polypeptide complexes comprising: a) an HLA polypeptide, the HLA polypeptide comprising a peptide binding cleft; and b) a randomized antigen polypeptide comprising an amino acid sequence set forth in any one of SEQ ID NOs: 1 to 209, wherein the randomized antigen polypeptide specifically binds to the peptide binding cleft of the HLA polypeptide.
32. The antigen screening library of claim 31, wherein the plurality of HLA-antigen complexes comprises an HLA polypeptide selected from the list consisting of A3, A11, A23, A24, A26, A30, A31, A33, A68, B7, B8, B15, B27, B40, B44, B51, B53, B57, C1, C2, C3, C4, C5, C6, C7, C8, and E.
33. The antigen screening library of claim 31, wherein the plurality of HLA-antigen complexes comprises at least five, ten, fifteen, twenty, or twenty-five different HLA polypeptides selected from the list consisting of A3, A11, A23, A24, A26, A30, A31, A33, A68, B7, B8, B15, B27, B40, B44, B51, B53, C1, C2, C3, C4, C5, C6, C7, C8, and E.
34. The antigen screening library of claim 31, wherein the plurality of HLA-antigen complexes comprises all of A3, A11, A23, A24, A26, A30, A31, A33, A68, B7, B8, B15, B27, B40, B44, B51, B53, C1, C2, C3, C4, C5, C6, C7, C8, and E HLA polypeptides.
35. The antigen screening library of claim 31, wherein the plurality of HLA-antigen complexes comprises an HLA polypeptide comprising an amino acid sequence at least 87.5%, 90%, 95%, 97%, 98%, 99%, or 100% identical to an amino acid sequence set forth in any one of SEQ ID NOs: 427 to 455.
36. The antigen screening library of any one of claims 31 to 35, wherein the plurality of the HLA-antigen polypeptide complexes comprises at least about 10.sup.5 different HLA-antigen polypeptide complexes comprising at least about 10.sup.5 different randomized antigen polypeptides.
37. The antigen screening library of any one of claims 31 to 36, wherein the HLA polypeptide, and the randomized antigen polypeptide comprise a single polypeptide.
38. The antigen screening library of claim 37, wherein the single polypeptide further comprises a first flexible polypeptide linker separating the HLA polypeptide from the randomized antigen polypeptide.
39. The antigen screening library of claim 38, wherein the randomized antigen polypeptide is N-terminal to the HLA polypeptide on the single polypeptide.
40. The antigen screening library of claim 38, wherein the randomized antigen polypeptide is C-terminal to the HLA polypeptide on the single polypeptide.
41. The antigen screening library of any one of claims 31 to 40, wherein each of the HLA-antigen complexes of the plurality of the HLA-antigen complexes do not comprise an epitope tag.
42. The antigen screening library of any one of claims 31 to 40, wherein at least one of the HLA-antigen complexes of the plurality of HLA-antigen complexes comprise an epitope tag.
43. The antigen screening library of any one of claims 31 to 40, wherein at least one of the HLA-antigen complexes of the plurality of HLA-antigen complexes does not comprise an epitope tag and at least one of the HLA-antigen complexes of the plurality of HLA-antigen complexes does comprise an epitope tag.
44. The antigen screening library of claim 42 or 43, wherein the epitope tag comprises a FLAG tag, a c-Myc tag, a HIS-tag, a hemagglutinin (HA) tag, a VSVg tag, or a V5 tag.
45. The antigen screening library of any one of claims 31 to 44, wherein the HLA-antigen complexes each comprise a membrane tethering domain.
46. The antigen screening library of claim 45, wherein the membrane tethering domain comprises Aga2.
47. The antigen screening library of any one of claims 31 to 46, wherein the antigen screening library is expressed on a plurality of cells.
48. The antigen screening library of claim 47, wherein the plurality of cells are a plurality of yeast cells.
49. The antigen screening library of claim 48, wherein the plurality of yeast cells are a plurality of yeast cells of the EBY100 strain of Saccharomyces cerevisiae.
50. The antigen screening library of any one of claims 47 to 49, wherein each cell of the plurality of cells expresses a specific HLA-antigen complex.
51. The antigen screening library of any one of claims 47 to 50, wherein each cell of the plurality of cells expresses a β2-microglobulin polypeptide.
52. An antigen screening library comprising a) a plurality of antigen polypeptide-Beta-2 (β2) microglobulin polypeptide complexes, the antigen polypeptide-Beta-2 (β2) microglobulin polypeptide complexes comprising: i) a randomized antigen polypeptide comprising an amino acid sequence set forth in any one of SEQ ID NOs: 1 to 209, wherein the randomized antigen polypeptide specifically binds to the peptide binding cleft of the HLA polypeptide; and ii) a Beta-2 (β2) microglobulin polypeptide; and b) a plurality of HLA polypeptides constitutively expressed by one or more yeast cells and comprising a peptide binding cleft.
53. The antigen screening library of claim 52, wherein the plurality of HLA polypeptides is selected from the list consisting of A3, A11, A23, A24, A26, A30, A31, A33, A68, B7, B8, B15, B27, B40, B44, B51, B53, B57, C1, C2, C3, C4, C5, C6, C7, C8, and E.
54. The antigen screening library of claim 52, wherein the plurality of HLA polypeptides comprises at least five, ten, fifteen, twenty, or twenty-five different HLA polypeptides selected from the list consisting of A3, A11, A23, A24, A26, A30, A31, A33, A68, B7, B8, B15, B27, B40, B44, B51, B53, C1, C2, C3, C4, C5, C6, C7, C8, and E.
55. The antigen screening library of claim 52, wherein the plurality of HLA polypeptides comprises all of A3, A11, A23, A24, A26, A30, A31, A33, A68, B7, B8, B15, B27, B40, B44, B51, B53, C1, C2, C3, C4, C5, C6, C7, C8, and E HLA polypeptides.
56. The antigen screening library of claim 52, wherein the plurality of HLA polypeptides comprises an HLA polypeptide comprising an amino acid sequence at least 87.5%, 90%, 95%, 97%, 98%, 99%, or 100% identical to an amino acid sequence set forth in any one of SEQ ID NOs: 427 to 455.
57. The antigen screening library of any one of claims 52 to 56, wherein the plurality of the antigen polypeptide-Beta-2 (β2) microglobulin polypeptide complexes comprises at least about 10.sup.5 different antigen polypeptide-Beta-2 (β2) microglobulin polypeptide complexes comprising at least about 10.sup.5 different randomized antigen polypeptides.
58. The antigen screening library of any one of claims 52 to 57, wherein the randomized antigen polypeptide and the β2-microglobulin polypeptide comprise a single polypeptide.
59. The antigen screening library of claim 58, wherein the single polypeptide further comprises a first flexible polypeptide linker.
60. The antigen screening library of claim 59, wherein the randomized antigen polypeptide is N-terminal to the β2-microglobulin polypeptide on the single polypeptide.
61. The antigen screening library of claim 60, wherein the randomized antigen polypeptide is C-terminal to the β2-microglobulin polypeptide on the single polypeptide.
62. The antigen screening library of any one of claims 52 to 61, wherein each of the antigen polypeptide-Beta-2 (β2) microglobulin polypeptide complexes of the plurality of the antigen polypeptide-Beta-2 (β2) microglobulin polypeptide complexes do not comprise an epitope tag.
63. The antigen screening library of any one of claims 52 to 61, wherein at least one of the antigen polypeptide-Beta-2 (β2) microglobulin polypeptide complexes of the plurality of antigen polypeptide-Beta-2 (β2) microglobulin polypeptide complexes comprise an epitope tag.
64. The antigen screening library of any one of claims 52 to 61, wherein at least one of the HLA-antigen complexes of the plurality of HLA-antigen complexes does not comprise an epitope tag and at least one of the HLA-antigen complexes of the plurality of HLA-antigen complexes does comprise an epitope tag.
65. The antigen screening library of claim 63 or 64, wherein the epitope tag comprises a FLAG tag, a c-Myc tag, a HIS-tag, a hemagglutinin (HA) tag, a VSVg tag, or a V5 tag.
66. The antigen screening library of any one of claims 52 to 65, wherein the antigen polypeptide-Beta-2 (β2) microglobulin polypeptide complexes each comprise a membrane tethering domain.
67. The antigen screening library of claim 66, wherein the membrane tethering domain comprises Aga2.
68. The antigen screening library of any one of claims 52 to 67, wherein the antigen screening library is expressed on a plurality of cells.
69. The antigen screening library of claim 68, wherein the plurality of cells are a plurality of yeast cells.
70. The antigen screening library of claim 69, wherein the plurality of yeast cells are a plurality of yeast cells of the EBY100 strain of Saccharomyces cerevisiae.
71. The antigen screening library of any one of claims 68 to 70, wherein each cell of the plurality of cells expresses a specific antigen polypeptide-Beta-2 (β2) microglobulin polypeptide complex.
72. A plurality of nucleic acids encoding the antigen screening library of any one of claims 1 to 71.
73. The plurality of nucleic acids of claim 72, wherein the HLA polypeptide is encoded by a nucleic acid that is at least about 85%, 87.5%, 90%, 95%, 97%, 98%, or 99% homologous to any one of SEQ ID NOs: 456 to 484.
74. The plurality of nucleic acids of claim 73, wherein the randomized antigen polypeptide is encoded by a nucleic acid set forth in any one of SEQ ID NOs: 210 to 426.
75. The plurality of nucleic acids of any one of claims 72 to 74, wherein the plurality of nucleic acids is expressed by a plurality of cells.
76. A plurality of cells expressing the antigen screening library of any one of claims 1 to 75.
77. The plurality of cells of claim 76, wherein the plurality of cells is a plurality of yeast cells.
78. The plurality of cells of claim 77, wherein the plurality of yeast cells is a plurality of cells of the EBY100 strain of Saccharomyces cerevisiae.
79. The plurality of cells of any one of claims 76 to 78, wherein each cell of the plurality of cells comprises a nucleic acid of the plurality of nucleic acids encoding a specific of HLA-antigen complex.
80. A method of selecting an antigen comprising contacting the plurality of cells of any one of claims 76 to 79 with a T cell receptor (TCR) or other macromolecule having one or more antigen binding domains.
81. The method of claim 80, wherein the TCR or other macromolecule having one or more antigen binding domains is immobilized on a substrate.
82. The method of claim 80, wherein the TCR or other macromolecule having one or more antigen binding domains is expressed by a cell.
83. The method of any one of claims 76 to 79, wherein the selection is repeated for 2, 3, 4, or 5 cycles.
84. The method of claim 83, wherein the antigen is a polypeptide antigen.
85. The method of claim 84, wherein the antigen is a polypeptide antigen that does not naturally occur.
86. The method of claim 85, wherein the antigen is a polypeptide antigen that does not naturally occur in a human.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0041]
[0042]
[0043]
[0044]
[0045]
DETAILED DESCRIPTION
[0046] Described herein are antigen screening libraries useful for selection and/or identification of polypeptide ligands for T cell receptors (TCRs). In many cases, the antigen screening libraries are useful to discover polypeptide antigens that are capable of interacting with and stimulating human T cells as TCR ligands, including both endogenous TCR antigens and non-endogenous TCR antigens which may be novel TCR antigens and/or novel epitopes. Such novel antigens and/or novel epitopes are useful, at least for example, to stimulate one or more TCRs on T cells that may have become exhausted or anergized, and revive immune responses against cancer, tumors, or chronic viral infections. Accordingly, the present disclosure includes peptide library display, such as randomized peptide antigen libraries, in the context of a given HLA to determine the specificities and general recognition properties of TCRs restricted to HLA-mediated peptide recognition.
[0047] Once expressed using the methodologies described herein, a randomized peptide antigen library may be displayed by HLA molecules that are expressed on the surface of cells. In general, the cells that display these HLA-antigen polypeptide complexes are not normal antigen presenting cells of a host's immune system but rather are cells that can easily be transformed, transfected, transduced, and/or electroporated with a nucleic acid encoding an HLA-antigen polypeptide, including without limitation, insect cells, yeast cells, and bacterial cells. In some embodiments, the randomized peptide antigen library is expressed by yeast cells. A mixture of plasmids that encode at least 10.sup.4, 10.sup.5, 10.sup.6, 10.sup.7, 10.sup.8, 10.sup.9, 10.sup.10, 10.sup.11, 10.sup.12, 10.sup.13, 10.sup.14, or 10.sup.15 distinct polypeptide antigens, and either one or a plurality of different HLA molecules, are transformed into yeast cells. Following transformation with the randomized peptide antigen library, the yeast cells that express the HLA-antigen polypeptide complex library are then contacted by a TCR, or other macromolecule having one or more antigen binding domains, serving as a bait. The TCRs are either (1) expressed by a cell or (2) recombinantly produced and, optionally, multimerized and/or immobilized, on a solid structure, such as a bead, or via a protein scaffold such as streptavidin or streptavidin conjugated dextran (referenced as the selection reagent). The cells expressing HLA-antigen polypeptide complexes that interact with the TCR selection reagent can be selected by an appropriate modality, and after 2, 3, 4, 5, 6, 7 or more rounds of enrichment (e.g., cycles) the nucleic acids encoding the HLA-antigen polypeptide complexes can be extracted from the enriched cells and sequencing can be performed to determine the polypeptide antigens that have been enriched. The enriched polypeptide antigens define the structural attributes that interact with a given TCR.
[0048] In some embodiments, the present disclosure includes an antigen screening library which comprises a plurality of HLA-antigen polypeptide complexes. In some embodiments, the HLA-antigen polypeptide complexes comprise (a) an HLA polypeptide, the HLA polypeptide comprising a peptide binding cleft; (b) a randomized antigen polypeptide comprising an amino acid sequence set forth in any one of SEQ ID NOs: 1 to 194, wherein the randomized antigen polypeptide is selected to specifically bind to the peptide binding cleft of the HLA polypeptide; and (c) a beta-2 (β2) microglobulin polypeptide. Also provided herein are derivatives of randomized peptide antigens and libraries thereof, compositions thereof, pharmaceutical compositions thereof, and uses of the same. Also provided herein are nucleic acid sequences encoding one or more randomized peptide antigen libraries disclosed herein and derivatives thereof, and methods for expressing the one or more randomized peptide antigen libraries, peptides thereof, and derivatives thereof in one or more cells.
[0049] As set forth in the examples provided herein, a randomized peptide antigen library was designed (Example 1) and includes nucleic acid constructs (
[0050] The following description of the invention is merely intended to illustrate various embodiments of the present disclosure. As such, the specific modifications discussed are not to be construed as limitations on the scope of the present disclosure. It will be apparent to one skilled in the art that various equivalents, changes, and modifications may be made without departing from the scope of the present disclosure, and it is understood that such equivalent embodiments are to be included herein.
[0051] All references listed herein are incorporated by reference, in their entirety. Methods and apparatuses are provided here by way of example and are not intended to be limiting to the present disclosure.
Certain Definitions
[0052] In the following description, some specific details are set forth in order to provide a thorough understanding of various embodiments. However, one skilled in the art will understand that the embodiments provided may be practiced without these details. Unless the context requires otherwise, throughout the specification and claims which follow, the word “comprise” and variations thereof, such as, “comprises” and “comprising” are to be construed in an open, inclusive sense, that is, as “including, but not limited to.” As used in this specification and the appended claims, the singular forms “a,” “an,” and “the” include plural referents unless the content clearly dictates otherwise. It should also be noted that the term “or” is generally employed in its sense including “and/or” unless the content clearly dictates otherwise. Further, headings provided herein are for convenience only and do not interpret the scope or meaning of the claimed embodiments.
[0053] The terms “peptide,” “polypeptide,” and “protein” are used interchangeably to refer to a polymer of amino acid residues, and are not limited to a minimum length, though a number of amino acid residues may be specified (e.g., 9mer is nine amino acid residues). Polypeptides may include amino acid residues including natural and/or non-natural amino acid residues. The terms also include post-expression modifications of the polypeptide, for example, glycosylation, sialylation, acetylation, phosphorylation, and the like. In some embodiments, the polypeptides may contain modifications with respect to a native or natural sequence, as long as the protein maintains the desired activity. These modifications may be deliberate, as through site-directed mutagenesis, or may be accidental, such as through mutations of hosts which produce the proteins or errors due to PCR amplification.
[0054] The term “acidic residue” refers to amino acid residues in D- or L-form having sidechains comprising acidic groups. Exemplary acidic residues include D and E.
[0055] The term “amide residue” refers to amino acids in D- or L-form having sidechains comprising amide derivatives of acidic groups. Exemplary residues include N and Q.
[0056] The term “aromatic residue” refers to amino acid residues in D- or L-form having sidechains comprising aromatic groups. Exemplary aromatic residues include F, Y, and W.
[0057] The term “basic residue” refers to amino acid residues in D- or L-form having sidechains comprising basic groups. Exemplary basic residues include H, K, and R.
[0058] The term “hydrophilic residue” refers to amino acid residues in D- or L-form having sidechains comprising polar groups. Exemplary hydrophilic residues include C, S, T, N, and Q.
[0059] The term “nonfunctional residue” refers to amino acid residues in D- or L-form having sidechains that lack acidic, basic, or aromatic groups. Exemplary nonfunctional amino acid residues include M, G, A, V, I, L and norleucine (Nle).
[0060] The term “neutral hydrophobic residue” refers to amino acid residues in D- or L-form having sidechains that lack basic, acidic, or polar groups. Exemplary neutral hydrophobic amino acid residues include A, V, L, I, P, W, M, and F.
[0061] The term “polar hydrophobic residue” refers to amino acid residues in D- or L-form having sidechains comprising polar groups. Exemplary polar hydrophobic amino acid residues include T, G, S, Y, C, Q, and N.
[0062] The term “hydrophobic residue” refers to amino acid residues in D- or L-form having sidechains that lack basic or acidic groups. Exemplary hydrophobic amino acid residues include A, V, L, I, P, W, M, F, T, G, S, Y, C, Q, and N.
[0063] “Percent (%) sequence identity” with respect to a reference polypeptide sequence is the percentage of amino acid residues in a candidate sequence that is identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are known, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software, or other software appropriate for nucleic acid sequences. Appropriate parameters for aligning sequences are able to be determined, including algorithms needed to achieve maximal alignment over the full length of the sequences being compared. For purposes herein, however, % amino acid sequence identity values are generated using the sequence comparison computer program ALIGN-2. The ALIGN-2 sequence comparison computer program was authored by Genentech, Inc., and the source code has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U.S. Copyright Registration No. TXU510087. The ALIGN-2 program is publicly available from Genentech, Inc., South San Francisco, Calif., or may be compiled from the source code. The ALIGN-2 program should be compiled for use on a UNIX operating system, including digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.
[0064] In situations where ALIGN-2 is employed for amino acid sequence comparisons, the % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B (which can alternatively be phrased as a given amino acid sequence A that has or comprises a some % amino acid sequence identity to, with, or against a given amino acid sequence B) is calculated as follows: 100 times the fraction X/Y, where X is the number of amino acid residues scored as identical matches by the sequence alignment program ALIGN-2 in that program's alignment of A and B, and where Y is the total number of amino acid residues in B. It will be appreciated that where the length of amino acid sequence A is not equal to the length of amino acid sequence B, the % amino acid sequence identity of A to B will not equal the % amino acid sequence identity of B to A. Unless specifically stated otherwise, all % amino acid sequence identity values used herein are obtained as described in the immediately preceding paragraph using the ALIGN-2 computer program.
[0065] As used herein, the terms “homologous,” “homology,” or “percent homology” when used herein to describe to a nucleic acid sequence, relative to a reference sequence, can be determined using the formula described by Karlin & Altschul 1990, modified as in Karlin & Altschul 1993. Such a formula is incorporated into the basic local alignment search tool (BLAST) programs of Altschul 1990. Percent homology of sequences can be determined using the most recent version of BLAST, as of the filing date of this application.
[0066] “T cell receptor” (TCR), refers to an antigen/MHC binding heterodimeric protein product of a vertebrate, e.g. mammalian, TCR gene complex, including the human TCR α, β, γ and δ chains. For example, the complete sequence of the human (3 TCR locus has been sequenced, as published by Rowen 1996; the human TCR locus has been sequenced and resequenced, for example see Mackelprang 2006; see a general analysis of the T-cell receptor variable gene segment families in Arden 1995; each of which is herein specifically incorporated by reference for the sequence information provided and referenced in the publication.
[0067] “Bait” refers to a TCR or “other macromolecule having one or more antigen binding domains” that binds to an antigen of the present technology. The other macromolecule having one or more antigen binding domains is an antibody, a DARPin, or a synthetic molecule, including aptamers. The antigen binding domain binds a peptide, such as one or more of the HLA-peptide complexes of the present technology, or a nucleic acid, such as DNA and RNA.
[0068] “Exogenous” with respect to a nucleic acid or polynucleotide indicates that the nucleic acid is part of a recombinant nucleic acid construct or is not in its natural environment. For example, an exogenous nucleic acid can be a sequence from one species introduced into another species, i.e., a heterologous nucleic acid. Typically, such an exogenous nucleic acid is introduced into the other species via a recombinant nucleic acid construct. An exogenous nucleic acid also can be a sequence that is native to an organism and that has been reintroduced into cells of that organism. An exogenous nucleic acid that includes a native sequence can often be distinguished from the naturally occurring sequence by the presence of non-natural sequences linked to the exogenous nucleic acid, e.g., nonnative regulatory sequences flanking a native sequence in a recombinant nucleic acid construct. In addition, stably transformed exogenous nucleic acids typically are integrated at positions other than the position where the native sequence is found. The exogenous elements may be added to a construct, for example, using genetic recombination. Genetic recombination is the breaking and rejoining of DNA strands to form new molecules of DNA encoding a novel set of genetic information.
[0069] As used herein the term “about” refers to an amount that is near the stated amount by 10%.
Structural Characteristics of the HLA-Antigen Polypeptide Complexes
[0070] Disclosed herein are antigen screening libraries, such as randomized peptide antigen libraries, which include a plurality of HLA-antigen polypeptide complexes. The HLA-antigen polypeptide complexes of the current disclosure minimally comprise at least three constituents: (a) a randomized antigen polypeptide, (b) a major histocompatibility class I (MHC I) HLA molecule, and (c) a β2-microglobulin. In some embodiments, the randomized antigen polypeptide of (a) is randomized having at least one or more residues conserved that serve as anchor residues to bind to an HLA molecule of a specific type. Exemplary, but not limiting, randomized antigen polypeptide antigens and the HLA type with which they associate are shown in Table 1 and given by SEQ ID NOs: 1 to 194 and Table 2 and given by SEQ ID NOs: 195 to 209. In some embodiments, the randomized polypeptide antigens comprises a sequence that is at least about 70%, 75%, 80%, 85%, 87%, 87.5%, 90%, 95%, 97%, 97.5%, 98%, 98.5%, 99%, 99.5%, or 100% identical to any one of, but not limited to, the amino acid sequences set forth in any one of SEQ ID NOs: 1 to 194 and SEQ ID NOs: 195 to 209. In some embodiments, the randomized polypeptide antigens comprise a sequence identical to any one of those set forth in any one of SEQ ID NOs: 1 to 194 and SEQ ID NOs: 195 to 209. Also envisioned within the present disclosure are randomized polypeptide antigen truncations that have 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 25 amino acids truncated from the N-terminus or truncated from the C-terminus of any one of SEQ ID NOs: 1 to 194 and SEQ ID NOs: 195 to 209. In some embodiments, the HLA molecule of (b) is a HLA polypeptide and comprises a peptide binding cleft. Once expressed, in some embodiments, the randomized antigen polypeptide of (a) binds the HLA polypeptide of (b) at the peptide binding cleft.
TABLE-US-00001 TABLE 1 Polypeptide Antigen Sequences Sorted By HLA Type HLA type SEQ ID NO: Sequence HLA A3 1 X(V/L/M)XXXXXK 2 X(V/L/M)XXXXXXK 3 X(V/L/M)XXXXXXXK 4 X(V/L/M)XXXXXXXXK 5 X(V/L/M)XXXXXXXXXK HLA A11 6 X(V/L/F)XXXXX(K/R) 7 X(V/L/F)XXXXXX(K/R) 8 X(V/L/F)XXXXXXX(K/R) 9 X(V/L/F)XXXXXXXX(K/R) 10 X(V/L/F)XXXXXXXXX(K/R) HLA A23 11 XXXXXXXY 12 XXXXXXXXY 13 XXXXXXXXXY 14 XXXXXXXXXXY 15 XXXXXXXXXXXY HLA A24 16 X(F/Y)XXXXX(I/L/F) 17 X(F/Y)XXXXXX(I/L/F) 18 X(F/Y)XXXXXXX(I/L/F) 19 X(F/Y)XXXXXXXX(I/L/F) 20 X(F/Y)XXXXXXXXX(I/L/F) HLA A26 21 X(V/L/F)XXXXX(F/Y) 22 X(I/T)XXXXX(F/Y) 23 X(V/L/F)XXXXXX(F/Y) 24 X(I/T)XXXXXX(F/Y) 25 X(V/L/F)XXXXXXX(F/Y) 26 X(I/T)XXXXXXX(F/Y) 27 X(V/L/F)XXXXXXXX(F/Y) 28 X(I/T)XXXXXXXX(F/Y) 29 X(V/L/F)XXXXXXXXX(F/Y) 30 X(I/T)XXXXXXXXX(F/Y) HLA A30 31 X(F/Y)XXXXX(L) 32 X(F/Y)XXXXXX(L) 33 X(F/Y)XXXXXXX(L) 34 X(F/Y)XXXXXXXX(L) 35 X(F/Y)XXXXXXXXX(L) HLA A31 36 XXXXXXX(K/R) 37 XXXXXXXX(K/R) 38 XXXXXXXXX(K/R) 39 XXXXXXXXXX(K/R) 40 XXXXXXXXXXX(K/R) HLA A33 41 XXXXXXX(K/R) 42 XXXXXXXX(K/R) 43 XXXXXXXXX(K/R) 44 XXXXXXXXXX(K/R) 45 XXXXXXXXXXX(K/R) HLA A68 46 X(V)XXXXX(K/R) 47 X(V)XXXXXX(K/R) 48 X(V)XXXXXXX(K/R) 49 X(V)XXXXXXXX(K/R) 50 X(V)XXXXXXXXX(K/R) 51 X(T)XXXXX(K/R) 52 X(T)XXXXXX(K/R) 53 X(T)XXXXXXX(K/R) 54 X(T)XXXXXXXX(K/R) 55 X(T)XXXXXXXXX(K/R) HLA B7 56 XPXXXXXL 57 XPXXXXXXL 58 XPXXXXXXXL 59 XPXXXXXXXXL 60 XPXXXXXXXXXL HLA B8 61 XX(K)X(K/R)XX(L) 62 XX(K)X(K/R)XXX(L) 63 XX(K)X(K/R)XXXX(L) 64 XX(K)X(K/R)XXXXX(L) 65 XX(K)X(K/R)XXXXXX(L) HLA B15 66 X(Q/L)XXXXX(F/Y) 67 X(Q/L)XXXXXX(F/Y) 68 X(Q/L)XXXXXXX(F/Y) 69 X(Q/L)XXXXXXXX(F/Y) 70 X(Q/L)XXXXXXXXX(F/Y) HLA B27 71 X(R)XXXXX(F/Y) 72 X(R)XXXXXX(F/Y) 73 X(R)XXXXXXX(F/Y) 74 X(R)XXXXXXXX(F/Y) 75 X(R)XXXXXXXXX(F/Y) HLA B35 76 X(P)XXXXX(F/Y) 77 X(P)XXXXXX(F/Y) 78 X(P)XXXXXXX(F/Y) 79 X(P)XXXXXXXX(F/Y) 80 X(P)XXXXXXXXX(F/Y) 81 X(P)XXXXX(M/L/I) 82 X(P)XXXXXX(M/L/I) 83 X(P)XXXXXXX(M/L/I) 84 X(P)XXXXXXXX(M/L/I) 85 X(P)XXXXXXXXX(M/L/I) HLA B40 86 X(E)XXXXX(L) 87 X(E)XXXXXX(L) 88 X(E)XXXXXXX(L) 89 X(E)XXXXXXXX(L) 90 X(E)XXXXXXXXX(L) HLA B51 91 X(A/G)XXXXX(V/I) 92 X(A/G)XXXXXX(V/I) 93 X(A/G)XXXXXXX(V/I) 94 X(A/G)XXXXXXXX(V/I) 95 X(A/G)XXXXXXXXX(V/I) 96 X(P)XXXXX(V/I) 97 X(P)XXXXXX(V/I) 98 X(P)XXXXXXX(V/I) 99 X(P)XXXXXXXX(V/I) 100 X(P)XXXXXXXXX(V/I) HLA B44 101 X(E)XXXXX(F/Y) 102 X(E)XXXXXX(F/Y) 103 X(E)XXXXXXX(F/Y) 104 X(E)XXXXXXXX(F/Y) 105 X(E)XXXXXXXXX(F/Y) HLA B53 106 X(P)XXXXX(W) 107 X(P)XXXXXX(W) 108 X(P)XXXXXXX(W) 109 X(P)XXXXXXXX(W) 110 X(P)XXXXXXXXX(W) 111 X(P)XXXXX(F/L) 112 X(P)XXXXXX(F/L) 113 X(P)XXXXXXX(F/L) 114 X(P)XXXXXXXX(F/L) 115 X(P)XXXXXXXXX(F/L) HLA B57 116 X(A/T/S)XXXXX(F/Y) 117 X(A/T/S)XXXXXX(F/Y) 118 X(A/T/S)XXXXXXX(F/Y) 119 X(A/T/S)XXXXXXXX(F/Y) 120 X(A/T/S)XXXXXXXXX(F/Y) 121 X(A/T/S)XXXXX(W) 122 X(A/T/S)XXXXXX(W) 123 X(A/T/S)XXXXXXX(W) 124 X(A/T/S)XXXXXXXX(W) 125 X(A/T/S)XXXXXXXXX(W) HLA C1 126 X(L)XXXXX(L) 127 X(L)XXXXXX(L) 128 X(L)XXXXXXX(L) 129 X(L)XXXXXXXX(L) 130 X(L)XXXXXXXXX(L) 131 X(A)XXXXXXX(L) 132 X(A)XXXXXX(L) 133 X(A)XXXXXXX(L) 134 X(A)XXXXXXXX(L) 135 X(A)XXXXXXXXX(L) HLA C2 136 X(A)XXXXX(L/V) 137 X(A)XXXXXX(L/V) 138 X(A)XXXXXXX(LN) 139 X(A)XXXXXXXX(L/V) 140 X(A)XXXXXXXXX(L/V) 141 X(A)XXXXX(F/Y) 142 X(A)XXXXXX(F/Y) 143 X(A)XXXXXXX(F/Y) 144 X(A)XXXXXXXX(F/Y) 145 X(A)XXXXXXXXX(F/Y) HLA C3 146 XXXXXXX(L/F/M/I) 147 XXXXXXXX(L/F/M/I) 148 XXXXXXXXX(L/F/M/I) 149 XXXXXXXXXX(L/F/M/I) 150 XXXXXXXXXXX(L/F/M/I) HLA C4 151 X(Y/F)XXXXX(L/F/M/I) 152 X(Y/F)XXXXXX(L/F/M/I) 153 X(Y/F)XXXXXXX(L/F/M/I) 154 X(Y/F)XXXXXXXX(L/F/M/I) 155 X(Y/F)XXXXXXXXX(L/F/M/I) 156 X(P)XXXXX(L/F/M/I) 157 X(P)XXXXXX(L/F/M/I) 158 X(P)XXXXXXX(L/F/M/I) 159 X(P)XXXXXXXX(L/F/M/I) 160 X(P)XXXXXXXXX(L/F/M/I) HLA C5 161 XX(D)XXXX(L/V) 162 XX(D)XXXXX(L/V) 163 XX(D)XXXXXX(LN) 164 XX(D)XXXXXXX(L/V) 165 XX(D)XXXXXXXX(L/V) HLA C6 166 XXXXXXX(L/V/I) 167 XXXXXXXX(L/V/I) 168 XXXXXXXXX(L/V/I) 169 XXXXXXXXXX(L/V/I) 170 XXXXXXXXXXX(L/V/I) 171 XXXXXXX(Y) 172 XXXXXXXX(Y) 173 XXXXXXXXX(Y) 174 XXXXXXXXXX(Y) 175 XXXXXXXXXXX(Y) HLA C7 176 XXXXXXX(F/L) 177 XXXXXXXX(F/L) 178 XXXXXXXXX(F/L) 179 XXXXXXXXXX(F/L) 180 XXXXXXXXXXX(F/L) 181 XXXXXXX(Y) 182 XXXXXXXX(Y) 183 XXXXXXXXX(Y) 184 XXXXXXXXXX(Y) 185 XXXXXXXXXXX(Y) HLA C8 186 XX(D)XXX(L) 187 XX(D)XXXX(L) 188 XX(D)XXXXX(L) 189 XX(D)XXXXXX(L) 190 XX(D)XXXXXXX(L) HLA E 191 X(L/M)XXXXX(L/V) 192 X(L/M)XXXXXX(LN) 193 X(L/M)XXXXXXX(LN) 194 X(L/M)XXXXXXXX(L/V)
TABLE-US-00002 TABLE 2 Additional Polypeptide Antigen Sequences for HLA A11 SEQ ID NO: Sequence 195 X(I/L/V)XXXXX(K/R) 196 X(I/L/V)XXXXXX(K/R) 197 X(I/L/V)XXXXXXX(K/R) 198 X(I/L/V)XXXXXXXX(K/R) 199 X(I/L/V)XXXXXXXXX(K/R) 200 X(Y/F)XXXXX(K/R) 201 X(Y/F)XXXXXX(K/R) 202 X(Y/F)XXXXXXX(K/R) 203 X(Y/F)XXXXXXXX(K/R) 204 X(Y/F)XXXXXXXXX(K/R) 205 X(N/Y)XXXXX(K/R) 206 X(N/Y)XXXXXX(K/R) 207 X(N/Y)XXXXXXX(K/R) 208 X(N/Y)XXXXXXXX(K/R) 209 X(N/Y)XXXXXXXXX(K/R)
[0071] In some embodiments, antigen screening libraries of the present disclosure include (b) randomized antigen polypeptides encoded at least by, but not limited to, nucleotide sequences SEQ ID NOs: 210 to 411 provided at least in Table 4. In some embodiments, antigen screening libraries of the present disclosure include (b) randomized antigen polypeptides encoded at least by, but not limited to, nucleotide sequences SEQ ID NOs: 412 to 426 provided at least in Table 5. Nucleic acids that encode the randomized antigen polypeptides of (b) are encoded by a degenerate base sequence, effectively allowing any amino acid to be encoded at a given position corresponding to the degenerate base sequence. Each randomized antigen polypeptide has at least one conserved anchor position that is encoded by a restricted degenerate code, or a specific sequence, which allows the randomized antigen polypeptide to more efficiently interact with a certain HLA type. Having at least one conserved anchor position per randomized antigen polypeptide increases efficiency of formation of a randomized antigen polypeptide and HLA complex compared to formation of an HLA complex with a fully randomized antigen polypeptide. In some embodiments, 1, 2, or 3 of the amino acid residues of a randomized antigen polypeptide are constant. In some embodiments, the randomized antigen polypeptide antigens comprises a sequence that is at least about 70%, 75%, 80%, 85%, 87%, 87.5%, 90%, 95%, 97%, 97.5%, 98%, 98.5%, 99%, 99.5%, or 100% identical to any one of, but not limited to, the amino acid sequences set forth in any one of SEQ ID NOs: 210 to 411 and SEQ ID NOs: 412 to 426. In some embodiments, the randomized antigen polypeptide antigens comprise a sequence identical to any one of those set forth in any one of SEQ ID NOs: 210 to 411 and SEQ ID NOs: 412 to 426. Also envisioned within the present disclosure are randomized antigen polypeptide antigen polypeptide truncations that have 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 25 amino acids truncated from the N-terminus or truncated from the C-terminus of any one of SEQ ID NOs: 210 to 411 and SEQ ID NOs: 412 to 426.
[0072] In some embodiments, amino acid residues of a randomized antigen polypeptide vary by 2, 3, or 4 different amino acids. For example, referring to Table 1, the second and the last position of a randomized antigen polypeptide that binds to HLA-A2 will comprise leucine or methionine; and leucine, methionine, or valine, respectively.
[0073] The amino acid sequences in Tables 1 and 2 above include random amino acid residues (‘X’) and explicitly defined amino acids located at residues referred to collectively as anchor positions. The anchor positions specified in the library design can be altered, for example, based on amino acid substitutions set forth in Table 3. One of ordinary skill in the art would appreciate that possible substitutions for X residue in the amino acid sequences of Tables 1 and 2 are not limited and can include additional substitutions without departing from the scope of the disclosure. For example, amino acid substitutions can be used to identify important residues of the peptide sequence that contribute to binding of the HLA or to constrain of expand the members of the library described herein.
[0074] Conservative modifications will produce peptides having functional and chemical characteristics similar to those of the peptide from which such modifications are made. In contrast, substantial modifications in the functional and/or chemical characteristics of the peptides may be accomplished by selecting substitutions in the amino acid sequence that differ significantly in their effect on maintaining (a) the structure of the molecular backbone in the area of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the size of the molecule.
[0075] For example, a “conservative amino acid substitution” may involve a substitution of a native amino acid residue with a nonnative residue such that there is little or no effect on the polarity or charge of the amino acid residue at that position. Furthermore, any native residue in the polypeptide may also be substituted with alanine, as has been previously described for “alanine scanning mutagenesis” (see, for example, MacLennan 1998 and Sasaki & Sutoh 1998, which discuss alanine scanning mutagenesis).
[0076] Desired amino acid substitutions (whether conservative or non-conservative) can be determined by those skilled in the art at the time such substitutions are desired. Exemplary amino acid substitutions are set forth in Table 3.
TABLE-US-00003 TABLE 3 Amino Acid Substitutions Original Residues Exemplary Substitutions Ala (A) Val, Leu, Ile Arg (R) Lys, Gln, Asn Asn (N) Gln Asp (D) Glu Cys (C) Ser, Ala Gln (Q) Asn Glu (E) Asp Gly (G) Pro, Ala His (H) Asn, Gln, Lys, Arg Ile (I) Leu, Val, Met, Ala, Phe, Norleucine (Nle) Leu (L) Norleucine (Nle), Ile, Val, Met, Ala, Phe Lys (K) Arg, 1,4 Diaminobutyric Acid (Dab), Gln, Asn Met (M) Leu, Phe, Ile Phe (F) Leu, Val, Ile, Ala, Tyr Pro (P) Ala Ser (S) Thr, Ala, Cys Thr (T) Ser Trp (W) Tyr, Phe Tyr (Y) Trp, Phe, Thr, Ser Val (V) Ile, Met, Leu, Phe, Ala, Norleucine (Nle)
[0077] In certain embodiments, conservative amino acid substitutions also encompass non-naturally occurring amino acid residues which are typically incorporated by chemical peptide synthesis rather than by synthesis in biological systems.
[0078] As noted in the foregoing section “Certain Definitions,” naturally occurring residues may be divided into classes based on common sidechain properties that may be useful for modifications of sequence. For example, non-conservative substitutions may involve the exchange of a member of one of these classes for a member from another class. Such substituted residues may be introduced into regions of the peptide that are homologous with non-human orthologs, or into the non-homologous regions of the molecule. In addition, one may also make modifications using P or G for the purpose of influencing chain orientation.
[0079] In making such modifications, the hydropathic index of amino acids may be considered. Each amino acid has been assigned a hydropathic index on the basis of their hydrophobicity and charge characteristics; these are: isoleucine (+4.5); valine (+4.2); leucine (+3.8); phenylalanine (+2.8); cysteine/cystine (+2.5); methionine (+1.9); alanine (+1.8); glycine (−0.4); threonine (−0.7); serine (−0.8); tryptophan (−0.9); tyrosine (−1.3); proline (−1.6); histidine (−3.2); glutamate (−3.5); glutamine (−3.5); aspartate (−3.5); asparagine (−3.5); lysine (−3.9); and arginine (−4.5).
[0080] The importance of the hydropathic amino acid index in conferring interactive biological function on a protein is understood in the art (Kyte & Doolittle 1982). It is known that certain amino acids may be substituted for other amino acids having a similar hydropathic index or score and still retain a similar biological activity. In making changes based upon the hydropathic index, the substitution of amino acids whose hydropathic indices are within ±2 is preferred, those which are within ±1 are particularly preferred, and those within ±0.5 are even more particularly preferred.
[0081] It is also understood in the art that the substitution of like amino acids can be made effectively on the basis of hydrophilicity. The greatest local average hydrophilicity of a protein, as governed by the hydrophilicity of its adjacent amino acids, correlates with its immunogenicity and antigenicity, i.e. with a biological property of the protein.
[0082] The following hydrophilicity values have been assigned to amino acid residues: arginine (+3.0); lysine (+3.0); aspartate (+3.0±1); glutamate (+3.0±1); serine (+0.3); asparagine (+0.2); glutamine (+0.2); glycine (0); threonine (−0.4); proline (−0.5±1); alanine (−0.5); histidine (−0.5); cysteine (−1.0); methionine (−1.3); valine (−1.5); leucine (−1.8); isoleucine (−1.8); tyrosine (−2.3); phenylalanine (−2.5); tryptophan (−3.4). In making changes based upon similar hydrophilicity values, the substitution of amino acids whose hydrophilicity values are within ±2 is preferred, those which are within ±1 are particularly preferred, and those within ±0.5 are even more particularly preferred. One may also identify epitopes from primary amino acid sequences on the basis of hydrophilicity. These regions are also referred to as “epitopic core regions.”
[0083] A skilled artisan will be able to determine suitable variants of the polypeptide as set forth in the foregoing sequences using well known techniques. For identifying suitable areas of the molecule that may be changed without destroying activity, one skilled in the art may target areas not believed to be important for activity. For example, when similar polypeptides with similar activities from the same species or from other species are known, one skilled in the art may compare the amino acid sequence of a peptide to similar peptides. With such a comparison, one can identify residues and portions of the molecules that are conserved among similar polypeptides. It will be appreciated that changes in areas of a peptide that are not conserved relative to such similar peptides would be less likely to adversely affect the biological activity and/or structure of the peptide. One skilled in the art would also know that, even in relatively conserved regions, one may substitute chemically similar amino acids for the naturally occurring residues while retaining activity (conservative amino acid residue substitutions). Therefore, even areas that may be important for biological activity or for structure may be subject to conservative amino acid substitutions without destroying the biological activity or without adversely affecting the peptide structure.
[0084] Additionally, one skilled in the art can review structure-function studies identifying residues in similar peptides that are important for activity or structure. In view of such a comparison, one can predict the importance of amino acid residues in a peptide that correspond to amino acid residues that are important for activity or structure in similar peptides. One skilled in the art may opt for chemically similar amino acid substitutions for such predicted important amino acid residues of the peptides.
[0085] One skilled in the art can also analyze the three-dimensional structure and amino acid sequence in relation to that structure in similar polypeptides. In view of that information, one skilled in the art may predict the alignment of amino acid residues of a peptide with respect to its three dimensional structure. One skilled in the art may choose not to make radical changes to amino acid residues predicted to be on the surface of the protein, since such residues may be involved in important interactions with other molecules. Moreover, one skilled in the art may generate test variants containing a single amino acid substitution at each desired amino acid residue. The variants can then be screened using activity assays known to those skilled in the art. Such data could be used to gather information about suitable variants. For example, if one discovered that a change to a particular amino acid residue resulted in destroyed, undesirably reduced, or unsuitable activity, variants with such a change would be avoided. In other words, based on information gathered from such routine experiments, one skilled in the art can readily determine the amino acids where further substitutions should be avoided, either alone or in combination with other mutations.
[0086] A number of scientific publications have been devoted to the prediction of secondary structure (see, e.g., Moult 1996; Chou & Fasman 1974a; Chou & Fasman 1974b; Chou & Fasman 1978a; Chou & Fasman 1978b; and Chou & Fasman 1979). Moreover, computer programs are currently available to assist with predicting secondary structure. One method of predicting secondary structure is based upon homology modeling. For example, two polypeptides or proteins which have a sequence identity of greater than 30%, or similarity greater than 40% often have similar structural topologies. The recent growth of the protein structural data base (PDB) has provided enhanced predictability of secondary structure, including the potential number of folds within a polypeptide's or protein's structure (Holm & Sander 1999). It has been suggested that there are a limited number of folds in a given polypeptide or protein and that once a critical number of structures have been resolved, structural prediction will gain dramatically in accuracy (Brenner 1997).
[0087] Additional methods of predicting secondary structure include “threading” (Jones 1997; Sippl & Flockner 1996), “profile analysis” (Bowie 1991; Gribskov 1987; Gribskov 1990), and “evolutionary linkage” (Holm & Sander 1999; Brenner 1997).
TABLE-US-00004 TABLE 4 Nucleic Acid Sequences Encoding Randomized Polypeptide Antigens HLA SEQ type ID NO: Sequence HLA A2 210 nnkmtgnnknnknnknnknnkntg 211 nnkmtgnnknnknnknnknnknnkntg 212 nnkmtgnnknnknnknnknnknnknnkntg 213 nnkmtgnnknnknnknnknnknnknnknnkntg HLA A1 214 nnknnkgaknnknnknnknnknnktat 215 nnknnkgaknnknnknnknnknnknnktat 216 nnknnkgaknnknnknnknnknnknnknnktat HLA A3 217 nnkvtgnnknnknnknnknnkaaa 218 nnkvtgnnknnknnknnknnknnkaaa 219 nnkvtgnnknnknnknnknnknnknnkaaa 220 nnkvtgnnknnknnknnknnknnknnknnkaaa 221 nnkvtgnnknnknnknnknnknnknnknnknnkaaa HLA A11 222 nnkbttnnknnknnknnknnkara 223 nnkbttnnknnknnknnknnknnkara 224 nnkbttnnknnknnknnknnknnknnkara 225 nnkbttnnknnknnknnknnknnknnknnkara 226 nnkbttnnknnknnknnknnknnknnknnknnkara HLA A23 227 nnknnknnknnknnknnknnktay 228 nnknnknnknnknnknnknnknnktay 229 nnknnknnknnknnknnknnknnknnktay 230 nnknnknnknnknnknnknnknnknnknnktay 231 nnknnknnknnknnknnknnknnknnknnknnktay HLA A24 232 nnktwtnnknnknnknnknnkhtt 233 nnktwtnnknnknnknnknnknnkhtt 234 nnktwtnnknnknnknnknnknnknnkhtt 235 nnktwtnnknnknnknnknnknnknnknnkhtt 236 nnktwtnnknnknnknnknnknnknnknnknnkhtt HLA A26 237 nnkbthnnknnknnknnknnktwy 238 nnkayynnknnknnknnknnktwy 239 nnkbthnnknnknnknnknnknnktwy 240 nnkayynnknnknnknnknnknnktwy 241 nnkbthnnknnknnknnknnknnknnktwy 242 nnkayynnknnknnknnknnknnknnktwy 243 nnkbthnnknnknnknnknnknnknnknnktwy 244 nnkayynnknnknnknnknnknnknnknnktwy 245 nnkbthnnknnknnknnknnknnknnknnknnktwy 246 nnkayynnknnknnknnknnknnknnknnknnktwy HLA A30 247 nnktwynnknnknnknnknnkctn 248 nnktwynnknnknnknnknnknnkctn 249 nnktwynnknnknnknnknnknnknnkctn 250 nnktwynnknnknnknnknnknnknnknnkctn 251 nnktwynnknnknnknnknnknnknnknnknnkctn HLA A31 252 nnknnknnknnknnknnknnkarr 253 nnknnknnknnknnknnknnknnkarr 254 nnknnknnknnknnknnknnknnknnkarr 255 nnknnknnknnknnknnknnknnknnknnkarr 256 nnknnknnknnknnknnknnknnknnknnknnkarr HLA A33 257 nnknnknnknnknnknnknnkarr 258 nnknnknnknnknnknnknnknnkarr 259 nnknnknnknnknnknnknnknnknnkarr 260 nnknnknnknnknnknnknnknnknnknnkarr 261 nnknnknnknnknnknnknnknnknnknnknnkarr HLA A68 262 nnkgttnnknnknnknnknnkarr 263 nnkgttnnknnknnknnknnknnkarr 264 nnkgttnnknnknnknnknnknnknnkarr 265 nnkgttnnknnknnknnknnknnknnknnkarr 266 nnkgttnnknnknnknnknnknnknnknnknnkarr 267 nnkactnnknnknnknnknnkarr 268 nnkactnnknnknnknnknnknnkarr 269 nnkactnnknnknnknnknnknnknnkarr 270 nnkactnnknnknnknnknnknnknnknnkarr 271 nnkactnnknnknnknnknnknnknnknnknnkarr HLA B7 272 nnkcctnnknnknnknnknnkctt 273 nnkcctnnknnknnknnknnknnkctt 274 nnkcctnnknnknnknnknnknnknnkctt 275 nnkcctnnknnknnknnknnknnknnknnkctt 276 nnkcctnnknnknnknnknnknnknnknnknnkctt HLA B8 277 nnknnkaaannkarannknnkctt 278 nnknnkaaannkarannknnknnkctt 279 nnknnkaaannkarannknnknnknnkctt 280 nnknnkaaannkarannknnknnknnknnkctt 281 nnknnkaaannkarannknnknnknnknnknnkctt HLA B15 282 nnkcwannknnknnknnknnktwt 283 nnkcwannknnknnknnknnknnktwt 284 nnkcwannknnknnknnknnknnknnktwt 285 nnkcwannknnknnknnknnknnknnknnktwt 286 nnkcwannknnknnknnknnknnknnknnknnktwt HLA B27 287 nnkagannknnknnknnknnktwt 288 nnkagannknnknnknnknnknnktwt 289 nnkagannknnknnknnknnknnknnktwt 290 nnkagannknnknnknnknnknnknnknnktwt 291 nnkagannknnknnknnknnknnknnknnknnktwt HLA B35 292 nnkcctnnknnknnknnknnktwt 293 nnkcctnnknnknnknnknnknnktwt 294 nnkcctnnknnknnknnknnknnknnktwt 295 nnkcctnnknnknnknnknnknnknnknnktwt 296 nnkcctnnknnknnknnknnknnknnknnknnktwt 297 nnkcctnnknnknnknnknnkmtr 298 nnkcctnnknnknnknnknnknnkmtr 299 nnkcctnnknnknnknnknnknnknnkmtr 300 nnkcctnnknnknnknnknnknnknnknnkmtr 301 nnkcctnnknnknnknnknnknnknnknnknnkmtr HLA B40 302 nnkgaannknnknnknnknnkctt 303 nnkgaannknnknnknnknnknnkctt 304 nnkgaannknnknnknnknnknnknnkctt 305 nnkgaannknnknnknnknnknnknnknnkctt 306 nnkgaannknnknnknnknnknnknnknnknnkctt HLA B51 307 nnkgstnnknnknnknnknnkrtt 308 nnkgstnnknnknnknnknnknnkrtt 309 nnkgstnnknnknnknnknnknnknnkrtt 310 nnkgstnnknnknnknnknnknnknnknnkrtt 311 nnkgstnnknnknnknnknnknnknnknnknnkrtt 312 nnkcctnnknnknnknnknnkrtt 313 nnkcctnnknnknnknnknnknnkrtt 314 nnkcctnnknnknnknnknnknnknnkrtt 315 nnkcctnnknnknnknnknnknnknnknnkrtt 316 nnkcctnnknnknnknnknnknnknnknnknnkrtt HLA B44 317 nnkgaannknnknnknnknnktwt 318 nnkgaannknnknnknnknnknnktwt 319 nnkgaannknnknnknnknnknnknnktwt 320 nnkgaannknnknnknnknnknnknnknnktwt 321 nnkgaannknnknnknnknnknnknnknnknnktwt HLA B53 322 nnkcctnnknnknnknnknnktgg 323 nnkcctnnknnknnknnknnknnktgg 324 nnkcctnnknnknnknnknnknnknnktgg 325 nnkcctnnknnknnknnknnknnknnknnktgg 326 nnkcctnnknnknnknnknnknnknnknnknnktgg 327 nnkcctnnknnknnknnknnkytt 328 nnkcctnnknnknnknnknnknnkytt 329 nnkcctnnknnknnknnknnknnknnkytt 330 nnkcctnnknnknnknnknnknnknnknnkytt 331 nnkcctnnknnknnknnknnknnknnknnknnkytt HLA B57 332 nnkdctnnknnknnknnknnktwt 333 nnkdctnnknnknnknnknnknnktwt 334 nnkdctnnknnknnknnknnknnknnktwt 335 nnkdctnnknnknnknnknnknnknnknnktwt 336 nnkdctnnknnknnknnknnknnknnknnknnktwt 337 nnkdctnnknnknnknnknnktgg 338 nnkdctnnknnknnknnknnknnktgg 339 nnkdctnnknnknnknnknnknnknnktgg 340 nnkdctnnknnknnknnknnknnknnknnktgg 341 nnkdctnnknnknnknnknnknnknnknnknnktgg HLA C1 342 nnkttannknnknnknnknnktta 343 nnkttannknnknnknnknnknnktta 344 nnkttannknnknnknnknnknnknnktta 345 nnkttannknnknnknnknnknnknnknnktta 346 nnkttannknnknnknnknnknnknnknnknnktta 347 nnkgctnnknnknnknnknnktta 348 nnkgctnnknnknnknnknnknnktta 349 nnkgctnnknnknnknnknnknnknnktta 350 nnkgctnnknnknnknnknnknnknnknnktta 351 nnkgctnnknnknnknnknnknnknnknnknnktta HLA C2 352 nnkgctnnknnknnknnknnkstc 353 nnkgctnnknnknnknnknnknnkstc 354 nnkgctnnknnknnknnknnknnknnkstc 355 nnkgctnnknnknnknnknnknnknnknnkstc 356 nnkgctnnknnknnknnknnknnknnknnknnkstc 357 nnkgctnnknnknnknnknnktwt 358 nnkgctnnknnknnknnknnknnktwt 359 nnkgctnnknnknnknnknnknnknnktwt 360 nnkgctnnknnknnknnknnknnknnknnktwt 361 nnkgctnnknnknnknnknnknnknnknnknnktwt HLA C3 362 nnknnknnknnknnknnknnkhtk 363 nnknnknnknnknnknnknnknnkhtk 364 nnknnknnknnknnknnknnknnknnkhtk 365 nnknnknnknnknnknnknnknnknnknnkhtk 366 nnknnknnknnknnknnknnknnknnknnknnkhtk HLA C4 367 nnktwtnnknnknnknnknnkhtk 368 nnktwtnnknnknnknnknnknnkhtk 369 nnktwtnnknnknnknnknnknnknnkhtk 370 nnktwtnnknnknnknnknnknnknnknnkhtk 371 nnktwtnnknnknnknnknnknnknnknnknnkhtk 372 nnkcctnnknnknnknnknnkhtk 373 nnkcctnnknnknnknnknnknnkhtk 374 nnkcctnnknnknnknnknnknnknnkhtk 375 nnkcctnnknnknnknnknnknnknnknnkhtk 376 nnkcctnnknnknnknnknnknnknnknnknnkhtk HLA C5 377 nnknnkgatnnknnknnknnkstt 378 nnknnkgatnnknnknnknnknnkstt 379 nnknnknnkgatnnknnknnknnknnkstt 380 nnknnknnknnkgatnnknnknnknnknnkstt 381 nnknnknnknnkgatnnknnknnknnknnknnkstt HLA C6 382 nnknnknnknnknnknnknnkvtt 383 nnknnknnknnknnknnknnknnkvtt 384 nnknnknnknnknnknnknnknnknnkvtt 385 nnknnknnknnknnknnknnknnknnknnkvtt 386 nnknnknnknnknnknnknnknnknnknnknnkvtt 387 nnknnknnknnknnknnknnktat 388 nnknnknnknnknnknnknnknnktat 389 nnknnknnknnknnknnknnknnknnktat 390 nnknnknnknnknnknnknnknnknnknnktat 391 nnknnknnknnknnknnknnknnknnknnknnktat HLA C7 392 nnknnknnknnknnknnknnkytt 393 nnknnknnknnknnknnknnknnkytt 394 nnknnknnknnknnknnknnknnknnkytt 395 nnknnknnknnknnknnknnknnknnknnkytt 396 nnknnknnknnknnknnknnknnknnknnknnkytt 397 nnknnknnknnknnknnknnktat 398 nnknnknnknnknnknnknnknnktat 399 nnknnknnknnknnknnknnknnknnktat 400 nnknnknnknnknnknnknnknnknnknnktat 401 nnknnknnknnknnknnknnknnknnknnknnktat HLA C8 402 nnknnkgatnnknnknnkctt 403 nnknnkgatnnknnknnknnkctt 404 nnknnkgatnnknnknnknnknnkctt 405 nnknnkgatnnknnknnknnknnknnkat 406 nnknnkgatnnknnknnknnknnknnknnkat HLA E 407 nnkmtgnnknnknnknnknnkstt 408 nnkmtgnnknnknnknnknnknnkstt 409 nnkmtgnnknnknnknnknnknnknnkstt 410 nnkmtgnnknnknnknnknnknnknnknnkstt 411 nnkmtgnnknnknnknnknnknnknnknnknnkstt
TABLE-US-00005 TABLE 5 Additional Nucleic Acid Sequences Encoding Randomized Polypeptide Antigens for HLA A11 SEQ ID NO: Sequence 412 nnkvttnnknnknnknnknnkara 413 nnkvttnnknnknnknnknnknnkara 414 nnkvttnnknnknnknnknnknnknnkara 415 nnkvttnnknnknnknnknnknnknnknnkara 416 nnkvttnnknnknnknnknnknnknnknnknnkara 417 nnktwtnnknnknnknnknnknnkara 418 nnktwtnnknnknnknnknnkara 419 nnktwtnnknnknnknnknnknnknnkara 420 nnktwtnnknnknnknnknnknnknnknnkara 421 nnktwtnnknnknnknnknnknnknnknnknnkara 422 nnkwatnnknnknnknnknnkara 423 nnkwatnnknnknnknnknnknnkara 424 nnkwatnnknnknnknnknnknnknnkara 425 nnkwatnnknnknnknnknnknnknnknnkara 426 nnkwatnnknnknnknnknnknnknnknnknnkara
[0088] One advantage of a randomized antigen polypeptide is that a single nucleic acid with a degenerate base code can potentially express a large amount of different randomized antigen polypeptides, which increases the chances that any one screening experiment will identify one or more randomized antigen polypeptides that interact with a certain TCR. In some embodiments, the nucleic acid that encodes the randomized antigen polypeptide can encode at least 1×10.sup.4, at least 1×10.sup.5, at least 1×10.sup.6, at least 1×10.sup.7, at least 1×10.sup.8, at least 1×10.sup.9, at least 1×10.sup.10, at least 1×10.sup.11, at least 1×10.sup.12, at least 1×10.sup.13, at least 1×10.sup.14, or at least 1×10.sup.15 different randomized polypeptide antigens.
[0089] Peptide antigens that bind in the binding cleft of an HLA molecule are generally of a restricted length range. The majority of polypeptides that bind to class I HLA molecules are 8, 9, 10, or 11 amino acids in length. In some embodiments, the randomized antigen polypeptide which binds to an HLA molecule and forming the HLA-antigen polypeptide complexes of the present disclosure is between 8 and 11 amino acids in length. In some embodiments, the randomized antigen polypeptide is between 8 and 10 amino acids in length. In some embodiments, the randomized antigen polypeptide is 8 amino acids in length. In some embodiments, the randomized antigen polypeptide is 9 amino acids in length. In some embodiments, the randomized antigen polypeptide is 10 amino acids in length. In some embodiments, the randomized antigen polypeptide is 11 amino acids in length.
[0090] Another constituent of the HLA-antigen polypeptide complexes described herein is an HLA molecule, such as an HLA polypeptide. For the purposes of the current disclosure, the HLA molecule is a class I major histocompatibility molecule. In some embodiments, the plurality of HLA polypeptides of the HLA-antigen polypeptide complexes of the current disclosure (HLA-antigen complexes) can comprise any of the following loci and alleles: A3, A11, A23, A24, A26, A30, A31, A33, A68, B7, B8, B15, B27, B40, B44, B51, B53, C1, C2, C3, C4, C5, C6, C7, C8, and E. In some embodiments, each of the HLA-antigen complexes in the plurality of HLA-antigen complexes comprise an HLA polypeptide selected from the group of HLA polypeptides consisting of A3, A11, A23, A24, A26, A30, A31, A33, A68, B7, B8, B15, B27, B40, B44, B51, B53, C1, C2, C3, C4, C5, C6, C7, C8, and E. In some embodiments, the plurality of HLA-antigen complexes comprises at least five, ten, fifteen, twenty, or twenty-five different HLA polypeptides selected from the group of HLA polypeptides consisting of A3, A11, A23, A24, A26, A30, A31, A33, A68, B7, B8, B15, B27, B40, B44, B51, B53, C1, C2, C3, C4, C5, C6, C7, C8, and E. In some embodiments, the plurality of HLA-antigen complexes comprises all of the HLA polypeptides in the group of HLA polypeptides consisting of A3, A11, A23, A24, A26, A30, A31, A33, A68, B7, B8, B15, B27, B40, B44, B51, B53, C1, C2, C3, C4, C5, C6, C7, C8, and E.
[0091] In some embodiments, the amino acid sequence of the HLA polypeptide of the HLA-antigen polypeptide complex can comprise any of the amino acid sequences set forth in Table 6. In some embodiments, the HLA polypeptide comprises an amino acid sequence that is at least about 70%, 75%, 80%, 85%, 87%, 87.5%, 90%, 95%, 97%, 97.5%, 98%, 98.5%, 99%, 99.5%, or 100% identical to any one of, but not limited to, the amino acid sequences set forth in any one of SEQ ID NOs: 427 to 455. In some embodiments, the HLA polypeptide comprises an amino acid sequence identical to any one of those set forth in any one of SEQ ID NOs: 427 to 455. In some embodiments, a portion of the HLA polypeptide that comprises the peptide binding cleft is identical to any one of SEQ ID Nos: 251 to 279, and the non-peptide binding cleft residues are at least about 70%, 75%, 80%, 85%, 87.5%, 90%, 95%, 97%, 98%, 99%, or 100% identical to any one of SEQ ID NOs: 427 to 455. Also envisioned within the present disclosure are HLA polypeptide truncations that have 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 25 amino acids truncated from the N-terminus or truncated from the C-terminus of any one of SEQ ID NOs: 427 to 455.
TABLE-US-00006 TABLE 6 HLA Allele Amino Acid Sequences SEQ ID NO: Amino Acid Sequence 427 GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAH SQTDRANLGTLRGAYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAA QITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYP AEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSS 428 GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQ SQTDRVDLGTLRGAYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAA QITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYP AEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSS 429 GSHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQ SQTDRVDLGTLRGAYNQSEDGSHTIQEVIYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA AQITKRKWEAAHAAEQQRAYLEGRCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGEY PAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSS 430 GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVREDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAH SQTDRENLRIALRAYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAA QITQRKWEAARVAEQLRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYP AEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSS 431 GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVREDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAH SQTDRENLRIALRAYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAA QITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGEYP AEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSS 432 GSHSMRYFSTSVSRPGSGEPRFIAVGYVDDTQFVREDSDAASQRMEPRAPWIEQERPEYWDQETRNVKAQ SQTDRVDLGTLRGAYNQSEAGSHTIQIMYGCDVGSDGRFLRGYEQHAYDGKDYIALNEDLRSWTAADMAA QITQRKWEAARWAEQLRAYLEGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGEYP AEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSS 433 GSHSMRYFTTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQERPEYWDQETRNVKAH SQIDRVDLGTLRGAYNQSEAGSHTIQMMYGCDVGSDGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAA QITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDPPKTHMTHHAVSDHEATLRCWALSFYP AEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRYTCHVQHEGLPKPLTLRWEPSS 434 GSHSMRYFTTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAH SQIDRVDLGTLRGAYNQSEAGSHTIQMMYGCDVGSDGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAA QITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDPPKTHMTHHAVSDHEATLRCWALSFYP AEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRYTCHVQHEGLPKPLTLRWEPSS 435 GSHSMRYFYTSMSRPGRGEPRFIAVGYVDDTQFVREDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAQ SQTDRVDLGTLRGAYNQSEAGSHTIQRMYGCDVGPDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAA QTTKHKWEAAHVAEQWRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYP AEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRWEPSS 436 GSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVREDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQ AQTDRESLRNLRGAYNQSEAGSHTLQSMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAA QITQRKWEAAREAEQRRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHEATLRCWALGEYP AEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSS 437 GSHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVREDSDAASPREEPRAPWIEQEGPEYWDRNTQIFKTN TQTDRESLRNLRGAYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAA QITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYP AEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSS 438 GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDRETQISKTN TQTYRESLRNLRGAYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAA QITQRKWEAAREAEQWRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGEYP AEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSS 439 GSHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTN TQTYRESLRNLRGAYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAA QISQRKLEAARVAEQLRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHEATLRCWALGFYP AEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSS 440 GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTN TQTYRESLRNLRGAYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAA QITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYP AEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSS 441 GSHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTN TQTYRENLRTALRAYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAA QITQRKWEAARVAEQDRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHEVTLRCWALGEYP AEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSS 442 GSHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTN TQTYRENLRTALRAYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAA QITQRKWEAARVAEQLRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHEVTLRCWALGEYP AEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSS 443 GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTN TQTYRENLRIALRAYNQSEAGSHTWQTMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAA QITQRKWEAAREAEQLRAYLEGLCVEWLRRHLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYP AEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSS 444 GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTN TQTYRENLRIALRAYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAA QITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYP AEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSS 445 GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDGETRNMKAS AQTYRENLRIALRAYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAA QITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYP AEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSS 446 CSHSMKYFFTSVSRPGRGEPRFISVGYVDDTQFVREDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQ AQTDRVSLRNLRGAYNQSEAGSHTLQWMCGCDLGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTAA QITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHEATLRCWALGEYP AEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVMVPSGEEQRYTCHVQHEGLPEPLTLRWEPSS 447 CSHSMRYFYTAVSRPSRGEPHFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQ AQTDRVNLRKLRGAYNQSEAGSHTLQRMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAA QITQRKWEAAREAEQWRAYLEGECVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHEATLRCWALGFYP TEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSS 448 GSHSMRYFYTAVSRPGRGEPHFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQ AQTDRVSLRNLRGAYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTAA QITQRKWEAAREAEQLRAYLEGLCVEWLRRYLKNGKETLQRAEHPKTHVTHHPVSDHEATLRCWALGEYP AEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSS 449 GSHSMRYFSTSVSWPGRGEPRFIAVGYVDDTQFVREDSDAASPRGEPREPWVEQEGPEYWDRETQKYKRQ AQADRVNLRKLRGAYNQSEDGSHTLQRMEGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTAA QITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHEATLRCWALGEYP AEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWKPSS 450 CSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVQFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQ AQTDRVNLRKLRGAYNQSEAGSHTLQRMYGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADKAA QITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKKTLQRAEHPKTHVTHHPVSDHEATLRCWALGEYP AEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWGPSS 451 CSHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVREDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQ AQADRVNLRKLRGAYNQSEDGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAA QITQRKWEAAREAEQWRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHEATLRCWALGFYP AEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSS 452 CSHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVREDSDAASPRGEPRAPWVEQEGPEYWDRETQNYKRQ AQADRVSLRNLRGAYNQSEDGSHTLQRMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAA QITQRKLEAARAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGEYP AEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSWEPSS 453 CSHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVREDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQ AQADRVSLRNLRGAYNQSEDGSHTLQRMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAA QITQRKLEAARAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGEYP AEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSWEPSS 454 CSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVREDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQ AQTDRVSLRNLRGAYNQSEAGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAA QITQRKWEAARAAEQQRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHLVSDHEATLRCWALGEYP AEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSS 455 GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDT AQIFRVNLRTLRGAYNQSEAGSHTLQWMHGCELGPDGRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAA QISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGEYP AEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPAS
[0092] The HLA polypeptide of the HLA-antigen polypeptide complex can be encoded by a nucleic acid of any set forth in Table 7. In some embodiments, the HLA polypeptide is encoded by a nucleic acid sequence that is at least about 90%, 95%, 97%, 98%, 99%, or 100% homologous to at least, but not limited to, any one of the nucleic acid sequences listed in Table 7, such as SEQ ID NOs: 456 to 484. In some embodiments, the HLA polypeptide is encoded by a nucleic acid sequence identical to that set forth in any one of SEQ ID NOs: 456 to 484.
TABLE-US-00007 TABLE 7 HLA Allele Nucleic Acid Sequences SEQ ID NO: DNA sequence 456 ggctcccactccatgaggtatttcttcacatccgtgtcccggcccggccgcggggagccccgc ttcatcgccgtgggctacgtggacgacacgcagttcgtgcggttcgacagcgacgccgcgagc cagaagatggagccgcgggcgccgtggatagagcaggaggggccggagtattgggaccaggag acacggaatatgaaggcccactcacagactgaccgagcgaacctggggaccdgcgcggcgcct acaaccagagcgaggacggttctcacaccatccagataatgtatggctgcgacgtggggccgg acgggcgcttcctccgcgggtaccggcaggacgcctacgacggcaaggattacatcgccctga acgaggacctgcgctcttggaccgcggcggacatggcagctcagatcaccaagcgcaagtggg aggcggtccatgcggcggagcagcggagagtctacctggagggccggtgcgtggacgggctcc gcagatacctggagaacgggaaggagacactgcagcgcacggacccccccaagacacatatga cccaccaccccatctctgaccatgaggccaccctgaggtgctgggccctgggcttctaccctg cggagatcacactgacctggcagcgggatggggaggaccagacccaggacacggagctcgtgg agaccaggcctgcaggggatggaaccttccagaagtgggcggctgtggtggtgccttctggag aggagcagagatacacctgccatgtgcagcatgagggtctgcccaagcccctcaccctgagat gggagctgtcttcc 457 ggctcccactccatgaggtatttcttcacatccgtgtcccggcccggccgcggggagccccgc ttcatcgccgtgggctacgtggacgacacgcagttcgtgcggttcgacagcgacgccgcgagc cagaggatggagccgcgggcgccgtggatagagcaggaggggccggagtattgggaccaggag acacggaatgtgaaggcccagtcacagactgaccgagtggacctggggaccctgcgcggcgcc tacaaccagagcgaggccggttctcacaccatccagataatgtatggctgcgacgtggggtcg gacgggcgcttcctccgcgggtaccggcaggacgcctacgacggcaaggattacatcgccctg aacgaggacctgcgctcttggaccgcggcggacatggcggctcagatcaccaagcgcaagtgg gaggcggcccatgaggcggagcagttgagagcctacctggatggcacgtgcgtggagtggctc cgcagatacctggagaacgggaaggagacactgcagcgcacggacccccccaagacacatatg acccaccaccccatctctgaccatgaggccaccctgaggtgctgggccctgggcttctaccct gcggagatcacactgacctggcagcgggatggggaggaccagacccaggacacggagctcgtg gagaccaggcctgcaggggatggaaccttccagaagtgggcggctgtggtggtgccttctgga gaggagcagagatacacctgccatgtgcagcatgagggtctgcccaagcccctcaccctgaga tgggagctgtcttcc 458 ggctcccactccatgaggtatttctacacctccgtgtcccggcccggccgcggggagccccgc ttcatcgccgtgggctacgtggacgacacgcagttcgtgcggttcgacagcgacgccgcgagc cagaggatggagccgcgggcgccgtggatagagcaggaggggccggagtattgggaccaggag acacggaatgtgaaggcccagtcacagactgaccgagtggacctggggaccctgcgcggcgcc tacaaccagagcgaggacggttctcacaccatccagataatgtatggctgcgacgtggggccg gacgggcgcttcctccgcgggtaccggcaggacgcctacgacggcaaggattacatcgccctg aacgaggacctgcgctcttggaccgcggcggacatggcagctcagatcaccaagcgcaagtgg gaggcggcccatgcggcggagcagcagagagcctacctggagggccggtgcgtggagtggctc cgcagatacctggagaacgggaaggagacactgcagcgcacggacccccccaagacacatatg acccaccaccccatctctgaccatgaggccaccctgaggtgctgggccctgggcttctaccct gcggagatcacactgacctggcagcgggatggggaggaccagacccaggacacggagctcgtg gagaccaggcctgcaggggatggaaccttccagaagtgggcggctgtggtggtgccttctgga gaggagcagagatacacctgccatgtgcagcatgagggtctgcccaagcccctcaccctgaga tgggagctgtcttcc 459 ggctcccactccatgaggtatttctccacatccgtgtcccggcccggccgcggggagccccgc ttcatcgccgtgggctacgtggacgacacgcagttcgtgcggttcgacagcgacgccgcgagc cagaggatggagccgcgggcgccgtggatagagcaggaggggccggagtattgggacgaggag acagggaaagtgaaggcccactcacagactgaccgagagaacctgcggatcgcgctccgcgcc tacaaccagagcgaggccggttctcacaccctccagatgatgtttggctgcgacgtggggtcg gacgggcgcttcctccgcgggtaccaccagtacgcctacgacggcaaggattacatcgccctg aaagaggacctgcgctcttggaccgcggcggacatggcggctcagatcacccagcgcaagtgg gaggcggcccgtgtggcggagcagttgagagcctacctggagggcacgtgcgtggacgggctc cgcagatacctggagaacgggaaggagacactgcagcgcacggacccccccaagacacatatg acccaccaccccatctctgaccatgaggccactctgagatgctgggccctgggcttctaccct gcggagatcacactgacctggcagcgggatggggaggaccagacccaggacacggagcttgtg gagaccaggcctgcaggggatggaaccttccagaagtgggcagctgtggtggtaccttctgga gaggagcagagatacacctgccatgtgcagcatgagggtctgcccaagcccctcaccctgaga tgggagccatcttcc 460 ggctcccactccatgaggtatttctccacatccgtgtcccggcccggccgcggggagccccgc ttcatcgccgtgggctacgtggacgacacgcagttcgtgcggttcgacagcgacgccgcgagc cagaggatggagccgcgggcgccgtggatagagcaggaggggccggagtattgggacgaggag acagggaaagtgaaggcccactcacagactgaccgagagaacctgcggatcgcgctccgcgcc tacaaccagagcgaggccggttctcacaccctccagatgatgtttggctgcgacgtggggtcg gacgggcgcttcctccgcgggtaccaccagtacgcctacgacggcaaggattacatcgccctg aaagaggacctgcgctcttggaccgcggcggacatggcggctcagatcaccaagcgcaagtgg gaggcggcccatgtggcggagcagcagagagcctacctggagggcacgtgcgtggacgggctc cgcagatacctggagaacgggaaggagacactgcagcgcacggacccccccaagacacatatg acccaccaccccatctctgaccatgaggccactctgagatgctgggccctgggcttctaccct gcggagatcacactgacctggcagcgggatggggaggaccagacccaggacacggagcttgtg gagaccaggcctgcaggggatggaaccttccagaagtgggcagctgtggtggtaccttctgga gaggagcagagatacacctgccatgtgcagcatgagggtctgcccaagcccctcaccctgaga tgggagccatcttcc 461 ggctcccactccatgaggtatttctccacatccgtgtcccggcccggcagtggagagccccgc ttcatcgcagtgggctacgtggacgacacgcagttcgtgcggttcgacagcgacgccgcgagc cagaggatggagccgcgggcgccgtggatagagcaggagaggcctgagtattgggaccaggag acacggaatgtgaaggcccagtcacagactgaccgagtggacctggggaccctgcgcggcgcc tacaaccagagcgaggccggttctcacaccatccagataatgtatggctgcgacgtggggtcg gacgggcgcttcctccgcgggtatgaacagcacgcctacgacggcaaggattacatcgccctg aacgaggacctgcgctcttggaccgcggcggacatggcggctcagatcacccagcgcaagtgg gaggcggcccgttgggcggagcagttgagagcctacctggagggcacgtgcgtggagtggctc cgcagatacctggagaacgggaaggagacactgcagcgcacggacccccccaagacacatatg acccaccaccccatctctgaccatgaggccaccctgaggtgctgggccctgggcttctaccct gcggagatcacactgacctggcagcgggatggggaggaccagacccaggacacggagctcgtg gagaccaggcctgcaggggatggaaccttccagaagtgggcggctgtggtggtgccttctgga gaggagcagagatacacctgccatgtgcagcatgagggtctgcccaagcccctcaccctgaga tgggagctgtcttcc 462 ggctcccactccatgaggtatttcaccacatccgtgtcccggcccggccgcggggagccccgc ttcatcgccgtgggctacgtggacgacacgcagttcgtgcggttcgacagcgacgccgcgagc cagaggatggagccgcgggcgccgtggatagagcaggagaggcctgagtattgggaccaggag acacggaatgtgaaggcccactcacagattgaccgagtggacctggggaccctgcgcggcgcc tacaaccagagcgaggccggttctcacaccatccagatgatgtatggctgcgacgtggggtcg gacgggcgcttcctccgcgggtaccagcaggacgcctacgacggcaaggattacatcgccttg aacgaggacctgcgctcttggaccgcggcggacatggcggctcagatcacccagcgcaagtgg gaggcggcccgtgtggcggagcagttgagagcctacctggagggcacgtgcgtggagtggctc cgcagatacctggagaacgggaaggagacactgcagcgcacggacccccccaagacgcatatg actcaccacgctgtctctgaccatgaggccaccctgaggtgctgggccctgagcttctaccct gcggagatcacactgacctggcagcgggatggggaggaccagacccaggacacggagctcgtg gagaccaggcctgcaggggatggaaccttccagaagtgggcgtctgtggtggtgccttctgga caggagcagagatacacctgccatgtgcagcatgagggtctccccaagcccctcaccctgaga tgggagccgtcttcc 463 ggctcccactccatgaggtatttcaccacatccgtgtcccggcccggccgcggggagccccgc ttcatcgccgtgggctacgtggacgacacgcagttcgtgcggttcgacagcgacgccgcgagc cagaggatggagccgcgggcgccgtggatagagcaggaggggccggagtattgggaccggaac acacggaatgtgaaggcccactcacagattgaccgagtggacctggggaccctgcgcggcgcc tacaaccagagcgaggccggttctcacaccatccagatgatgtatggctgcgacgtggggtcg gacgggcgcttcctccgcgggtaccagcaggacgcctacgacggcaaggattacatcgccttg aacgaggacctgcgctcttggaccgcggcggacatggcggctcagatcacccagcgcaagtgg gaggcggcccgtgtggcggagcagttgagagcctacctggagggcacgtgcgtggagtggctc cgcagatacctggagaacgggaaggagacactgcagcgcacggacccccccaagacgcatatg actcaccacgctgtctctgaccatgaggccaccctgaggtgctgggccctgagcttctaccct gcggagatcacactgacctggcagcgggatggggaggaccagacccaggacacggagctcgtg gagaccaggcctgcaggggatggaaccttccagaagtgggcgtctgtggtggtgccttctgga caggagcagagatacacctgccatgtgcagcatgagggtctccccaagcccctcaccctgaga tgggagccgtcttcc 464 ggctcccactccatgaggtatttctacacctccatgtcccggcccggccgcggggagccccgc ttcatcgccgtgggctacgtggacgacacgcagttcgtgcggttcgacagcgacgccgcgagc cagaggatggagccgcgggcgccgtggatagagcaggaggggccggagtattgggaccggaac acacggaatgtgaaggcccagtcacagactgaccgagtggacctggggaccctgcgcggcgcc tacaaccagagcgaggccggttctcacaccatccagaggatgtatggctgcgacgtggggccg gacgggcgcttcctccgcgggtaccaccagtacgcctacgacggcaaggattacatcgccctg aaagaggacctgcgctcttggaccgcggcggacatggcagctcagaccaccaagcacaagtgg gaggcggcccatgtggcggagcagtggagagcctacctggagggcacgtgcgtggagtggctc cgcagatacctggagaacgggaaggagacactgcagcgcacggacgcccccaaaacgcatatg actcaccacgctgtctctgaccatgaagccaccctgaggtgctgggccctgagcttctaccct gcggagatcacactgacctggcagcgggatggggaggaccagacccaggacacggagctcgtg gagaccaggcctgcaggggatggaaccttccagaagtgggtggctgtggtggtgccttctgga caggagcagagatacacctgccatgtgcagcatgagggtttgcccaagcccctcaccctgaga tgggagccgtcttcc 465 ggctcccactccatgaggtatttctacacctccgtgtcccggcccggccgcggggagccccgc ttcatctcagtgggctacgtggacgacacccagttcgtgaggttcgacagcgacgccgcgagt ccgagagaggagccgcgggcgccgtggatagagcaggaggggccggagtattgggaccggaac acacagatctacaaggcccaggcacagactgaccgagagagcctgcggaacctgcgcggcgcc tacaaccagagcgaggccgggtctcacaccctccagagcatgtacggctgcgacgtggggccg gacgggcgcctcctccgcgggcatgaccagtacgcctacgacggcaaggattacatcgccctg aacgaggacctgcgctcctggaccgccgcggacacggcggctcagatcacccagcgcaagtgg gaggcggcccgtgaggcggagcagcggagagcctacctggagggcgagtgcgtggagtggctc cgcagatacctggagaacgggaaggacaagctggagcgcgctgaccccccaaagacacacgtg acccaccaccccatctctgaccatgaggccaccctgaggtgctgggccctgggtttctaccct gcggagatcacactgacctggcagcgggatggcgaggaccaaactcaggacactgagcttgtg gagaccagaccagcaggagatagaaccttccagaagtgggcagctgtggtggtgccttctgga gaagagcagagatacacatgccatgtacagcatgaggggctgccgaagcccctcaccctgaga tgggagccgtcttcc 466 ggctcccactccatgaggtatttcgacaccgccatgtcccggcccggccgcggggagccccgc ttcatctcagtgggctacgtggacgacacgcagttcgtgaggttcgacagcgacgccgcgagt ccgagagaggagccgcgggcgccgtggatagagcaggaggggccggagtattgggaccggaac acacagatcttcaagaccaacacacagactgaccgagagagcctgcggaacctgcgcggcgcc tacaaccagagcgaggccgggtctcacaccctccagagcatgtacggctgcgacgtggggccg gacgggcgcctcctccgcgggcataaccagtacgcctacgacggcaaggattacatcgccctg aacgaggacctgcgctcctggaccgcggcggacaccgcggctcagatcacccagcgcaagtgg gaggcggcccgtgtggcggagcaggacagagcctacctggagggcacgtgcgtggagtggctc cgcagatacctggagaacgggaaggacacgctggagcgcgcggaccccccaaagacacacgtg acccaccaccccatctctgaccatgaggccaccctgaggtgctgggccctgggcttctaccct gcggagatcacactgacctggcagcgggatggcgaggaccaaactcaggacactgagcttgtg gagaccagaccagcaggagatagaaccttccagaagtgggcagctgtggtggtgccttctgga gaagagcagagatacacatgccatgtacagcatgaggggctgccgaagcccctcaccctgaga tgggagccgtcttcc 467 ggctcccactccatgaggtatttctacaccgccatgtcccggcccggccgcggggagccccgc ttcatcgcagtgggctacgtggacgacacccagttcgtgaggttcgacagcgacgccgcgagt ccgaggatggcgccccgggcgccatggatagagcaggaggggccggagtattgggaccgggag acacagatctccaagaccaacacacagacttaccgagagagcctgcggaacctgcgcggcgcc tacaaccagagcgaggccgggtctcacaccctccagaggatgtacggctgcgacgtggggccg gacgggcgcctcctccgcgggcatgaccagtccgcctacgacggcaaggattacatcgccctg aacgaggacctgagctcctggaccgcggcggacacggcggctcagatcacccagcgcaagtgg gaggcggcccgtgaggcggagcagtggagagcctacctggagggcctgtgcgtggagtggctc cgcagatacctggagaacgggaaggagacactgcagcgcgcggaccccccaaagacacatgtg acccaccaccccatctctgaccatgaggccaccctgaggtgctgggccctgggcttctaccct gcggagatcacactgacctggcagcgggatggcgaggaccaaactcaggacaccgagcttgtg gagaccagaccagcaggagatagaaccttccagaagtgggcagctgtggtggtgccttctgga gaagagcagagatacacatgccatgtacagcatgaggggctgccgaagcccctcaccctgaga tgggagccatcttcc 468 ggctcccactccatgaggtatttccacaccgccatgtcccggcccggccgcggggagccccgc ttcatcaccgtgggctacgtggacgacacgctgttcgtgaggttcgacagcgacgccacgagt ccgaggaaggagccgcgggcgccatggatagagcaggaggggccggagtattgggaccgggag acacagatctccaagaccaacacacagacttaccgagagagcctgcggaacctgcgcggcgcc tacaaccagagcgaggccgggtctcacaccctccagaggatgtacggctgcgacgtggggccg gacgggcgcctcctccgcgggcataaccagtacgcctacgacggcaaggattacatcgccctg aacgaggacctgcgctcctggaccgccgcggacacggcggctcagatctcccagcgcaagttg gaggcggcccgtgtggcggagcagctgagagcctacctggagggcgagtgcgtggagtggctc cgcagatacctggagaacgggaaggacaagctggagcgcgctgaccccccaaagacacacgtg acccaccaccccatctctgaccatgaggccaccctgaggtgctgggccctgggtttctaccct gcggagatcacactgacctggcagcgggatggcgaggaccaaactcaggacactgagcttgtg gagaccagaccagcaggagatagaaccttccagaagtgggcagctgtggtggtgccttctgga gaagagcagagatacacatgccatgtacagcatgaggggctgccgaagcccctcaccctgaga tgggagccgtcttcc 469 ggctcccactccatgaggtatttccacacctccgtgtcccggcccggccgcggggagccccgc ttcatcaccgtgggctacgtggacgacacgctgttcgtgaggttcgacagcgacgccacgagt ccgaggaaggagccgcgggcgccatggatagagcaggaggggccggagtattgggaccgggag acacagatctccaagaccaacacacagacttaccgagagagcctgcggaacctgcgcggcgcc tacaaccagagcgaggccgggtctcacaccctccagagcatgtacggctgcgacgtggggccg gacgggcgcctcctccgcgggcataaccagtacgcctacgacggcaaggattacatcgccctg aacgaggacctgcgctcctggaccgccgcggacacggcggctcagatcacccagcgcaagtgg gaggcggcccgtgtggcggagcagctgagagcctacctggagggcgagtgcgtggagtggctc cgcagatacctggagaacgggaaggagacactgcagcgcgcggaccccccaaagacacacgtg acccaccaccccatctctgaccatgaggccaccctgaggtgctgggccctgggcttctaccct gcggagatcacactgacctggcagcgggatggcgaggaccaaactcaggacactgagcttgtg gagaccagaccagcaggagatagaaccttccagaagtgggcagctgtggtggtgccttctgga gaagagcagagatacacatgccatgtacagcatgaggggctgccgaagcccctcaccctgaga tgggagccgtcttcc 470 ggctcccactccatgaggtatttctacaccgccatgtcccggcccggccgcggggagccccgc ttcatcaccgtgggctacgtggacgacacgctgttcgtgaggttcgacagcgacgccacgagt ccgaggaaggagccgcgggcgccatggatagagcaggaggggccggagtattgggaccgggag acacagatctccaagaccaacacacagacttaccgagagaacctgcgcaccgcgctccgcgcc tacaaccagagcgaggccgggtctcacatcatccagaggatgtacggctgcgacgtggggccg gacgggcgcctcctccgcgggtatgaccaggacgcctacgacggcaaggattacatcgccctg aacgaggacctgagctcctggaccgcggcggacaccgcggctcagatcacccagcgcaagtgg gaggcggcccgtgtggcggagcaggacagagcctacctggagggcctgtgcgtggagtcgctc cgcagatacctggagaacgggaaggagacactgcagcgcgcggaccccccaaagacacatgtg acccaccaccccatctctgaccatgaggtcaccctgaggtgctgggccctgggcttctaccct gcggagatcacactgacctggcagcgggatggcgaggaccaaactcaggacaccgagcttgtg gagaccagaccagcaggagatagaaccttccagaagtgggcagctgtggtggtgccttctgga gaagagcagagatacacatgccatgtacagcatgaggggctgccgaagcccctcaccctgaga tgggagccgtcttcc 471 ggctcccactccatgaggtatttctacaccgccatgtcccggcccggccgcggggagccccgc ttcatcaccgtgggctacgtggacgacacgctgttcgtgaggttcgacagcgacgccacgagt ccgaggaaggagccgcgggcgccatggatagagcaggaggggccggagtattgggaccgggag acacagatctccaagaccaacacacagacttaccgagagaacctgcgcaccgcgctccgcgcc tacaaccagagcgaggccgggtctcacatcatccagaggatgtacggctgcgacgtggggccg gacgggcgcctcctccgcgggtatgaccaggacgcctacgacggcaaggattacatcgccctg aacgaggacctgagctcctggaccgcggcggacaccgcggctcagatcacccagcgcaagtgg gaggcggcccgtgtggcggagcagctgagagcctacctggagggcctgtgcgtggagtcgctc cgcagatacctggagaacgggaaggagacactgcagcgcgcggaccccccaaagacacatgtg acccaccaccccatctctgaccatgaggtcaccctgaggtgctgggccctgggcttctaccct gcggagatcacactgacctggcagcgggatggcgaggaccaaactcaggacaccgagcttgtg gagaccagaccagcaggagatagaaccttccagaagtgggcagctgtggtggtgccttctgga gaagagcagagatacacatgccatgtacagcatgaggggctgccgaagcccctcaccctgaga tgggagccgtcttcc 472 ggctcccactccatgaggtatttctacaccgccatgtcccggcccggccgcggggagccccgc ttcattgcagtgggctacgtggacgacacccagttcgtgaggttcgacagcgacgccgcgagt ccgaggacggagccccgggcgccatggatagagcaggaggggccggagtattgggaccggaac acacagatcttcaagaccaacacacagacttaccgagagaacctgcggatcgcgctccgcgcc tacaaccagagcgaggccgggtctcacacttggcagacgatgtatggctgcgacgtggggccg gacgggcgcctcctccgcgggcataaccagtacgcctacgacggcaaagattacatcgccctg aacgaggacctgagctcctggaccgcggcggacaccgcggctcagatcacccagcgcaagtgg gaggcggcccgtgaggcggagcagctgagagcctacctggagggcctgtgcgtggagtggctc cgcagacacctggagaacgggaaggagacactgcagcgcgcggaccccccaaagacacacgtg acccaccacccagtctctgaccatgaggccaccctgaggtgctgggccctgggcttctaccct gcggagatcacactgacctggcagcgggatggcgaggaccaaactcaggacactgagcttgtg gagaccagaccagcaggagatagaaccttccagaagtgggcagctgtggtggtgccttctgga gaagagcagagatacacatgccatgtacagcatgaggggctgccgaagcccctcaccctgaga tgggagccatcttcc 473 ggctcccactccatgaggtatttctacaccgccatgtcccggcccggccgcggggagccccgc ttcatcgcagtgggctacgtggacgacacccagttcgtgaggttcgacagcgacgccgcgagt ccgaggacggagccccgggcgccatggatagagcaggaggggccggagtattgggaccggaac acacagatcttcaagaccaacacacagacttaccgagagaacctgcggatcgcgctccgcgcc tacaaccagagcgaggccgggtctcacatcatccagaggatgtatggctgcgacctggggccc gacgggcgcctcctccgcgggcatgaccagtccgcctacgacggcaaggattacatcgccctg aacgaggacctgagctcctggaccgcggcggacaccgcggctcagatcacccagcgcaagtgg gaggcggcccgtgtggcggagcagctgagagcctacctggagggcctgtgcgtggagtggctc cgcagatacctggagaacgggaaggagacactgcagcgcgcggaccccccaaagacacacgtg acccaccacccagtctctgaccatgaggccaccctgaggtgctgggccctgggcttctaccct gcggagatcacactgacctggcagcgggatggcgaggaccaaactcaggacactgagcttgtg gagaccagaccagcaggagatagaaccttccagaagtgggcagctgtggtggtgccttctgga gaagagcagagatacacatgccatgtacagcatgaggggctgccgaagcccctcaccctgaga tgggagccatcttcc 474 ggctcccactccatgaggtatttctacaccgccatgtcccggcccggccgcggggagccccgc ttcatcgcagtgggctacgtggacgacacccagttcgtgaggttcgacagcgacgccgcgagt ccgaggacggagccccgggcgccatggatagagcaggaggggccggagtattgggacggggag acacggaacatgaaggcctccgcgcagacttaccgagagaacctgcggatcgcgctccgcgcc tacaaccagagcgaggccgggtctcacatcatccagaggatgtatggctgcgacctggggccc gacgggcgcctcctccgcgggcatgaccagtccgcctacgacggcaaggattacatcgccctg aacgaggacctgagctcctggaccgcggcggacaccgcggctcagatcacccagcgcaagtgg gaggcggcccgtgtggcggagcagctgagagcctacctggagggcctgtgcgtggagtggctc cgcagatacctggagaacgggaaggagacactgcagcgcgcggaccccccaaagacacacgtg acccaccacccagtctctgaccatgaggccaccctgaggtgctgggccctgggcttctaccct gcggagatcacactgacctggcagcgggatggcgaggaccaaactcaggacactgagcttgtg gagaccagaccagcaggagatagaaccttccagaagtgggcagctgtggtggtgccttctgga gaagagcagagatacacatgccatgtacagcatgaggggctgccgaagcccctcaccctgaga tgggagccatcttcc 475 tgctcccactccatgaagtatttcttcacatccgtgtcccggcctggccgcggagagccccgc ttcatctcagtgggctacgtggacgacacgcagttcgtgcggttcgacagcgacgccgcgagt ccgagaggggagccgcgggcgccgtgggtggagcaggaggggccggagtattgggaccgggag acacagaagtacaagcgccaggcacagactgaccgagtgagcctgcggaacctgcgcggcgcc tacaaccagagcgaggccgggtctcacaccctccagtggatgtgtggctgcgacctggggccc gacgggcgcctcctccgcgggtatgaccagtacgcctacgacggcaaggattacatcgccctg aacgaggacctgcgctcctggaccgccgcggacaccgcggctcagatcacccagcgcaagtgg gaggcggcccgtgaggcggagcagcggagagcctacctggagggcacgtgcgtggagtggctc cgcagatacctggagaacgggaaggagacactgcagcgcgcggaacacccaaagacacacgtg acccaccatccagtctctgaccatgaggccaccctgaggtgctgggccctgggcttctaccct gcggagatcacactgacctggcagtgggatggggaggaccaaactcaggacaccgagcttgtg gagaccaggccagcaggagatggaaccttccagaagtgggcagctgtgatggtgccttctgga gaagagcagagatacacgtgccatgtgcagcacgaggggctgccggagcccctcaccctgaga tgggagccgtcttcc 476 tgctcccactccatgaggtatttctacaccgctgtgtcccggcccagccgcggagagccccac ttcatcgcagtgggctacgtggacgacacgcagttcgtgcggttcgacagcgacgccgcgagt ccaagaggggagccgcgggcgccgtgggtggagcaggaggggccggagtattgggaccgggag acacagaagtacaagcgccaggcacagactgaccgagtgaacctgcggaaactacgcggcgcc tacaaccagagcgaggccgggtctcacaccctccagaggatgtacggctgcgacctggggccc gacgggcgcctcctccgcgggtatgaccagtccgcctacgacggcaaggattacatcgccctg aacgaggacctgcgctcctggaccgccgcggacacagcggctcagatcacccagcgcaagtgg gaggcggcccgtgaggcggagcagtggagagcctacctggagggcgagtgcgtggagtggctc cgcagatacctggagaacgggaaggagacactgcagcgcgcggaacacccaaagacacacgtg acccaccatccagtctctgaccatgaggccaccctgaggtgctgggccctgggcttctaccct acggagatcacactgacctggcagcgggatggcgaggaccaaactcaggacaccgagcttgtg gagaccaggccagcaggagatggaaccttccagaagtgggcagctgtggtggtgccttctgga gaagagcagagatacacgtgccatgtgcagcacgaggggctgccggagcccctcaccctgaga tgggagccatcttcc 477 ggctcccactccatgaggtatttctacaccgctgtgtcccggcccggccgcggggagccccac ttcatcgcagtgggctacgtggacgacacgcagttcgtgcggttcgacagcgacgccgcgagt ccgagaggggagccgcgggcgccgtgggtggagcaggaggggccggagtattgggaccgggag acacagaagtacaagcgccaggcacagactgaccgagtgagcctgcggaacctgcgcggcgcc tacaaccagagcgaggccgggtctcacatcatccagaggatgtatggctgcgacgtggggccc gacgggcgcctcctccgcgggtatgaccagtacgcctacgacggcaaggattacatcgccctg aacgaggatctgcgctcctggaccgccgcggacacggcggctcagatcacccagcgcaagtgg gaggcggcccgtgaggcggagcagctgagagcctacctggagggcctgtgcgtggagtggctc cgcagatacctgaagaatgggaaggagacactgcagcgcgcggaacacccaaagacacacgtg acccaccatccagtctctgaccatgaggccaccctgaggtgctgggccctgggcttctaccct gcggagatcacactgacctggcagtgggatggggaggaccaaactcaggacactgagcttgtg gagaccaggccagcaggagatggaaccttccagaagtgggcagctgtggtggtgccttctgga gaagagcagagatacacgtgccatgtgcagcacgaggggctgccggagcccctcaccctgaga tgggagccgtcttcc 478 ggctcccactccatgaggtatttctccacatccgtgtcctggcccggccgcggggagccccgc ttcatcgcagtgggctacgtggacgacacgcagttcgtgcggttcgacagcgacgccgcgagt ccaagaggggagccgcgggagccgtgggtggagcaggaggggccggagtattgggaccgggag acacagaagtacaagcgccaggcacaggctgaccgagtgaacctgcggaaactgcgcggcgcc tacaaccagagcgaggacgggtctcacaccctccagaggatgtttggctgcgacctggggccg gacgggcgcctcctccgcgggtataaccagttcgcctacgacggcaaggattacatcgccctg aacgaggatctgcgctcctggaccgccgcggacacggcggctcagatcacccagcgcaagtgg gaggcggcccgtgaggcggagcagcggagagcctacctggagggcacgtgcgtggagtggctc cgcagatacctggagaacgggaaggagacactgcagcgcgcggaacacccaaagacacacgtg acccaccatccagtctctgaccatgaggccaccctgaggtgctgggccctgggcttctaccct gcggagatcacactgacctggcagtgggatggggaggaccaaactcaggacaccgagcttgtg gagaccaggccagcaggagatggaaccttccagaagtgggcagctgtggtggtgccttctgga gaagagcagagatacacgtgccatgttcagcacgaggggctgccggagcccctcaccctgaga tggaagccgtcttcc 479 tgctcccactccatgaggtatttctacaccgccgtgtcccggcccggccgcggagagccccgc ttcatcgcagtgggctacgtggacgacacgcagttcgtgcagttcgacagcgacgccgcgagt ccaagaggggagccgcgggcgccgtgggtggagcaggaggggccggagtattgggaccgggag acacagaagtacaagcgccaggcacagactgaccgagtgaacctgcggaaactgcgcggcgcc tacaaccagagcgaggccgggtctcacaccctccagaggatgtatggctgcgacctggggccc gacgggcgcctcctccgcgggtataaccagttcgcctacgacggcaaggattacatcgccctg aatgaggacctgcgctcctggaccgccgcggacaaggcggctcagatcacccagcgcaagtgg gaggcggcccgtgaggcggagcagcggagagcctacctggagggcacgtgcgtggagtggctc cgcagatacctggagaacgggaagaagacgctgcagcgcgcggaacacccaaagacacacgtg acccaccatccagtctctgaccatgaggccaccctgaggtgctgggccctgggcttctaccct gcggagatcacactgacctggcagcgggatggcgaggaccaaactcaggacaccgagcttgtg gagaccaggccagcaggagatggaaccttccagaagtgggcagctgtggtggtgccttctgga gaagagcagagatacacgtgccatgtgcagcacgaggggctgccagagcccctcaccctgaga tgggggccatcttcc 480 tgctcccactccatgaggtatttcgacaccgccgtgtcccggcccggccgcggagagccccgc ttcatctcagtgggctacgtggacgacacgcagttcgtgcggttcgacagcgacgccgcgagt ccgagaggggagccccgggcgccgtgggtggagcaggaggggccggagtattgggaccgggag acacagaagtacaagcgccaggcacaggctgaccgagtgaacctgcggaaactgcgcggcgcc tacaaccagagcgaggacgggtctcacaccctccagtggatgtatggctgcgacctggggccc gacgggcgcctcctccgcgggtatgaccagtccgcctacgacggcaaggattacatcgccctg aacgaggacctgcgctcctggaccgccgcggacacggcggctcagatcacccagcgcaagtgg gaggcggcccgtgaggcggagcagtggagagcctacctggagggcacgtgcgtggagtggctc cgcagatacctggagaacgggaaggagacactgcagcgcgcggaacacccaaagacacacgtg acccaccatccagtctctgaccatgaggccaccctgaggtgctgggccctgggcttctaccct gcggagatcacactgacctggcagcgggatggcgaggaccaaactcaggacaccgagcttgtg gagaccaggccagcaggagatggaaccttccagaagtgggcagctgtggtggtgccttctgga gaagagcagagatacacgtgccatgtgcagcacgaggggctgccagagcccctcaccctgaga tgggagccatcttcc 481 Tgctcccactccatgaggtatttcgacaccgccgtgtcccggcccggccgcggagagccccgc ttcatctcagtgggctacgtggacgacacgcagttcgtgcggttcgacagcgacgccgcgagt ccgagaggggagccgcgggcgccgtgggtggagcaggaggggccggagtattgggaccgggag acacagaactacaagcgccaggcacaggctgaccgagtgagcctgcggaacctgcgcggcgcc tacaaccagagcgaggacgggtctcacaccctccagaggatgtatggctgcgacctggggccc gacgggcgcctcctccgcgggtatgaccagtccgcctacgacggcaaggattacatcgccctg aacgaggacctgcgctcctggaccgccgcggacaccgcggctcagatcacccagcgcaagttg gaggcggcccgtgcggcggagcagctgagagcctacctggagggcacgtgcgtggagtggctc cgcagatacctggagaacgggaaggagacactgcagcgcgcagaacccccaaagacacacgtg acccaccaccccctctctgaccatgaggccaccctgaggtgctgggccctgggcttctaccct gcggagatcacactgacctggcagcgggatggggaggaccagacccaggacaccgagcttgtg gagaccaggccagcaggagatggaaccttccagaagtgggcagctgtggtggtgccttctgga caagagcagagatacacgtgccatatgcagcacgaggggctgcaagagcccctcaccctgagc tgggagccatcttcc 482 tgctcccactccatgaggtatttcgacaccgccgtgtcccggcccggccgcggagagccccgc ttcatctcagtgggctacgtggacgacacgcagttcgtgcggttcgacagcgacgccgcgagt ccgagaggggagccgcgggcgccgtgggtggagcaggaggggccggagtattgggaccgggag acacagaagtacaagcgccaggcacaggctgaccgagtgagcctgcggaacctgcgcggcgcc tacaaccagagcgaggacgggtctcacaccctccagaggatgtctggctgcgacctggggccc gacgggcgcctcctccgcgggtatgaccagtccgcctacgacggcaaggattacatcgccctg aacgaggacctgcgctcctggaccgccgcggacaccgcggctcagatcacccagcgcaagttg gaggcggcccgtgcggcggagcagctgagagcctacctggagggcacgtgcgtggagtggctc cgcagatacctggagaacgggaaggagacactgcagcgcgcagaacccccaaagacacacgtg acccaccaccccctctctgaccatgaggccaccctgaggtgctgggccctgggcttctaccct gcggagatcacactgacctggcagcgggatggggaggaccagacccaggacaccgagcttgtg gagaccaggccagcaggagatggaaccttccagaagtgggcagctgtggtggtgccttctgga caagagcagagatacacgtgccatatgcagcacgaggggctgcaagagcccctcaccctgagc tgggagccatcttcc 483 tgctcccactccatgaggtatttctacaccgccgtgtcccggcccggccgcggagagccccgc ttcatcgcagtgggctacgtggacgacacgcagttcgtgcggttcgacagcgacgccgcgagt ccaagaggggagccgcgggcgccgtgggtggagcaggaggggccggagtattgggaccgggag acacagaagtacaagcgccaggcacagactgaccgagtgagcctgcggaacctgcgcggcgcc tacaaccagagcgaggccgggtctcacaccctccagtggatgtatggctgcgacctggggccc gacgggcgcctcctccgcgggtatgaccagtccgcctacgacggcaaggattacatcgccctg aacgaggacctgcgctcctggaccgccgcggacacggcggctcagatcacccagcgcaagtgg gaggcggcccgtgcggcggagcagcagagagcctacctggagggcacgtgcgtggagtggctc cgcagatacctggagaacgggaaggagacactgcagcgcgcggaacacccaaagacacacgtg acccaccatttggtctctgaccatgaggccaccctgaggtgctgggccctgggcttctaccct gcggagatcacactgacctggcagcgggatggcgaggaccaaactcaggacaccgagcttgtg gagaccaggccagcaggagatggaaccttccagaagtgggcagctgtggtggtgccttctgga gaagagcagagatacacgtgccatgtgcagcacgaggggctgccggagcccctcaccctgaga tgggagccatcttcc 484 ggctcccactccttgaagtatttccacacttccgtgtcccggcccggccgcggggagccccgc ttcatctctgtgggctacgtggacgacacccagttcgtgcgcttcgacaacgacgccgcgagt ccgaggatggtgccgcgggcgccgtggatggagcaggaggggtcagagtattgggaccgggag acacggagcgccagggacaccgcacagattttccgagtgaacctgcggacgctgcgcggcgcc tacaatcagagcgaggccgggtctcacaccctgcagtggatgcatggctgcgagctggggccc gacgggcgcttcctccgcgggtatgaacagttcgcctacgacggcaaggattatctcaccctg aatgaggacctgcgctcctggaccgcggtggacacggcggctcagatctccgagcaaaagtca aatgatgcctctgaggcggagcaccagagagcctacctggaagacacatgcgtggagtggctc cacaaatacctggagaaggggaaggagacactgcttcacctggagcccccaaagacacacgtg actcaccaccccatctctgaccatgaggccaccctgaggtgctgggccctgggcttctaccct gcggagatcacactgacctggcagcaggatggggagggccatacccaggacacggagctcgtg gagaccaggcctgcaggggatggaaccttccagaagtgggcagctgtggtggtgccttctgga gaggagcagagatacacgtgccatgtgcagcatgaggggctacccgagcccgtcaccctgaga tggaagccggcttcc
[0093] In some embodiments, the plurality of the HLA-antigen polypeptide complexes of the randomized peptide antigen libraries comprise at least about 10.sup.5 different HLA-antigen polypeptide complexes. Components of the 10.sup.5 different HLA-antigen polypeptide complexes include, collectively, at least about 10.sup.5 different randomized antigen polypeptides. In some embodiments, the plurality of the HLA-antigen polypeptide complexes of the randomized peptide antigen libraries comprise at least about 10.sup.7 different HLA-antigen polypeptide complexes. Components of the 10.sup.7 different HLA-antigen polypeptide complexes include, collectively, at least about 10.sup.7 different randomized antigen polypeptides. In some embodiments, the plurality of the HLA-antigen polypeptide complexes of the randomized peptide antigen libraries comprise at least about 10.sup.9 different HLA-antigen polypeptide complexes. Components of the 10.sup.9 different HLA-antigen polypeptide complexes include, collectively, at least about 10.sup.9 different randomized antigen polypeptides. In some embodiments, the plurality of the HLA-antigen polypeptide complexes of the randomized peptide antigen libraries comprise at least about 10.sup.11 different HLA-antigen polypeptide complexes. Components of the 10.sup.11 different HLA-antigen polypeptide complexes include, collectively, at least about 10.sup.11 different randomized antigen polypeptides.
[0094] In some embodiments, the plurality of the HLA-antigen polypeptide complexes of the randomized peptide antigen libraries further comprise a β2-microglobulin polypeptide, which interacts with and stabilizes the HLA-antigen polypeptide complexes on the surface of the cell. The amino acid sequence of human β2-microglobulin polypeptide is set forth in NCBI Seq. Ref. NP_004039. In some embodiments, the human β2-microglobulin polypeptide amino acid sequence of the present disclosure is a functional naturally occurring variant of the human β2-microglobulin polypeptide having an amino acid sequence at least about 90%, 95%, 97%, 98%, or 99% identical to the human β2-microglobulin polypeptide disclosed as NCBI Seq. Ref NP_004039.
[0095] The present disclosure also includes antigen screening libraries of a plurality HLA-antigen polypeptide where the β2-microglobulin is constitutively expressed by a cell. In some embodiments, the β2-microglobulin is encoded by a first nucleic acid, the randomized antigen polypeptide encoded by a second nucleic acid, and the HLA polypeptide is encoded by a third nucleic acid. In other embodiments, the β2-microglobulin is encoded by a first nucleic acid and the randomized antigen polypeptide and the HLA polypeptide is encoded by a second nucleic acid. When encoded by the first nucleic acid, the β2-microglobulin can be transduced, transfected, or transformed into a cell before or after the second nucleic acid or the third nucleic acid.
[0096] In some embodiments of the present disclosure, the β2-microglobulin is fused to at least one of the randomized antigen polypeptides of the antigen screening library using techniques known to those of ordinary skill in the art. In these embodiments, the HLA polypeptides may or may not be a component of the antigen screening library. In other embodiments of the present disclosure, at least one of the HLA polypeptides is fused to at least one of the randomized antigen polypeptides of the antigen screening library using techniques known to those of ordinary skill in the art. In these embodiments, the β2-microglobulin can be expressed by a cell that is transduced, transfected, or transformed to express other components of the antigen screening library, such as the randomized antigen polypeptides and the HLA polypeptides. Similar to other embodiments described herein, the β2-microglobulin is constitutively expressed by the cell. In certain of these embodiments, the cell is a yeast cell. In other embodiments, the β2-microglobulin is not expressed by the cell that is transduced, transfected, or transformed to express other components of the antigen screening library, such as the randomized antigen polypeptides and the HLA polypeptides. In certain of these embodiments, the cell is a mammalian cell.
[0097] In addition to the (a) randomized antigen polypeptide, (b) MHC I HLA molecule, and (c) β2-microglobulin features of the HLA-antigen polypeptide complex of the randomized peptide antigen libraries, the HLA-antigen polypeptide complexes of the present disclosure can further include (d) a signal sequence, (e) polypeptide linkers between any or all of (a), (b), or (c), (f) a membrane tethering domain, and, optionally, (g) an epitope tag, such as a FLAG tag, a c-Myc tag, a His-tag, a hemagglutinin (HA) tag, a VSVg tag, a V5 tag, an AU1 tag, an AU5 tag, a Glu-Glu tag, an OLLAS tag, a T7 tag, an S-TagHSV tag, a KT3 tag, a TK15 tag, an Fc tag, an Xpress tag, a Ty tag, a Strep tag, an NE tag, an E tag, a C-tag, and/or an AviTag. In some embodiments, the HLA-antigen complexes do not comprise an epitope tag. However, in some embodiments, at least one or more of each of the plurality of HLA-antigen complexes of the randomized peptide antigen libraries comprise the epitope tag which allows for confirmation of expression of at least one of the HLA-antigen complexes using an antibody specific for the epitope. In some embodiments, each of the plurality of HLA-antigen complexes of the randomized peptide antigen libraries comprise the epitope tag.
[0098] In some embodiments, the membrane tethering domain comprises a polypeptide linker separating the membrane tethering domain from one or more other features ((a)-(e) and (g)) of the HLA-antigen polypeptide complex. In some embodiments, the features ((a)-(g)) of the HLA-antigen polypeptide complex are expressed as a single polypeptide. In some embodiments, the (b) HLA molecule (e.g., HLA polypeptide), the (a) randomized antigen polypeptide, and the (c) β2-microglobulin polypeptide comprise a single polypeptide. In some embodiments, the (b) HLA polypeptide and the (a) randomized antigen polypeptide are expressed as a single polypeptide, while, the (c) β2-microglobulin is expressed separately. For example, the (c) β2-microglobulin can be supplied from a separate polypeptide encoded by the same nucleic acid that expresses the (a) randomized antigen polypeptide and the (b) HLA polypeptide, a separate nucleic acid, or endogenously produced by the cell. In some embodiments, the randomized antigen polypeptide is N-terminal to the HLA polypeptide, and the HLA polypeptide is N-terminal to the β2-microglobulin polypeptide. In some embodiments, the randomized antigen polypeptide is C-terminal to the HLA polypeptide, and the HLA polypeptide is N-terminal to the β2-microglobulin polypeptide. In some embodiments, the randomized antigen polypeptide is N-terminal to the HLA polypeptide, and the HLA polypeptide is C-terminal to the β2-microglobulin polypeptide. In some embodiments, the randomized antigen polypeptide is C-terminal to the HLA polypeptide, and the HLA polypeptide is C-terminal to the β2-microglobulin polypeptide.
[0099] The (a) a randomized antigen polypeptide, (b) a major histocompatibility class I (MHC I) HLA molecule, and (c) a β2-microglobulin, can be separated by at least one flexible polypeptide linker, such as a first flexible polypeptide linker, a second flexible polypeptide linker, a third flexible polypeptide linker, a fourth flexible polypeptide linker, a fifth flexible polypeptide linker, or more flexible polypeptide linkers. In some embodiments, the at least one flexible polypeptide linker can range between about 3 and about 100 amino acid residues in length, between about 5 and about 80 amino acid residues in length, between about 10 and about 70 amino acid residues in length, between about 3 and about 100 amino acid residues in length, between about 20 and about 60 amino acid residues in length. In some embodiments, the linker can be about 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 amino acid residues in length. In some embodiments, the linker can be a glycine linker, or a Gly-Ser linker of the formula (GGGGS).sub.X, wherein X is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10. In some embodiments, the linker can suitably comprise a protease cleavage site such as a thrombin cleavage site.
[0100] In some embodiments, the HLA-antigen polypeptide complexes of the randomized peptide antigen libraries comprise a signal polypeptide which directs the HLA-antigen polypeptide complex to the cell surface via the secretory pathway. This signal peptide is cleaved in the endoplasmic reticulum and is not expressed by the HLA-antigen polypeptide complex when located on the cell-surface. The signal sequence can be any suitable sequence such as an endogenous HLA leader sequence, or a heterologous leader sequence imported from a different secretory or transmembrane molecule, such as an immunoglobulin leader sequence.
[0101] The HLA-antigen polypeptide complexes further comprise a membrane tethering domain, such as an anchor domain from a glycosylphosphatidylinositol (GPI) protein and/or a domain from yeast proteins having internal repeats (PIR protein). This membrane tethering domain can comprise a transmembrane domain or a domain that interacts with a cell surface protein. In some embodiments, the membrane tethering domain comprise at least one anchor domain of a GPI protein selected from the group consisting of yeast Aga2, Cwp1p, Cwp2p, Aga1p, Tip1p, Flo1p, Sed1p, YCR89w, and Tir1p and/or a PIR protein selected from the group consisting of yeast Pir1p, Pir2p, Pir3p, Pir4p, and Pir5p. A non-limiting example of membrane domain tethering is provided in
[0102] In other embodiments, components of the antigen screening libraries of a plurality HLA-antigen polypeptide complexes are expressed as more than one polypeptide and include a cleavage sequence which separates components of the antigen screening libraries of a plurality HLA-antigen polypeptide complexes from one another. For example, the randomized peptide antigen is separated from the HLA polypeptide and/or from the Beta-2 (β2) microglobulin polypeptide by the cleavage sequence. As another example, the HLA peptide is separated from the Beta-2 (β2) microglobulin polypeptide by the nucleotide encoded cleavage sequence. In some embodiments, the components of the antigen screening libraries are separated by more than one cleavage sequence. Suitable cleavage sequences are known to those of ordinary skill in the art and include, but are not limited to, self-cleaving peptides (P2A, T2A, F2A, and E2A), proteolytic cleavage sites (a 3C site, a thrombin site, a TEV site, a Factor Xa site, and an EKT site) and an internal ribosome entry sequence (IRES).
[0103] In some embodiments, the antigen screening library and/or the HLA-antigen polypeptide complexes can be expressed by one or more cells that can easily be transfected, transduced, electroporated, or transformed with the nucleic acids described herein. In some embodiments, the antigen screening library and/or the HLA-antigen polypeptide complexes are expressed on a plurality of cells. In some embodiments, each cell of the plurality of cells expresses a specific HLA-antigen complex of the HLA-antigen polypeptide complexes and/or another component of the antigen screening library. In some embodiments, a nucleic acid or a plurality of nucleic acids encode the antigen screening library and/or the HLA-antigen polypeptide complexes. In some embodiments, the antigen screening library and/or the HLA-antigen polypeptide complexes comprise prokaryotic cells. In some embodiments, the cell expressing the HLA-antigen polypeptide complexes comprise eukaryotic cells. In some embodiments, the eukaryotic cells comprise yeast cells. In some embodiments, the yeast cells are a cell of Saccharomyces cerevisiae. In some embodiments, the Saccharomyces cerevisiae is of the strain EBY100. Transforming Saccharomyces cerevisiae with nucleic acids can be achieved by standard methods as long as the efficiency is sufficient to produce at least 10.sup.7, 10.sup.8, 10.sup.9, or 10.sup.10 transformants.
[0104] In addition to the plurality of HLA-antigen polypeptide complexes of the antigen screening libraries described above, the present technology also includes at least two or more antigen screening libraries having HLA-antigen polypeptide complexes that differ from those described above. In some embodiments, the HLA-antigen polypeptide complexes have fewer components and/or at least one different component than the plurality of HLA-antigen polypeptide complexes described above. For example, in some embodiments, HLA-antigen polypeptide complexes can also comprise (a) an HLA polypeptide having a peptide binding cleft; and (b) a randomized antigen polypeptide comprising an amino acid sequence set forth in any one of SEQ ID NOs: 1 to 209 that specifically binds to the peptide binding cleft of the HLA polypeptide. In these embodiments, the HLA polypeptide, and the randomized antigen polypeptide comprise a single polypeptide. Also in these embodiments, the single polypeptide further comprises a first flexible polypeptide linker separating the HLA polypeptide from the randomized antigen polypeptide. When expressed on a single polypeptide separated by the first flexible polypeptide linker, the randomized antigen polypeptide is N-terminal to the HLA polypeptide on the single polypeptide or the randomized antigen polypeptide is C-terminal to the HLA polypeptide on the single polypeptide.
[0105] As another example, in some embodiments, antigen screening libraries of the present technology comprise (a) an HLA polypeptide constitutively expressed by one or more yeast cells, the HLA polypeptide comprising a peptide binding cleft, and (b) a plurality of Beta-2 (β2) microglobulin polypeptide-antigen polypeptide complexes. In these embodiments, the plurality of Beta-2 (β2) microglobulin polypeptide complexes include a randomized antigen polypeptide comprising an amino acid sequence set forth in any one of SEQ ID NOs: 1 to 209, wherein the randomized antigen polypeptide specifically binds to the peptide binding cleft of the HLA polypeptide; and (c) a Beta-2 (β2) microglobulin polypeptide. In these embodiments, the randomized antigen polypeptide and the β2-microglobulin polypeptide comprise a single polypeptide. Also, in these embodiments, the single polypeptide further comprises a first flexible polypeptide linker separating the Beta-2 (β2) microglobulin polypeptide from the randomized antigen polypeptide. When expressed on a single polypeptide separated by the first flexible polypeptide linker, the randomized antigen polypeptide is N-terminal to the Beta-2 (β2) microglobulin polypeptide on the single polypeptide or the randomized antigen polypeptide is C-terminal to the Beta-2 (β2) microglobulin polypeptide on the single polypeptide.
Nucleic Acids Encoding HLA-Antigen Polypeptide Complexes
[0106] Also disclosed herein are nucleic acids that encode HLA-antigen polypeptide complexes of the antigen screening libraries. Nucleic acids that encode the HLA-antigen polypeptide complexes of the current disclosure minimally encode: (a) a randomized antigen polypeptide, (b) an MHC I HLA molecule, and a (c) β2-microglobulin. In addition to the (a) randomized antigen polypeptide, (b) MHC I HLA molecule, and (c) β2-microglobulin features of the HLA-antigen polypeptide complex of the randomized peptide antigen libraries encoded by one or more nucleic acids, the HLA-antigen polypeptide complexes of the present disclosure further include nucleic acids which encode (d) a signal sequence, (e) polypeptide linkers between any or all of (a), (b), or (c), (f) a membrane tethering domain, and, optionally, (g) an epitope tag, such as a FLAG tag, a c-MYC tag, a HIS-tag, a hemagglutinin tag, a VSVg tag, a V5 tag, an AU1 tag, an AU5 tag, a Glu-Glu tag, an OLLAS tag, a T7 tag, an S-Tag, an HSV tag, a KT3 tag, a TK15 tag, an Fc tag, an Xpress tag, a Ty tag, a Strep tag, an NE tag, an E tag, a C-tag, and/or an AviTag (
[0107] In some embodiments, the nucleic acid encoding the (f) membrane tethering domain may further encode (e) one or more polypeptide linkers separating the membrane tethering domain from other features of the HLA-antigen polypeptide complex. In some embodiments, the nucleic acid encodes one or more flexible polypeptide linkers which separate the (a) HLA polypeptide from the (b) randomized antigen polypeptide and the (c) β2-microglobulin polypeptide when all three features are encoded on the single nucleic acid.
[0108] In some embodiments, the nucleic acid encoding the single polypeptide further comprises nucleotides which encode a first flexible polypeptide linker and a second flexible polypeptide linker, wherein the nucleotide sequence encoding the first flexible polypeptide linker separates the nucleotide sequence encoding the HLA polypeptide from the nucleotide sequence encoding the randomized antigen polypeptide, and the nucleotide sequence encoding the second flexible polypeptide linker separates the nucleotide sequence encoding the randomized antigen polypeptide from the nucleotide sequence encoding the β2-microglobulin polypeptide. In some embodiments, once expressed, the randomized antigen polypeptide is N-terminal to the HLA polypeptide on the single polypeptide, and the HLA polypeptide is N-terminal to the β2-microglobulin polypeptide on the single polypeptide.
[0109] In some embodiments, the nucleotide sequence encoding the first flexible polypeptide linker separates the nucleotide sequence encoding the HLA polypeptide from the nucleotide sequence encoding the randomized antigen polypeptide, and the nucleotide sequence encoding the second flexible polypeptide linker separates the nucleotide sequence encoding the HLA polypeptide from the nucleotide sequence encoding the β2-microglobulin polypeptide. In some embodiments, once expressed, the randomized antigen polypeptide is C-terminal to the HLA polypeptide on the single polypeptide, and the HLA polypeptide is N-terminal to the β2-microglobulin polypeptide on the single polypeptide.
[0110] In some embodiments, the nucleotide sequence encoding the first flexible polypeptide linker separates the nucleotide sequence encoding the HLA polypeptide from the nucleotide sequence encoding the randomized antigen polypeptide, and the nucleotide sequence encoding the second flexible polypeptide linker separates the nucleotide sequence encoding the HLA polypeptide from the nucleotide sequence encoding the β2-microglobulin polypeptide. In some embodiments, once expressed, the randomized antigen polypeptide is N-terminal to the HLA polypeptide on the single polypeptide, and the HLA polypeptide is C-terminal to the β2-microglobulin polypeptide on the single polypeptide.
[0111] In some embodiments, the nucleotide sequence encoding the first flexible polypeptide linker separates the nucleotide sequence encoding the randomized antigen polypeptide from the nucleotide sequence encoding the β2-microglobulin polypeptide, and the nucleotide sequence encoding the second flexible polypeptide linker separates the nucleotide sequence encoding the β2-microglobulin polypeptide from the nucleotide sequence encoding the HLA polypeptide. In some embodiments, once expressed the randomized antigen polypeptide is C-terminal to the HLA polypeptide on the single polypeptide, and the HLA polypeptide is C-terminal to the β2-microglobulin polypeptide on the single polypeptide.
[0112] In some embodiments, the nucleotide sequence encoding the first flexible polypeptide linker separates the nucleotide sequence encoding the HLA polypeptide from the nucleotide sequence encoding the β2-microglobulin polypeptide, and the nucleotide sequence encoding the second flexible polypeptide linker separates the nucleotide sequence encoding the randomized antigen polypeptide from the nucleotide sequence encoding the HLA polypeptide. In some embodiments, once expressed, the β2-microglobulin polypeptide is C-terminal to the HLA polypeptide on the single polypeptide, and the HLA polypeptide is N-terminal to the randomized antigen polypeptide on the single polypeptide.
[0113] In some embodiments, the nucleotide sequence encoding the first flexible polypeptide linker separates the nucleotide sequence encoding the HLA polypeptide from the nucleotide sequence encoding the randomized antigen polypeptide, and the nucleotide sequence encoding the second flexible polypeptide linker separates the nucleotide sequence encoding the randomized antigen polypeptide from the nucleotide sequence encoding the β2-microglobulin polypeptide. In some embodiments, once expressed, the randomized antigen polypeptide is C-terminal to the β2-microglobulin on the single polypeptide, and the HLA polypeptide is C-terminal to the randomized antigen polypeptide on the single polypeptide. In some embodiments, the nucleotide sequence encoding the first flexible polypeptide linker separates the nucleotide sequence encoding the β2-microglobulin polypeptide from the nucleotide sequence encoding the randomized antigen polypeptide, and the nucleotide sequence encoding the second flexible polypeptide linker separates the nucleotide sequence encoding the randomized antigen polypeptide from the nucleotide sequence encoding the HLA polypeptide.
[0114] In other embodiments, components of the antigen screening libraries of a plurality HLA-antigen polypeptide complexes are expressed as more than one polypeptide despite being encoded by a single nucleic acid. In these embodiments, a nucleotide encoded cleavage sequence separates components of the antigen screening libraries of a plurality HLA-antigen polypeptide complexes from one another. For example, once expressed, the randomized peptide antigen is separated from the HLA polypeptide and/or from the Beta-2 (β2) microglobulin polypeptide by the cleavage sequence. As another example, once expressed, the HLA peptide is separated from the Beta-2 (β2) microglobulin polypeptide by the nucleotide encoded cleavage sequence. In these embodiments, a portion of the HLA polypeptide is expressed separately from other components of the antigen screening libraries of a plurality HLA-antigen polypeptide complexes and, when expressed separately, pairs naturally with the other components of the HLA-antigen polypeptide complexes inside the cell.
[0115] In some embodiments, the randomized antigen polypeptide of the HLA-antigen complex is encoded by a nucleic acid set forth in any one of SEQ ID NOs: 210 to 411. In some embodiments, the HLA polypeptide of the HLA-antigen complex is encoded by a nucleic acid at least 70%, 75%, 80%, 85%, 87.5%, 90%, 95%, 97%, 98%, 99%, or 100% homologous to any one of SEQ ID NOs: 210 to 411. In some embodiments, the randomized antigen polypeptide of the HLA-antigen complex is encoded by a nucleic acid set forth in any one of SEQ ID NOs: 412 to 426. In some embodiments, the HLA polypeptide of the HLA-antigen complex is encoded by a nucleic acid at least 70%, 75%, 80%, 85%, 87.5%, 90%, 95%, 97%, 98%, 99%, or 100% homologous to any one of SEQ ID NOs: 280 to 308. In some embodiments, one or more of the nucleic acids such as one or more of the nucleic acids of SEQ ID NOs: 210 to 411 and 412 to 426 are expressed by a plurality of cells. In some embodiments, each cell of the plurality of cells comprises a nucleic acid encoding a HLA-antigen complex. In some embodiments, the plurality of cells are a plurality of yeast cells. In some embodiments, the plurality of yeast cells are a plurality of cells of the of the EBY100 strain of Saccharomyces cerevisiae.
[0116] Nucleic acids encoding one or more components of the HLA-antigen polypeptide complexes can be delivered to the plurality of cells with a nucleic acid or a vector, such as an exogenous nucleic acid or exogenous vector. Suitable exogenous nucleic acids and exogenous vectors include plasmids, bacterial artificial chromosomes (BACs), yeast artificial chromosomes (YACs), transposons, and viral vectors. These exogenous nucleic acids and exogenous vectors can further comprise components that allow for replication of the nucleic acids encoding one or more components of the HLA-antigen polypeptide complexes, permit antibiotic selection to allow for section of cells or other organisms expressing the nucleic acids encoding one or more components of the HLA-antigen polypeptide complexes, genes that complement yeast autotrophies to select for yeast transformants expressing the nucleic acids encoding one or more components of the HLA-antigen polypeptide complexes, promoters or enhancers for prokaryotic or eukaryotic expression of the HLA-antigen polypeptide complexes, polyadenylation sites, or marker genes that allow for visualization of transformed cells. In some embodiments, the nucleic acids that comprise a nucleic acid encoding the HLA-antigen polypeptide complexes of the current disclosure comprise an inducible promoter.
[0117] Methods of using the HLA-antigen polypeptide complexes and nucleic acids encoding such complexes minimally comprise contacting one or more cells, such as a plurality of cells, expressing the HLA antigen polypeptide complexes with a TCR and selecting for one or more cells that interact with the TCR. Selection can be performed, for example, by using the TCR in a “panning step” to capture the one or more cells expressing HLA-antigen polypeptide complexes that interact with the TCR, and washing away any non-interacting cells, such as one or more cells that do not express the HLA-antigen polypeptide complexes that do not interact with the TCR. Nucleic acids from interacting cells can be harvested and sequenced to elucidate the amino acid sequences of the randomized antigen polypeptide that interacted with the TCR. These nucleic acids can be re-transfected, transformed, or transduced into one or more different cells for another round of selection. This method can be iterated for any number of rounds of selection, such as 1, 2, 3, 4, 5, or more times (e.g., in cycles) to enrich for HLA-antigen polypeptide complexes that strongly interact with the TCR.
[0118] Sequencing platforms that can be used in the present disclosure include, but are not limited to: pyrosequencing, sequencing-by-synthesis, single-molecule sequencing, second-generation sequencing, nanopore sequencing, sequencing by ligation, or sequencing by hybridization. Preferred sequencing platforms are those commercially available from Illumina (RNA-Seq) and Helicos (Digital Gene Expression or “DGE”). “Next generation” sequencing methods include, but are not limited to those commercialized by: 1) 454/Roche Lifesciences including but not limited to the methods and apparatus described in Margulies 2005 and in U.S. Pat. Nos. 7,244,559; 7,335,762; 7,211,390; 7,244,567; 7,264,929; and 7,323,305; 2) Helicos Biosciences Corporation (Cambridge, Mass.) as described in U.S. Pat. Nos. 7,501,245; 7,491,498; and 7,276,720; and in U.S. Patent Publ. Nos. 2006/0024711; 2009/0061439; 2008/0087826; 2006/0286566; 2006/0024711; 2006/0024678; 2008/0213770; and 2008/0103058; 3) Applied Biosystems (e.g. SOLiD sequencing); 4) Dover Systems (e.g., Polonator G.007 sequencing); 5) Illumina as described U.S. Pat. Nos. 5,750,341; 6,306,597; and 5,969,119; and 6) Pacific Biosciences as described in U.S. Pat. Nos. 7,462,452; 7,476,504; 7,405,281; 7,170,050; 7,462,468; 7,476,503; 7,315,019; 7,302,146; and 7,313,308; and in US Patent Publ. Nos. 2009/0029385; 2009/0068655; 2009/0024331; and 2008/0206764.
Methods
[0119] Described herein are methods of using the HLA-antigen polypeptide complexes of the present disclosure to select or enrich for antigens that bind to a TCR, such as a specific TCR. In some embodiments, the method includes selecting an antigen comprising contacting one or more cells, such as a plurality of cells, expressing at the HLA antigen polypeptide complexes with a TCR using one or more transgenic HLA-antigen polypeptide cell libraries, such as a transgenic HLA-antigen polypeptide yeast cell libraries. The methods described herein include methods for constructing one or more transgenic HLA-antigen polypeptide yeast cell libraries.
[0120] After construction of the one or more transgenic HLA-antigen polypeptide yeast cell libraries, the methods further include validating one or more transgenic HLA-antigen polypeptide yeast cell libraries using limiting dilution methods which include limited dilution of one or more cultures of proliferating yeast cells that each express at least one of the HLA-antigen polypeptides with nutrient-deficient yeast media. In some embodiments, the methods further include counting yeast from diluted yeast cultures and estimating HLA-antigen polypeptide yeast cell libraries with diversities of at least about 10.sup.6, 10.sup.7, 10.sup.8, or 10.sup.9 unique HLA-antigen polypeptide sequences (e.g., clones). In some embodiments, expression of an epitope tag by a yeast cell is measured to determine if any of the 10.sup.6, 10.sup.7, 10.sup.8, or 10.sup.9 clones are displayed on a yeast cell surface. For example, expression of the epitope tag can be determined as a surrogate value for total HLA-antigen polypeptide expression in the plurality of yeast cells and percent expression can be calculated. In some embodiments, the percent expression is an estimate of a number of yeast cells expressing a certain HLA-antigen polypeptide relative to the HLA-antigen polypeptide sequence library.
[0121] Referring to
[0122] In some embodiments, greater than at least 1×10.sup.4, at least 1×10.sup.5, at least 1×10.sup.6, at least 1×10.sup.7, at least 1×10.sup.8, at least 1×10.sup.9, at least 1×10.sup.10, at least 1×10.sup.11, at least 1×10.sup.12, at least 1×10.sup.13, at least 1×10.sup.14, or at least 1×10.sup.15 different HLA-antigen polypeptide complexes are screened with methods of the present disclosure, such as those illustrated in
[0123] Expression of naive yeast libraries, such as the HLA-antigen polypeptide sequence libraries described herein, minimally express at about 15% of total antigen polypeptide sequences in an antigen polypeptide sequence library for a single length 9mer peptide presented by HLA-A1 (Gee 2018b) and less than about 5% of a single length peptide (e.g., 8mer) expression in an antigen polypeptide sequence library having mixed length peptides (e.g., 8mer, 9mer, 10 mer, 11 mer, 12mer) presented by HLA-A2 (Gee 2018a). Despite less than about 5% single length expression of the antigen polypeptide sequence library having 8mer length peptides, TCRs isolated target 8mer antigens from the antigen polypeptide sequence library that stimulated the TCR in an in vitro co-culture assay (Gee 2018a). These antigen polypeptide sequence libraries have been screened and isolate peptides against TCRs of known specificity (Gee 2018a). While a minimum level of expression necessary for a functional library has not yet been determined, data shows that less than 15% expression can result in an antigen polypeptide sequence library useful with the methods described herein.
[0124] In some embodiments, methods of the present disclosure further include identifying a polypeptide antigen that interact with a TCR. For example, a method for determining TCR interacting polypeptide antigens can comprise any of the following steps: [0125] 1. Generation and HLA-antigen polypeptide complex construct design: In some embodiments, step (1) includes, but is not limited to, generating one or more DNA constructs and/or designs to display one or more HLA polypeptides with a naturally occurring protein sequence, a synthetic protein sequences, or a combination thereof. [0126] 2. Test expression of the HLA-antigen polypeptide complex construct via yeast expression: In some embodiments, step (2) includes, but is not limited to, transforming one or more electro- or chemically competent yeast with a plasmid encoding a single peptide or library of peptides including the HLA of interest, such as the HLA polypeptide. The plasmid is designed for the single peptide construct or library of peptides constructs to display from the N-terminus of Aga2, a yeast protein. In some embodiments, expression confirmation can include antibody staining of an epitope tag (e.g., V5, VSVg, c-Myc, HA) or fluorescent TCR tetramer, dimer, or dextramer staining of yeast displaying a single peptide-HLA construct or library of peptide-HLA constructs. [0127] 3. Optional validation step for HLA display: In some embodiments, step (3) includes, but is not limited to, antibody-based staining of the epitope tag or fluorescent TCR tetramer, dimer, or dextramer staining of yeast displaying a single peptide-HLA construct or library of peptide-HLA constructs of step (2). In some embodiments, validation can also include staining a peptide-HLA construct with a TCR of known specificity or for selecting a diverse peptide library presented by the HLA. [0128] 4. Optional step to re-engineer the HLA for display: In some embodiments, step (4) includes, but is not limited to, random mutagenesis via an error-prone polymerase followed by electroporation into chemically and/or electro-competent yeast. Yeast cells expressing the library and/or libraries of the present technology are selected with cell separation by magnetic cell sorting (MACS) or fluorescence-activated cell sorting (FACS) based on a TCR of interest. In some embodiments, isolated yeast clones are sequenced or deep-sequenced to identify any functional HLA mutants that properly display antigenic peptides of interest. Step (4) is included in some embodiments if the construct or library is improperly displayed. [0129] 5. Generation of the peptide-HLA library: In some embodiments, step (5) includes, but is not limited to, randomized encoded peptide ligands or explicitly encoded peptide ligands. For example, the randomized encoded peptide ligands or explicitly encoded peptide ligands are uniquely designed for each HLA allele based on a preference for which peptides each HLA allele can present. In some embodiments, step (5) also includes generating genetic material from one or more polymerase-chain reactions. [0130] 6. Selection of the peptide-HLA library with a TCR of interest: In some embodiments, step (6) includes, but is not limited to, iterative MACS-based or FACS-based selection. For example, the TCR of interest, or other macromolecule having one or more antigen binding domains, acts as bait and can be multimerized on magnetic beads, streptavidin, dextran, or other substrates suitable for multimerization. In some embodiments, output from one or more selection rounds includes physically isolating one or more yeast cells with the TCR. Following isolation, the yeast are propagated and re-induced for protein expression. These iterative rounds enrich for binding yeast populations. [0131] 7. Deep-sequencing and data analysis: This process can involve extracting the genetic information of the yeast library and selection, and sequencing the products to identify the nature of peptides from the selected library. These data can then be analyzed to identify potential targets of TCRs and/or fed into algorithms to make predictions about TCR specificity.
T Cell Receptors (TCRs)
[0132] The transgenic HLA-antigen polypeptide cell libraries and antigens of the HLA-antigen polypeptide complexes described herein can be used in conjunction with a given TCR. For example, the TCR, or other macromolecule having one or more antigen binding domains, is a positive selector or bait and once bound to an antigen (e.g., HLA-antigen polypeptide complex), identifies its cognate antigen. The TCRs described herein can be native or exogenous (e.g., recombinant) and expressed by a cell, such as a primary T cell, an immortalized T cell, or a non-T cell. In some embodiments, the TCR is immobilized on a solid support such as a column, a polystyrene plate or well of a multi-well plate, or a bead. In some embodiments, the TCR is multimerized as a plurality of TCRs immobilized on a bead. For example, the TCR can be multimerized on but not limited to magnetic beads, streptavidin, or dextran.
[0133] In some embodiments, the TCR is a soluble protein comprising at least one or more binding domains of a TCR of interest, e.g. TCRα/β, TCRγ/δ. The soluble protein may be a single chain, or a heterodimer. In some embodiments, the soluble TCR is modified by the addition of a biotin acceptor peptide sequence at the C terminus of one polypeptide. After biotinylation at the acceptor peptide, the TCR can be multimerized or added to substrate by binding to biotin binding partner, e.g. avidin, streptavidin, traptavidin, neutravidin, etc. In some embodiments, the biotin binding partner can comprise a detectable label, e.g. a fluorophore, mass label, etc., or can be bound to a particle, e.g. a paramagnetic particle. Selection of ligands bound to the TCR can be performed by flow cytometry, magnetic selection, and the like as known in the art.
[0134] To the extent the foregoing materials and/or any other materials incorporated herein by reference conflict with the present disclosure, the present disclosure controls.
[0135] The following examples provide further representative embodiments of the presently disclosed technology.
EXAMPLES
[0136] The following examples are provided to further illustrate embodiments of the present technology and are not to be interpreted as limiting the scope of the present technology. To the extent that certain embodiments or features thereof are mentioned, it is merely for purposes of illustration and, unless otherwise specified, is not intended to limit the present technology. One skilled in the art may develop equivalent means without the exercise of inventive capacity and without departing from the scope of the present technology. It will be understood that many variations can be made in the procedures herein described while remaining within the bounds of the present technology. Such variations are intended to be included within the scope of the presently disclosed technology. As such, embodiments of the presently disclosed technology are described in the following representative examples.
Example 1: Design of an Antigen Polypeptide Library
[0137] This example describes design of the antigen libraries of the present disclosure for use with a polypeptide antigen HLA complex. An exemplary algorithm to design and select anchor residues for each HLA allele is as follows, using data of known HLA binding epitopes ligands from a website such as www.IEDB.org/:
[0138] Step 1: download list of polypeptides that bind to a given allele which may comprise several hundred peptides or several thousand peptides.
[0139] Step 2: construct a frequency matrix of residues per position of the peptide based upon the downloaded known peptides.
[0140] Step 3: select composition of “anchors” for library design by using a cutoff of the top 4 residues at each position.
Example 2: Electroporation of pHLA Library
[0141] This example describes electroporating yeast cells with nucleic acids encoding an exemplary antigen library of the present disclosure having all HLA allotypes and using peptides of 8-11 amino acids in length (8mer-11 mer). In this example, yeast cells were electroporated with nucleic acids encoding the antigen library of HLA-antigen polypeptide complexes (pHLA library).
[0142] The electroporation methods for expression of pHLA on yeast are as follows:
[0143] Day 0: [0144] 1. Autoclave three 2.5 L baffled flasks and one 250 ml baffled flask for expanding proliferating yeast cultures. [0145] 2. Prepare Yeast Peptone Dextrose media (YPD), which includes bacto peptone, glucose, and yeast extract. [0146] 3. Prepare two 5 ml EBY100 yeast cultures and shake at 30° C. overnight. [0147] 4. Prepare pYAL_3T plasmid (10 μg) restriction enzyme digested with HindIII, NheI or NheI, and BamHI and insert containing libraries of SEQ ID NO: 210 to 411 (50 μg). pYAL_3T vector (SEQ ID NO: 485) is a derivative of pCT vector (SEQ ID NO: 486; Invitrogen), Table 8, and the maps are provided in
TABLE-US-00008 TABLE 8 Nucleotide sequences of pYAL_3T and pCT vectors SEQ ID NO: Nucleotide Sequence 485 acggattagaagccgccgagcgggtgacagccctccgaaggaagactctcctccgtgcgt cctcgtcttcaccggtcgcgttcctgaaacgcagatgtgcctcgcgccgcactgctccga acaataaagattctacaatactagcttttatggttatgaagaggaaaaattggcagtaac ctggccccacaaaccttcaaatgaacgaatcaaattaacaaccataggatgataatgcga ttagttttttagccttatttctggggtaattaatcagcgaagcgatgatttttgatctat taacagatatataaatgcaaaaactgcataaccactttaactaatactttcaacattttc ggtttgtattacttcttattcaaatgtaataaaagtatcaacaaaaaattgttaatatac ctctatactttaacgtcaaggagaaaaaaccccggatcggactactagcagctgtaatac gactcactatagggaatattaagctaattctacttcatacattttcaattaagatgcagt tacttcgctgtttttcaatattttctgttattgctagcgttttggctggtggaggaggtt ctggaggtggtggtagtggtggtggtggttccatacaaagaactccaaagatccaagttt acagtagacatcctgctgaaaacggtaaatctaatttcttgaactgttacgtctccggtt tccacccaagtgatatagaagttgacttgttgaaaaatggtgaaagaatcgaaaaggttg aacattcagatttgtctttttctaaggactggtccttctatttgttgtactacacagaat tcactccaactgaaaaggatgaatacgcttgcagagttaatcatgtaaccttgtctcaac ctaaaatcgttaagtgggatagagacatgggtggaggtggaagtggaggtggcggttcag gtggtggcggttccggtggaggtggatccgaacaaaagcttatctccgaagaagacttgg gtggtggtggatctggtggtggtggttctggtggtggtggttctcaggaactgacaacta tatgcgagcaaatcccctcaccaactttagaatcgacgccgtactctttgtcaacgacta ctattttggccaacgggaaggcaatgcaaggagtttttgaatattacaaatcagtaacgt ttgtcagtaattgcggttctcacccctcaacaactagcaaaggcagccccataaacacac agtatgttttttgagtttaaacccgctgatctgataacaacagtgtagatgtaacaaaat cgactttgttcccactgtacttttagctcgtacaaaatacaatatacttttcatttctcc gtaaacaacatgttttcccatgtaatatccttttctatttttcgttccgttaccaacttt acacatactttatatagctattcacttctatacactaaaaaactaagacaattttaattt tgctgcctgccatatttcaatttgttataaattcctataatttatcctattagtagctaa aaaaagatgaatgtgaatcgaatcctaagagaattgggcaagtgcacaaacaatacttaa ataaatactactcagtaataacctatttcttagcatttttgacgaaatttgctattttgt tagagtcttttacaccatttgtctccacacctccgcttacatcaacaccaataacgccat ttaatctaagcgcatcaccaacattttctggcgtcagtccaccagctaacataaaatgta agctctcggggctctcttgccttccaacccagtcagaaatcgagttccaatccaaaagtt cacctgtcccacctgcttctgaatcaaacaagggaataaacgaatgaggtttctgtgaag ctgcactgagtagtatgttgcagtcttttggaaatacgagtcttttaataactggcaaac cgaggaactcttggtattcttgccacgactcatctccgtgcagttggacgatatcaatgc cgtaatcattgaccagagccaaaacatcctccttaggttgattacgaaacacgccaacca agtatttcggagtgcctgaactatttttatatgcttttacaagacttgaaattttccttg caataaccgggtcaattgttctctttctattgggcacacatataatacccagcaagtcag catcggaatctagagcacattctgcggcctctgtgctctgcaagccgcaaactttcacca atggaccagaactacctgtgaaattaataacagacatactccaagctgcctttgtgtgct taatcacgtatactcacgtgctcaatagtcaccaatgccctccctcttggccctctcctt ttcttttttcgaccgaatttcttgaagacgaaagggcctcgtgatacgcctatttttata ggttaatgtcatgataataatggtttcttaggacggatcgcttgcctgtaacttacacgc gcctcgtatcttttaatgatggaataatttgggaatttactctgtgtttatttattttta tgttttgtatttggattttagaaagtaaataaagaaggtagaagagttacggaatgaaga aaaaaaaataaacaaaggtttaaaaaatttcaacaaaaagcgtactttacatatatattt attagacaagaaaagcagattaaatagatatacattcgattaacgataagtaaaatgtaa aatcacaggattttcgtgtgtggtcttctacacagacaagatgaaacaattcggcattaa tacctgagagcaggaagagcaagataaaaggtagtatttgttggcgatccccctagagtc ttttacatcttcggaaaacaaaaactattttttctttaatttctttttttactttctatt tttaatttatatatttatattaaaaaatttaaattataattatttttatagcacgtgatg aaaaggacccaggtggcacttttcggggaaatgtgcgcggaacccctatttgtttatttt tctaaatacattcaaatatgtatccgctcatgagacaataaccctgataaatgcttcaat aatattgaaaaaggaagagtatgagtattcaacatttccgtgtcgcccttattccdtttt tgcggcattttgccttcctgtttttgctcacccagaaacgctggtgaaagtaaaagatgc tgaagatcagttgggtgcacgagtgggttacatcgaactggatctcaacagcggtaagat ccttgagagttttcgccccgaagaacgttttccaatgatgagcacttttaaagttctgct atgtggcgcggtattatcccgtgttgacgccgggcaagagcaactcggtcgccgcataca ctattctcagaatgacttggttgagtactcaccagtcacagaaaagcatcttacggatgg catgacagtaagagaattatgcagtgctgccataaccatgagtgataacactgcggccaa cttacttctgacaacgatcggaggaccgaaggagctaaccgcttttttgcacaacatggg ggatcatgtaactcgccttgatcgttgggaaccggagctgaatgaagccataccaaacga cgagcgtgacaccacgatgcctgtagcaatggcaacaacgttgcgcaaactattaactgg cgaactacttactctagcttcccggcaacaattaatagactggatggaggcggataaagt tgcaggaccacttctgcgctcggcccttccggctggctggtttattgctgataaatctgg agccggtgagcgtgggtctcgcggtatcattgcagcactggggccagatggtaagccctc ccgtatcgtagttatctacacgacgggcagtcaggcaactatggatgaacgaaatagaca gatcgctgagataggtgcctcactgattaagcattggtaactgtcagaccaagtttactc atatatactttagattgatttaaaacttcatttttaatttaaaaggatctaggtgaagat cctttttgataatctcatgaccaaaatcccttaacgtgagttttcgttccactgagcgtc agaccccgtagaaaagatcaaaggatcttcttgagatcctttttttctgcgcgtaatctg ctgcttgcaaacaaaaaaaccaccgctaccagcggtggtttgtttgccggatcaagagct accaactctttttccgaaggtaactggcttcagcagagcgcagataccaaatactgtcct tctagtgtagccgtagttaggccaccacttcaagaactctgtagcaccgcctacatacct cgctctgctaatcctgttaccagtggctgctgccagtggcgataagtcgtgtcttaccgg gttggactcaagacgatagttaccggataaggcgcagcggtcgggctgaacggggggttc gtgcacacagcccagcttggagcgaacgacctacaccgaactgagatacctacagcgtga gcattgagaaagcgccacgcttcccgaagggagaaaggcggacaggtatccggtaagcgg cagggtcggaacaggagagcgcacgagggagcttccaggggggaacgcctggtatcttta tagtcctgtcgggtttcgccacctctgacttgagcgtcgatttttgtgatgctcgtcagg ggggccgagcctatggaaaaacgccagcaacgcggcctttttacggttcctggccttttg ctggccttttgctcacatgttctttcctgcgttatcccctgattctgtggataaccgtat taccgcctttgagtgagctgataccgctcgccgcagccgaacgaccgagcgcagcgagtc agtgagcgaggaagcggaagagcgcccaatacgcaaaccgcctctccccgcgcgttggcc gattcattaatgcagctggcacgacaggtttcccgactggaaagcgggcagtgagcgcaa cgcaattaatgtgagttacctcactcattaggcaccccaggctttacactttatgcttcc ggctcctatgttgtgtggaattgtgagcggataacaatttcacacaggaaacagctatga ccatgattacgccaagctcggaattaaccctcactaaagggaacaaaagctggctagt 486 acggattagaagccgccgagcgggtgacagccctccgaaggaagactctcctccgtgcgt cctcgtcttcaccggtcgcgttcctgaaacgcagatgtgcctcgcgccgcactgctccga acaataaagattctacaatactagcttttatggttatgaagaggaaaaattggcagtaac ctggccccacaaaccttcaaatgaacgaatcaaattaacaaccataggatgataatgcga ttagttttttagccttatttctggggtaattaatcagcgaagcgatgatttttgatctat taacagatatataaatgcaaaaactgcataaccactttaactaatactttcaacattttc ggtttgtattacttcttattcaaatgtaataaaagtatcaacaaaaaattgttaatatac ctctatactttaacgtcaaggagaaaaaaccccggatcggactactagcagctgtaatac gactcactatagggaatattaagctaattctacttcatacattttcaattaagatgcagt tacttcgctgtttttcaatattttctgttattgcttcagttttagcacaggaactgacaa ctatatgcgagcaaatcccctcaccaactttagaatcgacgccgtactctttgtcaacga ctactattttggccaacgggaaggcaatgcaaggagtttttgaatattacaaatcagtaa cgtttgtcagtaattgcggttctcacccctcaacaactagcaaaggcagccccataaaca cacagtatgtttttaagcttctgcaggctagtggtggtggtggttctggtggtggtggtt ctggtggtggtggttctgctagcatgactggtggacagcaaatgggtcgggatctgtacg acgatgacgataaggtaccaggatccagtgtggtggaattctgcagatatccagcacagt ggcggccgctcgagtctagagggcccttcgaaggtaagcctatccctaaccctctcctcg gtctcgattctacgcgtaccggtcatcatcaccatcaccattgagtttaaacccgctgat ctgataacaacagtgtagatgtaacaaaatcgactttgttcccactgtacttttagctcg tacaaaatacaatatacttttcatttctccgtaaacaacatgttttcccatgtaatatcc ttttctatttttcgttccgttaccaactttacacatactttatatagctattcacttcta tacactaaaaaactaagacaattttaattttgctgcctgccatatttcaatttgttataa attcctataatttatcctattagtagctaaaaaaagatgaatgtgaatcgaatcctaaga gaattgggcaagtgcacaaacaatacttaaataaatactactcagtaataacctatttct tagcatttttgacgaaatttgctattttgttagagtcttttacaccatttgtctccacac ctccgcttacatcaacaccaataacgccatttaatctaagcgcatcaccaacattttctg gcgtcagtccaccagctaacataaaatgtaagctctcggggctctcttgccttccaaccc agtcagaaatcgagttccaatccaaaagttcacctgtcccacctgcttctgaatcaaaca agggaataaacgaatgaggtttctgtgaagctgcactgagtagtatgttgcagtcttttg gaaatacgagtcttttaataactggcaaaccgaggaactcttggtattcttgccacgact catctccgtgcagttggacgatatcaatgccgtaatcattgaccagagccaaaacatcct ccttaggttgattacgaaacacgccaaccaagtatttcggagtgcctgaactatttttat atgcttttacaagacttgaaattttccttgcaataaccgggtcaattgttctctttctat tgggcacacatataatacccagcaagtcagcatcggaatctagagcacattctgcggcct ctgtgctctgcaagccgcaaactttcaccaatggaccagaactacctgtgaaattaataa cagacatactccaagctgcctttgtgtgcttaatcacgtatactcacgtgctcaatagtc accaatgccctccctcttggccctctccttttcttttttcgaccgaatttcttgaagacg aaagggcctcgtgatacgcctatttttataggttaatgtcatgataataatggtttctta ggacggatcgcttgcctgtaacttacacgcgcctcgtatcttttaatgatggaataattt gggaatttactctgtgtttatttatttttatgttttgtatttggattttagaaagtaaat aaagaaggtagaagagttacggaatgaagaaaaaaaaataaacaaaggtttaaaaaattt caacaaaaagcgtactttacatatatatttattagacaagaaaagcagattaaatagata tacattcgattaacgataagtaaaatgtaaaatcacaggattttcgtgtgtggtcttcta cacagacaagatgaaacaattcggcattaatacctgagagcaggaagagcaagataaaag gtagtatttgttggcgatccccctagagtcttttacatcttcggaaaacaaaaactattt tttctttaatttctttttttactttctatttttaatttatatatttatattaaaaaattt aaattataattatttttatagcacgtgatgaaaaggacccaggtggcacttttcggggaa atgtgcgcggaacccctatttgtttatttttctaaatacattcaaatatgtatccgctca tgagacaataaccctgataaatgcttcaataatattgaaaaaggaagagtatgagtattc aacatttccgtgtcgcccttattcccttttttgcggcattttgccttcctgtttttgctc acccagaaacgctggtgaaagtaaaagatgctgaagatcagttgggtgcacgagtgggtt acatcgaactggatctcaacagcggtaagatccttgagagttttcgccccgaagaacgtt ttccaatgatgagcacttttaaagttctgctatgtggcgcggtattatcccgtgttgacg ccgggcaagagcaactcggtcgccgcatacactattctcagaatgacttggttgagtact caccagtcacagaaaagcatcttacggatggcatgacagtaagagaattatgcagtgctg ccataaccatgagtgataacactgcggccaacttacttctgacaacgatcggaggaccga aggagctaaccgcttttttgcacaacatgggggatcatgtaactcgccttgatcgttggg aaccggagctgaatgaagccataccaaacgacgagcgtgacaccacgatgcctgtagcaa tggcaacaacgttgcgcaaactattaactggcgaactacttactctagcttcccggcaac aattaatagactggatggaggcggataaagttgcaggaccacttctgcgctcggcccttc cggctggctggtttattgctgataaatctggagccggtgagcgtgggtctcgcggtatca ttgcagcactggggccagatggtaagccctcccgtatcgtagttatctacacgacgggca gtcaggcaactatggatgaacgaaatagacagatcgctgagataggtgcctcactgatta agcattggtaactgtcagaccaagtttactcatatatactttagattgatttaaaacttc atttttaatttaaaaggatctaggtgaagatcctttttgataatctcatgaccaaaatcc cttaacgtgagttttcgttccactgagcgtcagaccccgtagaaaagatcaaaggatctt cttgagatcctttttttctgcgcgtaatctgctgcttgcaaacaaaaaaaccaccgctac cagcggtggtttgtttgccggatcaagagctaccaactctttttccgaaggtaactggct tcagcagagcgcagataccaaatactgtccttctagtgtagccgtagttaggccaccact tcaagaactctgtagcaccgcctacatacctcgctctgctaatcctgttaccagtggctg ctgccagtggcgataagtcgtgtcttaccgggttggactcaagacgatagttaccggata aggcgcagcggtcgggctgaacggggggttcgtgcacacagcccagcttggagcgaacga cctacaccgaactgagatacctacagcgtgagcattgagaaagcgccacgcttcccgaag ggagaaaggcggacaggtatccggtaagcggcagggtcggaacaggagagcgcacgaggg agcttccaggggggaacgcctggtatctttatagtcctgtcgggtttcgccacctctgac ttgagcgtcgatttttgtgatgctcgtcaggggggccgagcctatggaaaaacgccagca acgcggcctttttacggttcctggccttttgctggccttttgctcacatgttctttcctg cgttatcccctgattctgtggataaccgtattaccgcctttgagtgagctgataccgctc gccgcagccgaacgaccgagcgcagcgagtcagtgagcgaggaagcggaagagcgcccaa tacgcaaaccgcctctccccgcgcgttggccgattcattaatgcagctggcacgacaggt ttcccgactggaaagcgggcagtgagcgcaacgcaattaatgtgagttacctcactcatt aggcaccccaggctttacactttatgcttccggctcctatgttgtgtggaattgtgagcg gataacaatttcacacaggaaacagctatgaccatgattacgccaagctcggaattaacc ctcactaaagggaacaaaagctggctagt
TABLE-US-00009 TABLE 9 Features of pYAL_3T Vector Feature Nucleotide Position GAL1 promotor 5007-450 T7 473-494 Aga2 Leader 534-587 Aga2 588-794 Linker 813-858 CEN-ARS Prs 2289-2799 Ampr 3129-3788 Laco 4908-4930
TABLE-US-00010 TABLE 10 Features of pCT Vector Feature Position GAL1 promotor 5217-451 T7 475-494 Aga2 Leader 534-587 linker 588-632 hB2m 633-929 linker 930-989 epitope tag (cMyc) 990-1019 linker 1020-1064 Aga2 1065-1271 CEN-ARS pRS 2499-3009 AmpR 3339-3998 LacO 5118-5140
[0148] Day 1: Passage the two yeast cultures from Day 0 step 3 by adding 100 μl of each of the two yeast cultures to 5 ml of fresh YPD and shake at 30° C. overnight.
[0149] Day 2: [0150] 1. Measure optical density (OD) of overnight cultures from Day 1. [0151] 2. Prepare a new culture with 300 ml of an OD 0.3 yeast culture from step 1 using YPD in a 2.5 L baffled flask. [0152] 3. Prepare 3 ml of 1M Tris pH 8.0/1 M 1,4-dithiothreitol (DTT) [0153] 4. Prepare 15 ml of 2 M lithium acetate (LiAc)/10 mM Tris, 1 mM EDTA (TE) [0154] 5. Propagate culture to an OD of 1.6-2.0. [0155] 6. Add 3 ml of Tris/DTT. [0156] 7. Add 15 ml of 2 M LiAc/TE. [0157] 8. Propagate culture at 30° C. for 15 minutes while shaking at 225 rounds per minute (rpm). [0158] 9. Centrifuge culture at 3000×g for 3 minutes. [0159] 10. Resuspend the pellet in 50 mL cold E-buffer. [0160] 11. Centrifuge the suspension from step 10 at 3000×g for 3 min, at 4° C. [0161] 12. Repeat steps 10 and 11 twice. [0162] 13. Remove residual buffer. [0163] 14. Resuspend pellet in 600 μL E-buffer. [0164] 15. Add the 50 μg insert and 10 μg digested plasmid from step 4 of Day 0, total volume of buffer, insert, plasmid, and yeast should be about 1 mL. [0165] 16. Aliquot 150 μL of the suspension from step 15 into ice-chilled 2 mm gap electroporation cuvettes. [0166] 17. Electroporate each cuvette at 2.5 kV. The time constant should be between 3 and 4 ms.sup.1. [0167] 18. Add three 1 mL volumes of cold YPD, then bring the total volume up to 200 mL with YPD [0168] 19. Culture electroporated yeast at 30° C. at 225 rpm, for 1 hour in a 250 ml baffled flask. [0169] 20. Centrifuge culture at 3500×g for 3 minutes to form a yeast cell pellet, decant the supernatant, and re-suspend the yeast cell pellet in 10 mL of SDCAA (dextrose casamino acids, which also includes, yeast nitrogen base without amino acids and with ammonium sulfate, sodium citrate, and citric acid monohydrate, at a pH of 4.5).
[0170] Day 2: Determine Titer [0171] 1. Add 990 μL of SDCAA to each of four Eppendorf tubes. [0172] 2. Add 10 μL from step 20 above to one tube containing 990 μL SDCAA. [0173] 3. Pipet 100 μL of the 10.sup.4 solution into a tube containing only 990 μL of SDCAA. [0174] 4. Pipet 100 μL of the 10.sup.5 solution into a tube containing only 990 μL of SDCAA. [0175] 5. Pipet 100 μL of the 10.sup.6 solution into a tube containing only 990 μL of SDCAA. [0176] 6. Spread 100 μL of each dilution in steps 2-5 onto a separate SDCAA plates and incubate at 30° C. for 3 days. Count the colonies on the plates to determine the titer. From step 2, the colonies counted represent the diversity of the library x 10.sup.4. From step 3, the colonies counted represent the diversity of the library x 10.sup.5. From step 4, the colonies counted represent the diversity of the library x 10.sup.6. From step 5, the colonies counted represent the diversity of the library x 10.sup.7. [0177] 7. Add 490 ml of pH 4.5 SDCAA to the remaining cell suspension from step 20 and culture at 30° C. overnight.
[0178] Day 3: Measure the OD of the passage from step 8 after 24 hours. The OD should be at least 5. Passage the culture to an OD of 1 in a total volume of 500 mL SDCAA.
[0179] Day 4: Passage cells to an OD of 1 in a total volume of 500 mL SDCAA.
[0180] Day 5: 72 hours after step 18 from Day 2 was performed, induce in SGCAA (galactose casamino acids, which also includes, yeast nitrogen base without amino acids and with ammonium sulfate, sodium citrate, and citric acid monohydrate, at a pH of 4.5).
[0181] Recipes: [0182] 1) E-buffer, 500 ml [0183] 0.6 g Tris base, [0184] 91.09 g Sorbitol (1M) [0185] 73.50 mg CaCl2 (1 mM; consider making 1M stock solution) in ddH2O to a final volume of 500 ml, pH to 7.5. Filter through 0.22 μm membrane. [0186] 2) 1 M Tris/1 M DTT, 3 ml [0187] 0.462 g 1,4-dithiothreitol in 3 ml 1 M Tris, pH 8.0 and sterilize by filtration. [0188] 3) 2 M LiAc/TE solution, 15 ml [0189] 1.98 g LiAc in 10 ml of TE (10 mM Tris, 1 mM EDTA), sterilize by filtration.
Example 3: Characterization of pHLA Expression
[0190] This example describes characterizing expression of HLA-antigen polypeptide complexes on the electroporated yeast cells of Example 2. These expression measurements include FACS analysis to determine the levels of peptide-MHC displayed on the surface of yeast cells and indicate functionality of the random yeast display library. The characterization methods for expression of pHLA on yeast are as follows:
[0191] Materials [0192] 1. Yeast library from Example 2 [0193] 2. PBSM (1×PBS, 1 g/L bovine serum albumin, EDTA, pH 7.4; filtered) [0194] 3. Anti-myc (FITC fluorophore-conjugated) antibody [0195] 4. 96-well U-bottom plate
[0196] Optional: [0197] 5. Anti-VS (647 fluorophore-conjugated) antibody [0198] 6. Anti-HA (BV421 fluorophore-conjugated) antibody [0199] 7. Anti-VSV (PE fluorophore-conjugated) antibody
[0200] Cell Preparation [0201] 1. Measure optical density of yeast culture on NanoDrop. OD600 readings between 0 to 1 are in the liner range for cultures induced 2 to 3 days at 20° C. at a 1:20 culture:SDCAA dilution. [0202] 2. Transfer samples of yeast cultures into wells of a 96-well plate. For yeast cultures having an OD600 of about 10, use 254, of the culture. Include single-color and unstained controls. [0203] 3. Add PBSM to 200 μl final volume to each well. [0204] 4. Centrifuge the 96-well plate at 2500×g for 2 minutes. [0205] 5. Remove supernatants.
[0206] Staining Cells [0207] 1. Re-suspend each cell pellet in 100 μl PBSM [0208] 2. Add 1 μl antibody as appropriate. 3. Incubate at 4° C., protected from light (e.g., dark) for 30 minutes.
[0209] Washing Cells and Determining pHLA Expression [0210] 1. Centrifuge the 96-well plate at 2500×g for 2 minutes. [0211] 2. Remove supernatants. [0212] 3. Re-suspend each pellet in 200 μl PB SM. [0213] 4. Centrifuge the 96-well plate at 2500×g for 2 minutes. [0214] 5. Remove supernatants. [0215] 6. Re-suspend each pellet in 200 μl PB SM. [0216] 7. Analyze samples in each well with CytoFlex.
[0217] Results: Expression of the HLA-antigen polypeptide complexes (peptides of SEQ ID Nos: 8, 11, 14, 18, 21+24, 28, 32, 36, 40-44, 47, 50, 53, 56, 65, 75, 69, 77+80, 89, 95, 99, 102+106, 108, 111+114, 117+120, 124, and 125) was determined by flow cytometry and shown in
Example 4: Functional Validation of pHLA Expression
[0218] This example describes functionally validating expression of pHLAs on the electroporated yeast cells of Example 2 with a candidate TCR. Expected target antigens of the pHLAs can be identified from up to 6 libraries when the candidate TCR is allotype-matched. The functional validation methods for expression of pHLA on yeast are as follows:
[0219] HLA-antigen polypeptide sequence libraries, such as those disclosed herein, minimally express about 25% of total antigen polypeptide sequences for a single length 9mer peptide presented by HLA-A1 (Gee 2018b) and express less than about 5% of a single length peptide (e.g., 8mer) having mixed length peptides (e.g., 8mer, 9mer, 10 mer, 11 mer) presented by HLA-A2 (Gee 2018a). Despite less than about 5% single length peptide expression of the HLA-antigen polypeptide sequence having 8mer length peptides, isolated TCRs of interest target 8mer antigens from the HLA-antigen polypeptide complexes. These isolated TCR of interest were stimulated by one or more HLA-antigen polypeptide complexes in an in vitro co-culture assay (Gee 2018a; see
[0220] While preferred embodiments of the present invention have been shown and described herein, it will be obvious to those skilled in the art that such embodiments are provided by way of example only. Numerous variations, changes, and substitutions will now occur to those skilled in the art without departing from the invention. It should be understood that various alternatives to the embodiments of the invention described herein may be employed in practicing the invention.
[0221] All publications, patent applications, issued patents, and other documents referred to in this specification are herein incorporated by reference as if each individual publication, patent application, issued patent, or other document was specifically and individually indicated to be incorporated by reference in its entirety. Definitions that are contained in text incorporated by reference are excluded to the extent that they contradict definitions in this disclosure.
REFERENCES
[0222] Altschul et al. “Basic local alignment search tool.” J Mol Biol 215(3):403-410 (1990) Altschul & Karlin. “Methods for assessing the statistical significance of molecular sequence features by using general scoring schemes.” Proc Natl Acad Sci USA 87(6):2264-2268 (1990) [0223] Altschul & Karlin. “Applications and statistics for multiple high-scoring segments in molecular sequences.” Proc Natl Acad Sci USA 90(12):5873-5877 (1993) [0224] Arden et al. “Human T-cell receptor variable gene segment families.” Immunogenetics 42(6):455-500 (1995) [0225] Bowie et al. “A method to identify protein sequences that fold into a known three-dimensional structure.” Science 253(5016):164-170 (1991) [0226] Brenner et al. “Population statistics of protein structures: lessons from structural classifications.” Curr Opin Struct Biol 7(3):369-376 (1997) [0227] Chou & Fasman. “Prediction of protein conformation.” Biochemistry 13(2):222-245 (1974a) [0228] Chou & Fasman. “Conformational parameters for amino acids in helical, beta-sheet, and random coil regions calculated from proteins.” Biochemistry 113(2):211-222 (1974b) [0229] Chou & Fasman. “Prediction of the secondary structure of proteins from their amino acid sequence.” Adv Enzymol Relat Areas Mol Biol 47:45-148 (1978a) [0230] Chou & Fasman. “Empirical predictions of protein conformation.” Annu Rev Biochem 47:251-276 (1978b) [0231] Chou & Fasman. “Prediction of beta-turns.” Biophys J 26:367-384 (1979) [0232] Gee et al. “Antigen identification for orphan T cell receptors expressed on tumor-infiltrating lymphocytes.” Cell 172(3):549-563 (2018a) [0233] Gee et al. “Facile method for screening clinical T cell receptors for off-target peptide-HLA reactivity.” bioRxiv 472480 (2018b) [0234] Gribskov et al. “Profile analysis: detection of distantly related proteins.” Proc Natl Acad Sci USA 84(13):4355-4358 (1987) [0235] Gribskov et al. Profile analysis.” Methods Enzymol 183:146-159 (1990) [0236] Holm & Sander. “Protein folds and families: sequence and structure alignments.” Nucleic Acids Res 27(1):244-247 (1999) [0237] Jones. “Progress in protein structure prediction.” Curr Opin Struct Biol 7(3):377-87 (1997) [0238] Jones et. al. “Engineering and Characterization of a Stabilized α1/α2 Module of the Class I Major Histocompatibility Complex Product L.” J. of Biol. Chem. 281(35):25734-25744 (2006) [0239] Kotsiou et al. “Properties and Applications of Single-Chain Major Histocompatibility Complex Class I Molecule.” Antioxid. Redox Signal. 15(3):645-655 (2011) [0240] Kyte & Doolittle. “A simple method for displaying the hydropathic character of a protein.” J Mol Biol 157(1):105-132 (1982) [0241] Mackelprang et al. “Sequence diversity, natural selection and linkage disequilibrium in the human T cell receptor alpha/delta locus.” Hum Genet 119(3):255-266 (2006) [0242] MacLennan et al. “Structure-function relationships in the Ca(2+)-binding and translocation domain of SERCA1: physiological correlates in Brody disease.” Acta Physiol Scand Suppl 643:55-67 (1998) [0243] Margulies et al. “Genome sequencing in microfabricated high-density picolitre reactors.” Nature 437(7057):376-380 (2005) [0244] Mottez et al. “Cells Expressing a Major Histocompatibility Complex Class I Molecule with a Single Covalently Bound Peptide Are Highly Immunogenic.” J. Exp. Med. 181: 493-502 (1995) [0245] Moult. “The current state of the art in protein structure prediction.” Curr Opin Biotechnol 7(4):422-427 (1996) [0246] Pandey et al. “Current strategies for protein production and purification enabling membrane protein structural biology.” Biochem Cell Biol. 94(6) 507-527 (2016) [0247] Rowen et al. “The complete 685-kilobase DNA sequence of the human beta T cell receptor locus.” Science 272(5269):1755-1762 (1996) [0248] Sasaki & Sutoh. “Structure-mutation analysis of the ATPase site of Dictyostelium discoideum myosin II.” Adv Biophys 35:1-24 (1998) [0249] Sippl & Flockner. “Threading thrills and threats.” Structure 4(1):15-19 (1996) [0250] Tafuro et al. “Reconstitution of Antigen Presentation in HLA Class I-Negative Cancer Cells with Peptide-β2m Fusion Molecules.” Eur. J. Immunol. 31: 440-449 (2001) [0251] White et al. “Soluble Class I MHC with β2-Microglobulin Covalently Linked Peptides: Specific Binding to a T Cell Hybridoma.” J. Immunol. 162: 2671-2676 (1999)