METHODS AND COMPOSITIONS FOR MODULATING IMMUNE RESPONSES AND LYMPHOCYTE ACTIVITY
20210263012 · 2021-08-26
Inventors
- Ana C. Anderson (Boston, MA, US)
- Vijay K. Kuchroo (Boston, MA, US)
- Meromit Singer (Cambridge, MA, US)
- Aviv Regev (Cambridge, MA)
Cpc classification
A61K35/17
HUMAN NECESSITIES
C12Q1/6809
CHEMISTRY; METALLURGY
C12Q1/6881
CHEMISTRY; METALLURGY
International classification
G01N33/50
PHYSICS
A61K35/17
HUMAN NECESSITIES
Abstract
The subject matter disclosed herein is generally directed to novel CD8+ and CD4+ T cell subtypes associated with effector, suppressive or regulatory T cell functions. Moreover, the subject matter disclosed herein is generally directed to methods and compositions for use of the subtype. Also, disclosed herein are gene signatures and markers associated with the subtype and use of said signatures and markers. Further disclosed are therapeutic methods of using said gene signatures and immune cell subtype. Further disclosed are pharmaceutical compositions comprising populations of CD4+ and/or CD8+ TILs or populations of immune cells depleted for a specific subtype. Further disclosed are interactions with other T cell subtypes.
Claims
1. An isolated CD8.sup.+ T cell characterized in that the CD8.sup.+ T cell comprises expression of a gene signature comprising one or more genes selected from the group consisting of any of tables 1 to 20.
2. The isolated CD8.sup.+ T cell according to claim 1, wherein the CD8.sup.+ T cell expresses PD-1 and TIM3; or wherein the CD8.sup.+ T cell expresses PD-1, TIM3, and KI67 and does not express Helios.
3. The isolated CD8.sup.+ T cell according to claim 2, wherein the CD8.sup.+ T cell expresses HMMR; or wherein the CD8.sup.+ T cell expresses a gene signature comprising one or more genes selected from Table 20.
4-5. (canceled)
6. The isolated CD8.sup.+ T cell according to claim 1, wherein the CD8.sup.+ T cell expresses PD-1 and does not express TIM3.
7. The isolated CD8.sup.+ T cell according to claim 6, wherein the CD8.sup.+ T cell expresses Helios (IKZF2).
8. The isolated CD8.sup.+ T cell according to claim 6, wherein the CD8.sup.+ T cell does not express MTI.
9. The isolated CD8.sup.+ T cell according to claim 6, wherein the CD8.sup.+ T cell expresses XCL1.
10. The isolated CD8.sup.+ T cell according to claim 6, wherein the CD8.sup.+ T cell expresses CCR8.
11. The isolated CD8.sup.+ T cell according to claim 6, wherein the CD8.sup.+ T cell expresses a gene signature comprising one or more genes selected from Table 19.
12. The isolated CD8.sup.+ T cell according to claim 6, wherein the CD8.sup.+ T cell expresses one or more genes selected from the group consisting of RAMP3, NRGN, SLC16A11, MYO1E, FOSB, IL18RAP, OLFR1033, IL2RA, BCL2A1B, CD83, FAM46A, CD74, ENPP2, LAD1, AI836003, DUSP4, ARL14EP, CD81, XDH, KIT, TNFRSF4, RORA, ST6GAL1, ATP2B2, CAPG and PLXDC2.
13. The isolated CD8.sup.+ T cell according to claim 1, wherein the CD8.sup.+ T cell is a human cell; and/or wherein the CD8.sup.+ T cell is a CAR T cell; and/or wherein the CD8.sup.+ T cell is a CD8.sup.+ T cell autologous for a subject suffering from cancer, and/or wherein the cell expresses an exogenous TCR; and/or wherein the CD8.sup.+ T cell displays tumor specificity.
14-17. (canceled)
18. The isolated CD8.sup.+ T cell according to claim 6, wherein the CD8.sup.+ T cell expresses an endogenous TCR or CAR specific for a low affinity antigen.
19. A method for detecting or quantifying CD8.sup.+ T cells in a biological sample of a subject, or for isolating CD8.sup.+ T cells from a biological sample of a subject, the method comprising detecting or quantifying in a biological sample of the subject CD8.sup.+ T cells as defined in claim 1, or isolating from the biological sample CD8.sup.+ T cells as defined in claim 1.
20. The method according to claim 19, wherein CD8.sup.+ T cells are detected, quantified or isolated using one or more markers selected from the group consisting of HMMR, PD-1, TIM3, KI67, Helios, MT1, XCL1 and CCR8.
21. The method according to claim 19, wherein the CD8.sup.+ T cells are detected, quantified or isolated using a technique comprising flow cytometry, mass cytometry, fluorescence activated cell sorting, fluorescence microscopy, affinity separation, magnetic cell separation, microfluidic separation, or combinations thereof, preferably, wherein the technique employs one or more agents capable of specifically binding to one or more gene products expressed or not expressed by the CD8.sup.+ T cells, preferably on the cell surface of the CD8.sup.+ T cells, more preferably, wherein the one or more agents are one or more antibodies.
22-23. (canceled)
24. The method according to claim 19, wherein the biological sample is a tumor sample obtained from a subject in need thereof and the CD8.sup.+ T cells are CD8.sup.+ tumor infiltrating lymphocytes (TIL); and/or wherein the biological sample comprises ex vivo or in vitro CD8.sup.+ T cells.
25. (canceled)
26. A population of CD8.sup.+ T cells comprising CD8.sup.+ T cells as defined in claim 1, preferably a pharmaceutical composition comprising the CD8.sup.+ T cell population.
27. (canceled)
28. A method for treating or preventing cancer comprising administering to a subject in need thereof the pharmaceutical composition according to claim 26.
29. A kit comprising reagents to detect at least one gene or polypeptide as defined in claim 1.
30. An isolated CD8.sup.+ T cell characterized in that the CD8.sup.+ T cell comprises expression of a gene signature comprising one or more genes selected from the group consisting of: a. GPR56, PDCD1, LAG3, HAVCR2, ENTPD1, 1700017B05RIK, CHN2, 2900026A02RIK, FGL2, SERPINA3H, OSBPL3, S100A4, CCL3, TNFRSF9, UBASH3B, CD244, RGS8, BCL2A1D, CCL4, CIAPIN1, GP49A, CCRL2, IRF8, GRINA, C1QTNF6, CD200R4, FILIP1, THEMIS2, SERPINA3F, LRRK1, ARNT2, MXI1, DAPK2, TWSG1, ADAM8, TRPS1, LAT2, SDCBP2, SLC37A2, MT2, ADAMTS14, GBP10, EPDR1 and DUT; or b. RGS16, GZMB, SERPINA3G, CXCR6, LITAF, SERPINA3I, TOX, PRF1, EHD1, LILRB4, PLEK, ITGAV, CREM, CDK6, NR4A2, UHRF2, GBP6, IRAK2, PTK2B, OXSR1 and ITGBlBP1; or c. TIGIT, DGAT1, PLAC8, BHLHE40, GM5069, SAMSN1, RGS1, DENND4A and SIK1.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
[0081]
[0082]
[0083]
[0084]
[0085]
[0086]
[0087]
[0088]
[0089]
[0090]
[0091]
[0092]
[0093]
[0094]
[0095]
[0096]
[0097]
[0098]
[0099]
[0100]
[0101]
[0102]
[0103]
[0104]
[0105]
[0106]
[0107]
[0108]
[0109]
[0110]
[0111]
[0112]
[0113]
[0114]
[0115]
[0116]
[0117]
[0118]
[0119]
[0120]
[0121]
[0122]
[0123]
DETAILED DESCRIPTION
[0124] Unless defined otherwise, technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure pertains. Definitions of common terms and techniques in molecular biology may be found in Molecular Cloning: A Laboratory Manual, 2.sup.nd edition (1989) (Sambrook, Fritsch, and Maniatis); Molecular Cloning: A Laboratory Manual, 4.sup.th edition (2012) (Green and Sambrook); Current Protocols in Molecular Biology (1987) (F. M. Ausubel et al. eds.); the series Methods in Enzymology (Academic Press, Inc.): PCR 2: A Practical Approach (1995) (M. J. MacPherson, B. D. Hames, and G. R. Taylor eds.): Antibodies, A Laboraotry Manual (1988) (Harlow and Lane, eds.): Antibodies A Laboraotry Manual, 2.sup.nd edition 2013 (E. A. Greenfield ed.); Animal Cell Culture (1987) (R. I. Freshney, ed.); Benjamin Lewin, Genes IX, published by Jones and Bartlet, 2008 (ISBN 0763752223); Kendrew et al. (eds.), The Encyclopedia of Molecular Biology, published by Blackwell Science Ltd., 1994 (ISBN 0632021829); Robert A. Meyers (ed.), Molecular Biology and Biotechnology: a Comprehensive Desk Reference, published by VCH Publishers, Inc., 1995 (ISBN 9780471185710); Singleton et al., Dictionary of Microbiology and Molecular Biology 2nd ed., J. Wiley & Sons (New York, N.Y. 1994), March, Advanced Organic Chemistry Reactions, Mechanisms and Structure 4th ed., John Wiley & Sons (New York, N.Y. 1992); and Marten H. Hofker and Jan van Deursen, Transgenic Mouse Methods and Protocols, 2.sup.nd edition (2011).
[0125] As used herein, the singular forms “a”, “an”, and “the” include both singular and plural referents unless the context clearly dictates otherwise.
[0126] The term “optional” or “optionally” means that the subsequent described event, circumstance or substituent may or may not occur, and that the description includes instances where the event or circumstance occurs and instances where it does not.
[0127] The recitation of numerical ranges by endpoints includes all numbers and fractions subsumed within the respective ranges, as well as the recited endpoints.
[0128] The terms “about” or “approximately” as used herein when referring to a measurable value such as a parameter, an amount, a temporal duration, and the like, are meant to encompass variations of and from the specified value, such as variations of +/−10% or less, preferably +/−5% or less, more preferably +/−1% or less, and still more preferably +/−0.1% or less of and from the specified value, insofar such variations are appropriate to perform in the disclosed invention. It is to be understood that the value to which the modifier “about” or “approximately” refers is itself also specifically, and preferably, disclosed.
[0129] Reference throughout this specification to “one embodiment”, “an embodiment” means that a particular feature, structure or characteristic described in connection with the embodiment is included in at least one embodiment of the present invention. Thus, appearances of the phrases “in one embodiment” or “in an embodiment” in various places throughout this specification are not necessarily all referring to the same embodiment, but may. Furthermore, the particular features, structures or characteristics may be combined in any suitable manner, as would be apparent to a person skilled in the art from this disclosure, in one or more embodiments. Furthermore, while some embodiments described herein include some but not other features included in other embodiments, combinations of features of different embodiments are meant to be within the scope of the invention, and form different embodiments, as would be understood by those in the art. For example, in the appended claims, any of the claimed embodiments can be used in any combination.
[0130] The terms “subject”, “individual” or “patient” are used interchangeably throughout this specification, and typically and preferably denote humans, but may also encompass reference to non-human animals, preferably warm-blooded animals, even more preferably mammals, such as, e.g., non-human primates, rodents, canines, felines, equines, ovines, porcines, and the like. The term “non-human animals” includes all vertebrates, e.g., mammals, such as non-human primates, (particularly higher primates), sheep, dog, rodent (e.g. mouse or rat), guinea pig, goat, pig, cat, rabbits, cows, and non-mammals such as chickens, amphibians, reptiles etc. In one embodiment, the subject is a non-human mammal. In another embodiment, the subject is human. In another embodiment, the subject is an experimental animal or animal substitute as a disease model. The term does not denote a particular age or sex. Thus, adult and newborn subjects, as well as fetuses, whether male or female, are intended to be covered. Examples of subjects include humans, dogs, cats, cows, goats, and mice. The term subject is further intended to include transgenic species.
[0131] The terms “subtype”, “subset” or “subpopulation” are used interchangeably throughout this specification.
[0132] All publications, published patent documents, and patent applications cited herein are hereby incorporated by reference to the same extent as though each individual publication, published patent document, or patent application was specifically and individually indicated as being incorporated by reference.
Overview
[0133] Embodiments disclosed herein relate to cell products, substances, compositions, markers, marker signatures, molecular targets, kits of parts and methods useful in characterizing, evaluating and modulating the immune system and immune responses. The CD8.sup.+ and CD4+ T cells of the present invention were discovered by analysis of single immune cells obtained at several time points from a mouse tumor model (B16). The transcriptomes of the CD8.sup.+ and CD4+ T cells were analyzed. In certain embodiments, T cells were characterized as a suppressive CD4+ or CD8.sup.+ T cell population required to dampen excessive immune responses and prevent autoimmunity (e.g., a subtype of CD8 Tregs). In certain embodiments, T cells were characterized as an effector CD4+ or CD8.sup.+ T cell population (e.g., activated). Applicants identified markers expressed by the CD8.sup.+ and CD4+ T cells that can be used to detect and/or quantitate the T cells or specifically target the T cells therapeutically. Furthermore, the surface cell markers can be used to detect, quantitate and isolate the T cells. The identified markers can also be used to distinguish between PD1+CD8.sup.+ T cell subtypes. In certain embodiments, the T cell is characterized by expression of PD-1 and TIM3. In certain embodiments, the T cell is characterized by expression of PD-1 and lack of expression of TIM3. Moreover, Applicants can confirm the presence of the CD8.sup.+ T cells in human samples.
[0134] In certain embodiments, a T cell is a suppressive T cell. In certain embodiments, the T cell is characterized by expression of CD8, TIM3, PD1, MT1, and IKZF2, and low or no expression of HMMR. The T cell may be further characterized by expression of one or more of TNFRSF9, PRF1, BHLHE40 (DEC1), IRF8, GLDC, STAT3, CST7, IL1R2, EEF2, SLC2A3, SQSTM1, RBPJ, NABP1, ACTN1, TNFRSF4, SERPINB9, FOSL2, CAPG, KLRC1, IL18R1, JUNB, EEF1A1, TNFRSF18, RGS2, NFKB2, RPL5, PEX16, LAT2, KDM5B, HILPDA, GEM, DENND4A, BCL2L11, ADAM8, PGLYRP1, KIT, SERPINE2, CCRL2, CSF1, EPAS1, RUNX2, SPRY2 and XCR1, preferably upregulated as compared to all CD8.sup.+ TIM3+PD1+ T cells in a population of cells.
[0135] In certain embodiments, a T cell is an activated T cell. In certain embodiments, the T cell is characterized by expression of PD-1 and TIM3. In certain embodiments, the T cell is characterized by expression of PD-1, TIM3 and HMMR. In certain embodiments, the CD8.sup.+ T cell expresses PD-1, TIM3, and KI67 and does not express Helios. In certain embodiments, the T cell may be characterized by expression of a gene signature comprising one or more genes selected from one of Table 20.
[0136] In certain embodiments, a T cell is primed to be an activated T cell. In certain embodiments, the T cell is characterized by expression of PD-1 and lack of expression of TIM3. In certain embodiments, the T cell is characterized by expression of Helios (IKZF2), XCL1 and/or CCR8. In certain embodiments, the T cell does not express MT1. In certain embodiments, the T cell may be characterized by expression of a gene signature comprising one or more genes selected from one of Table 19.
[0137] In certain embodiments, the T cell may be characterized by expression of a gene signature comprising any gene or combination of genes selected from one of Tables 1 to 20.
[0138] In certain embodiments, depletion of the suppressive T cells may be used in adoptive cell transfer (e.g., TIL therapy, CAR T therapy). In certain embodiments, T cells (e.g., tumor infiltrating lymphocytes or TILs) may obtained from a subject and depleted for the T cells described herein ex vivo. The term “ex vivo” is encompassed by the term “in vitro.” The term “in vitro” generally denotes outside, or external to, a body, e.g., an animal or human body. In certain embodiments, removing CD8.sup.+ Tregs from a population of T cells used in adoptive cell transfer allows an enhanced immune response. In certain embodiments, CD8 Tregs normally prevent the immune system from targeting self-antigens, but in the case of cancer Tregs may prevent immune cells from targeting cancer cells through suppression of effector cells. In certain embodiments, a population of T cells enriched for suppressive T cells may be used in treating an autoimmune disease.
[0139] In certain embodiments, enrichment of activated T cells or T cells primed for activation may be used in adoptive cell transfer (e.g., TIL therapy, CAR T therapy). In certain embodiments, the T cell is selected based on the affinity of the antigen targeted. The antigen may have high affinity for a TCR or MHC molecule or low affinity. In certain embodiments, the subtype may be used in adoptive cell transfer (e.g., TIL therapy, CAR T therapy). In certain embodiments, TILs may be isolated from a tumor and the isolated cells selected for one or more specific subtypes. The one or more specific subtypes may be expanded or may be used to express a CAR or endogenous TCR. In certain embodiments, allogenic CAR T cells may be enriched for one or more specific subtypes.
[0140] Particular advantageous uses include methods for identifying agents capable of inducing or suppressing one or more immune cell subtypes based on the gene signatures, protein signature, and/or other genetic or epigenetic signature as defined herein. In certain example embodiments, detection or quantifying the subtypes may be used to determine responsiveness to various therapeutics.
[0141] Particular advantageous uses include methods for identifying agents capable of modulating the T cells based on their gene signatures, protein signature, and/or other genetic or epigenetic signature as defined herein. In certain example embodiments, detection or quantifying the T cells may be used to determine responsiveness to various therapeutics (e.g., an increase or decrease in one or more of the T cells may indicate an immunotherapy is effective). Not being bound by a theory, checkpoint blockade therapy may specifically target the T cells of the present invention. In certain embodiments, cytokines or differentiating agents may be used to shift the balance of T cells to be less or more suppressive or more activated.
[0142] In one aspect, the invention relates to a signature or set of biomarkers that distinguish between CD8.sup.+ T cells. The signature may be a gene signature, protein signature, and/or other genetic or epigenetic signature of particular tumor cell subpopulations, as defined herein. In certain embodiments, CD8.sup.+ T cell subtypes may be detected and isolated by subtype specific signature biomarkers or combinations thereof.
[0143] In certain embodiments, pharmaceutical compositions comprising populations of T cells wherein the T cells of the present invention are depleted or enriched may be used in treating cancer (e.g., adoptive cell transfer). In certain embodiments, populations of cells depleted or enriched for the T cells of the present invention are used in combination with other therapies (e.g., checkpoint blockade therapy, CAR T cell therapy). In certain embodiments, pharmaceutical compositions comprising populations of T cells wherein the suppressive T cells of the present invention are enriched may be used in treating an autoimmune disease.
[0144] The invention further relates to agents capable of inducing or suppressing particular immune cell populations based on the gene signatures, protein signature, and/or other genetic or epigenetic signature as defined herein, as well as their use for modulating, such as inducing or repressing, a particular gene signature, protein signature, and/or other genetic or epigenetic signature. In one embodiment, genes in one population of cells may be activated or suppressed in order to affect the cells of another population (e.g., suppressive T cells may be activated or inactivated to enhance or repress activity of effector T cells). Not being bound by a theory, the CD8.sup.+ T cells described herein are effected by other immune cells in the tumor microenvironment (e.g., antigen presenting cells). In related aspects, modulating, such as inducing or repressing, a particular gene signature, protein signature, and/or other genetic or epigenetic signature may modify overall immune cell composition, such as immune cell composition, such as immune cell subpopulation composition or distribution, or functionality.
[0145] In further aspects, the invention relates to a signature or set of biomarkers that may be detected in combination. The signature detected in combination may be a gene signature, protein signature, and/or other genetic or epigenetic signature of a particular tumor cell (sub)population (e.g., tumor cells capable of immune evasion, tumor cells having specific mutations). The invention hereto also further relates to particular tumor cell subpopulations, which may be identified based on the methods according to the invention as discussed herein; as well as methods to target such cell subpopulations, such as in therapeutics (e.g., adoptive cell therapy, CAR T cells, agents capable of modulating T cells as defined herein); and screening methods to identify agents capable of inducing or suppressing particular tumor cell (sub)populations.
[0146] The term “immune cell” as used throughout this specification generally encompasses any cell derived from a hematopoietic stem cell that plays a role in the immune response. The term is intended to encompass immune cells both of the innate or adaptive immune system. The immune cell as referred to herein may be a leukocyte, at any stage of differentiation (e.g., a stem cell, a progenitor cell, a mature cell) or any activation stage. Immune cells include lymphocytes (such as natural killer cells, T-cells (including, e.g., thymocytes, Th or Tc; Th1, Th2, Th17, Thaβ, CD4+, CD8.sup.+, effector Th, memory Th, regulatory Th, CD4+/CD8.sup.+ thymocytes, CD4-/CD8-thymocytes, γδ T cells, etc.) or B-cells (including, e.g., pro-B cells, early pro-B cells, late pro-B cells, pre-B cells, large pre-B cells, small pre-B cells, immature or mature B-cells, producing antibodies of any isotype, T1 B-cells, T2, B-cells, naïve B-cells, GC B-cells, plasmablasts, memory B-cells, plasma cells, follicular B-cells, marginal zone B-cells, B-1 cells, B-2 cells, regulatory B cells, etc.), such as for instance, monocytes (including, e.g., classical, non-classical, or intermediate monocytes), (segmented or banded) neutrophils, eosinophils, basophils, mast cells, histiocytes, microglia, including various subtypes, maturation, differentiation, or activation stages, such as for instance hematopoietic stem cells, myeloid progenitors, lymphoid progenitors, myeloblasts, promyelocytes, myelocytes, metamyelocytes, monoblasts, promonocytes, lymphoblasts, prolymphocytes, small lymphocytes, macrophages (including, e.g., Kupffer cells, stellate macrophages, M1 or M2 macrophages), (myeloid or lymphoid) dendritic cells (including, e.g., Langerhans cells, conventional or myeloid dendritic cells, plasmacytoid dendritic cells, mDC-1, mDC-2, Mo-DC, HP-DC, veiled cells), granulocytes, polymorphonuclear cells, antigen-presenting cells (APC), etc.
[0147] As used throughout this specification, “immune response” refers to a response by a cell of the immune system, such as a B cell, T cell (CD4+ or CD8.sup.+), regulatory T cell, antigen-presenting cell, dendritic cell, monocyte, macrophage, NKT cell, NK cell, basophil, eosinophil, or neutrophil, to a stimulus. In some embodiments, the response is specific for a particular antigen (an “antigen-specific response”), and refers to a response by a CD4 T cell, CD8 T cell, or B cell via their antigen-specific receptor. In some embodiments, an immune response is a T cell response, such as a CD4+ response or a CD8.sup.+ response. Such responses by these cells can include, for example, cytotoxicity, proliferation, cytokine or chemokine production, trafficking, or phagocytosis, and can be dependent on the nature of the immune cell undergoing the response.
[0148] T cell response refers more specifically to an immune response in which T cells directly or indirectly mediate or otherwise contribute to an immune response in a subject. T cell-mediated response may be associated with cell mediated effects, cytokine mediated effects, and even effects associated with B cells if the B cells are stimulated, for example, by cytokines secreted by T cells. By means of an example but without limitation, effector functions of MHC class I restricted Cytotoxic T lymphocytes (CTLs), may include cytokine and/or cytolytic capabilities, such as lysis of target cells presenting an antigen peptide recognized by the T cell receptor (naturally-occurring TCR or genetically engineered TCR, e.g., chimeric antigen receptor, CAR), secretion of cytokines, preferably IFN gamma, TNF alpha and/or or more immunostimulatory cytokines, such as IL-2, and/or antigen peptide-induced secretion of cytotoxic effector molecules, such as granzymes, perforins or granulysin. By means of example but without limitation, for MHC class II restricted T helper (Th) cells, effector functions may be antigen peptide-induced secretion of cytokines, preferably, IFN gamma, TNF alpha, IL-4, IL5, IL-10, and/or IL-2. By means of example but without limitation, for T regulatory (Treg) cells, effector functions may be antigen peptide-induced secretion of cytokines, preferably, IL-10, IL-35, and/or TGF-beta. B cell response refers more specifically to an immune response in which B cells directly or indirectly mediate or otherwise contribute to an immune response in a subject. Effector functions of B cells may include in particular production and secretion of antigen-specific antibodies by B cells (e.g., polyclonal B cell response to a plurality of the epitopes of an antigen (antigen-specific antibody response)), antigen presentation, and/or cytokine secretion.
[0149] The term “antigen” as used throughout this specification refers to a molecule or a portion of a molecule capable of being bound by an antibody, or by a T cell receptor (TCR) when presented by MHC molecules. At the molecular level, an antigen is characterized by its ability to be bound at the antigen-binding site of an antibody. The specific binding denotes that the antigen will be bound in a highly selective manner by its cognate antibody and not by the multitude of other antibodies which may be evoked by other antigens. An antigen is additionally capable of being recognized by the immune system. In some instances, an antigen is capable of eliciting a humoral immune response in a subject. In some instances, an antigen is capable of eliciting a cellular immune response in a subject, leading to the activation of B- and/or T-lymphocytes. In some instances, an antigen is capable of eliciting a humoral and cellular immune response in a subject. Hence, an antigen may be preferably antigenic and immunogenic. Alternatively, an antigen may be antigenic and not immunogenic. Typically, an antigen may be a peptide, polypeptide, protein, nucleic acid, an oligo- or polysaccharide, or a lipid, or any combination thereof, a glycoprotein, proteoglycan, glycolipid, etc. In certain embodiments, an antigen may be a peptide, polypeptide, or protein. An antigen may have one or more than one epitope. The terms “antigenic determinant” or “epitope” generally refer to the region or part of an antigen that specifically reacts with or is recognized by the immune system, specifically by antibodies, B cells, or T cells.
[0150] An antigen as contemplated throughout this specification may be obtained by any means available to a skilled person, e.g., may be isolated from a naturally-occurring material comprising the antigen, or may be produced recombinantly by a suitable host or host cell expression system and optionally isolated therefrom (e.g., a suitable bacterial, yeast, fungal, plant or animal host or host cell expression system), or may be produced recombinantly by cell-free transcription or translation, or non-biological nucleic acid or peptide synthesis.
[0151] The term “tumor antigen” as used throughout this specification refers to an antigen that is uniquely or differentially expressed by a tumor cell, whether intracellular or on the tumor cell surface (preferably on the tumor cell surface), compared to a normal or non-neoplastic cell. By means of example, a tumor antigen may be present in or on a tumor cell and not typically in or on normal cells or non-neoplastic cells (e.g., only expressed by a restricted number of normal tissues, such as testis and/or placenta), or a tumor antigen may be present in or on a tumor cell in greater amounts than in or on normal or non-neoplastic cells, or a tumor antigen may be present in or on tumor cells in a different form than that found in or on normal or non-neoplastic cells. The term thus includes tumor-specific antigens (TSA), including tumor-specific membrane antigens, tumor-associated antigens (TAA), including tumor-associated membrane antigens, embryonic antigens on tumors, growth factor receptors, growth factor ligands, etc. The term further includes cancer/testis (CT) antigens. Examples of tumor antigens include, without limitation, β-human chorionic gonadotropin (PHCG), glycoprotein 100 (gp100/Pme117), carcinoembryonic antigen (CEA), tyrosinase, tyrosinase-related protein 1 (gp75/TRP1), tyrosinase-related protein 2 (TRP-2), NY-BR-1, NY-CO-58, NY-ESO-1, MN/gp250, idiotypes, telomerase, synovial sarcoma X breakpoint 2 (SSX2), mucin 1 (MUC-1), antigens of the melanoma-associated antigen (MAGE) family, high molecular weight-melanoma associated antigen (IMW-MAA), melanoma antigen recognized by T cells 1 (MART1), Wilms' tumor gene 1 (WT1), HER2/neu, mesothelin (MSLN), alphafetoprotein (AFP), cancer antigen 125 (CA-125), and abnormal forms of ras or p53 (see also, WO2016187508A2). Tumor antigens may also be subject specific (e.g., subject specific neoantigens; see, e.g., U.S. Pat. No. 9,115,402; and international patent application publication numbers WO2016100977A1, WO2014168874A2, WO2015085233A1, and WO2015095811A2).
Biomarkers and Signatures
[0152] The invention further relates to various biomarkers for detecting CD8.sup.+ T cell populations. As used herein “marker” and “biomarker” are used interchangeably. In certain example embodiments, suppressive CD8.sup.+ T cell populations are present in a population of tumor infiltrating lymphocytes (TIL). The suppressive T cell populations may be detected by detecting one or more biomarkers in a sample. The set of markers may comprise one or more genes or polypeptides, e.g., TIM3, SERPINE2, HMMR, KIT, TNFRSF4, CD8, CD45, PD1, TNFRSF9, PRF1, BHLHE40, IRF8, GLDC, STAT3, CST7, IL1R2, EEF2, SLC2A3, SQSTM1, RBPJ, NABP1, ACTN1, TNFRSF4, SERPINB9, FOSL2, CAPG, KLRC1, IL18R1, JUNB, EEF1A1, TNFRSF18, RGS2, NFKB2, RPL5, PEX16, LAT2, KDM5B, HILPDA, GEM, DENND4A, BCL2L11, ADAM8, PGLYRP1, IKZF2, KIT, SERPINE2, CCRL2, CSF1, EPAS1, RUNX2, SPRY2, XCL1, CCR8, MT 1 and KI67. In certain embodiments, the markers include the following combinations: a) TIM3, SERPINE2 and HMMR; or b) SERPINE2 and HMMR; or c) TIM3, KIT and HMMR; or d) TIM3, TNFRSF4 and HMMR; or e) any of (a), (b), (c) or (d) and one or more of CD8, CD45 and PD1; or any of (a), (b), (c), (d) or (e) and one or more of TNFRSF9, PRF1, BHLHE40, IRF8, GLDC, STAT3, CST7, IL1R2, EEF2, SLC2A3, SQSTM1, RBPJ, NABP1, ACTN1, TNFRSF4, SERPINB9, FOSL2, CAPG, KLRC1, IL18R1, JUNB, EEF1A1, TNFRSF18, RGS2, NFKB2, RPL5, PEX16, LAT2, KDM5B, HILPDA, GEM, DENND4A, BCL2L11, ADAM8, PGLYRP1, IKZF2, KIT, SERPINE2, CCRL2, CSF1, EPAS1, RUNX2, SPRY2, XCL1, CCR8, MT1 and KI67.
[0153] The term “biomarker” is widespread in the art and commonly broadly denotes a biological molecule, more particularly an endogenous biological molecule, and/or a detectable portion thereof, whose qualitative and/or quantitative evaluation in a tested object (e.g., in or on a cell, cell population, tissue, organ, or organism, e.g., in a biological sample of a subject) is predictive or informative with respect to one or more aspects of the tested object's phenotype and/or genotype. The terms “marker” and “biomarker” may be used interchangeably throughout this specification. Biomarkers as intended herein may be nucleic acid-based or peptide-, polypeptide- and/or protein-based. For example, a marker may be comprised of peptide(s), polypeptide(s) and/or protein(s) encoded by a given gene, or of detectable portions thereof. Further, whereas the term “nucleic acid” generally encompasses DNA, RNA and DNA/RNA hybrid molecules, in the context of markers the term may typically refer to heterogeneous nuclear RNA (hnRNA), pre-mRNA, messenger RNA (mRNA), or complementary DNA (cDNA), or detectable portions thereof. Such nucleic acid species are particularly useful as markers, since they contain qualitative and/or quantitative information about the expression of the gene. Particularly preferably, a nucleic acid-based marker may encompass mRNA of a given gene, or cDNA made of the mRNA, or detectable portions thereof. Any such nucleic acid(s), peptide(s), polypeptide(s) and/or protein(s) encoded by or produced from a given gene are encompassed by the term “gene product(s)”.
[0154] Preferably, markers as intended herein may be extracellular or cell surface markers, as methods to measure extracellular or cell surface marker(s) need not disturb the integrity of the cell membrane and may not require fixation/permeabilization of the cells.
[0155] Unless otherwise apparent from the context, reference herein to any marker, such as a peptide, polypeptide, protein, or nucleic acid, may generally also encompass modified forms of said marker, such as bearing post-expression modifications including, for example, phosphorylation, glycosylation, lipidation, methylation, cysteinylation, sulphonation, glutathionylation, acetylation, oxidation of methionine to methionine sulphoxide or methionine sulphone, and the like.
[0156] The term “peptide” as used throughout this specification preferably refers to a polypeptide as used herein consisting essentially of 50 amino acids or less, e.g., 45 amino acids or less, preferably 40 amino acids or less, e.g., 35 amino acids or less, more preferably 30 amino acids or less, e.g., 25 or less, 20 or less, 15 or less, 10 or less or 5 or less amino acids.
[0157] The term “polypeptide” as used throughout this specification generally encompasses polymeric chains of amino acid residues linked by peptide bonds. Hence, insofar a protein is only composed of a single polypeptide chain, the terms “protein” and “polypeptide” may be used interchangeably herein to denote such a protein. The term is not limited to any minimum length of the polypeptide chain. The term may encompass naturally, recombinantly, semi-synthetically or synthetically produced polypeptides. The term also encompasses polypeptides that carry one or more co- or post-expression-type modifications of the polypeptide chain, such as, without limitation, glycosylation, acetylation, phosphorylation, sulfonation, methylation, ubiquitination, signal peptide removal, N-terminal Met removal, conversion of pro-enzymes or pre-hormones into active forms, etc. The term further also includes polypeptide variants or mutants which carry amino acid sequence variations vis-à-vis a corresponding native polypeptide, such as, e.g., amino acid deletions, additions and/or substitutions. The term contemplates both full-length polypeptides and polypeptide parts or fragments, e.g., naturally-occurring polypeptide parts that ensue from processing of such full-length polypeptides.
[0158] The term “protein” as used throughout this specification generally encompasses macromolecules comprising one or more polypeptide chains, i.e., polymeric chains of amino acid residues linked by peptide bonds. The term may encompass naturally, recombinantly, semi-synthetically or synthetically produced proteins. The term also encompasses proteins that carry one or more co- or post-expression-type modifications of the polypeptide chain(s), such as, without limitation, glycosylation, acetylation, phosphorylation, sulfonation, methylation, ubiquitination, signal peptide removal, N-terminal Met removal, conversion of pro-enzymes or pre-hormones into active forms, etc. The term further also includes protein variants or mutants which carry amino acid sequence variations vis-à-vis a corresponding native protein, such as, e.g., amino acid deletions, additions and/or substitutions. The term contemplates both full-length proteins and protein parts or fragments, e.g., naturally-occurring protein parts that ensue from processing of such full-length proteins.
[0159] The reference to any marker, including any peptide, polypeptide, protein, or nucleic acid, corresponds to the marker commonly known under the respective designations in the art. The terms encompass such markers of any organism where found, and particularly of animals, preferably warm-blooded animals, more preferably vertebrates, yet more preferably mammals, including humans and non-human mammals, still more preferably of humans.
[0160] The terms particularly encompass such markers, including any peptides, polypeptides, proteins, or nucleic acids, with a native sequence, i.e., ones of which the primary sequence is the same as that of the markers found in or derived from nature. A skilled person understands that native sequences may differ between different species due to genetic divergence between such species. Moreover, native sequences may differ between or within different individuals of the same species due to normal genetic diversity (variation) within a given species. Also, native sequences may differ between or even within different individuals of the same species due to somatic mutations, or post-transcriptional or post-translational modifications. Any such variants or isoforms of markers are intended herein. Accordingly, all sequences of markers found in or derived from nature are considered “native”. The terms encompass the markers when forming a part of a living organism, organ, tissue or cell, when forming a part of a biological sample, as well as when at least partly isolated from such sources. The terms also encompass markers when produced by recombinant or synthetic means.
[0161] In certain embodiments, markers, including any peptides, polypeptides, proteins, or nucleic acids, may be human, i.e., their primary sequence may be the same as a corresponding primary sequence of or present in a naturally occurring human markers. Hence, the qualifier “human” in this connection relates to the primary sequence of the respective markers, rather than to their origin or source. For example, such markers may be present in or isolated from samples of human subjects or may be obtained by other means (e.g., by recombinant expression, cell-free transcription or translation, or non-biological nucleic acid or peptide synthesis).
[0162] The reference herein to any marker, including any peptide, polypeptide, protein, or nucleic acid, also encompasses fragments thereof. Hence, the reference herein to measuring (or measuring the quantity of) any one marker may encompass measuring the marker and/or measuring one or more fragments thereof.
[0163] For example, any marker and/or one or more fragments thereof may be measured collectively, such that the measured quantity corresponds to the sum amounts of the collectively measured species. In another example, any marker and/or one or more fragments thereof may be measured each individually. The terms encompass fragments arising by any mechanism, in vivo and/or in vitro, such as, without limitation, by alternative transcription or translation, exo- and/or endo-proteolysis, exo- and/or endo-nucleolysis, or degradation of the peptide, polypeptide, protein, or nucleic acid, such as, for example, by physical, chemical and/or enzymatic proteolysis or nucleolysis.
[0164] The term “fragment” as used throughout this specification with reference to a peptide, polypeptide, or protein generally denotes a portion of the peptide, polypeptide, or protein, such as typically an N- and/or C-terminally truncated form of the peptide, polypeptide, or protein. Preferably, a fragment may comprise at least about 30%, e.g., at least about 50% or at least about 70%, preferably at least about 80%, e.g., at least about 85%, more preferably at least about 90%, and yet more preferably at least about 95% or even about 99% of the amino acid sequence length of said peptide, polypeptide, or protein. For example, insofar not exceeding the length of the full-length peptide, polypeptide, or protein, a fragment may include a sequence of ≥5 consecutive amino acids, or ≥10 consecutive amino acids, or ≥20 consecutive amino acids, or ≥30 consecutive amino acids, e.g., ≥40 consecutive amino acids, such as for example ≥50 consecutive amino acids, e.g., ≥60, ≥70, ≥80, ≥90, ≥100, ≥200, ≥300, ≥400, ≥500 or ≥600 consecutive amino acids of the corresponding full-length peptide, polypeptide, or protein.
[0165] The term “fragment” as used throughout this specification with reference to a nucleic acid (polynucleotide) generally denotes a 5′- and/or 3′-truncated form of a nucleic acid. Preferably, a fragment may comprise at least about 30%, e.g., at least about 50% or at least about 70%, preferably at least about 80%, e.g., at least about 85%, more preferably at least about 90%, and yet more preferably at least about 95% or even about 99% of the nucleic acid sequence length of said nucleic acid. For example, insofar not exceeding the length of the full-length nucleic acid, a fragment may include a sequence of ≥5 consecutive nucleotides, or ≥10 consecutive nucleotides, or ≥20 consecutive nucleotides, or ≥30 consecutive nucleotides, e.g., ≥40 consecutive nucleotides, such as for example ≥50 consecutive nucleotides, e.g., ≥60, ≥70, ≥80, ≥90, ≥100, ≥200, ≥300, ≥400, ≥500 or ≥600 consecutive nucleotides of the corresponding full-length nucleic acid.
[0166] Cells such as immune cells as disclosed herein may in the context of the present specification be said to “comprise the expression” or conversely to “not express” one or more markers, such as one or more genes or gene products; or be described as “positive” or conversely as “negative” for one or more markers, such as one or more genes or gene products; or be said to “comprise” a defined “gene or gene product signature”.
[0167] Such terms are commonplace and well-understood by the skilled person when characterizing cell phenotypes. By means of additional guidance, when a cell is said to be positive for or to express or comprise expression of a given marker, such as a given gene or gene product, a skilled person would conclude the presence or evidence of a distinct signal for the marker when carrying out a measurement capable of detecting or quantifying the marker in or on the cell. Suitably, the presence or evidence of the distinct signal for the marker would be concluded based on a comparison of the measurement result obtained for the cell to a result of the same measurement carried out for a negative control (for example, a cell known to not express the marker) and/or a positive control (for example, a cell known to express the marker). Where the measurement method allows for a quantitative assessment of the marker, a positive cell may generate a signal for the marker that is at least 1.5-fold higher than a signal generated for the marker by a negative control cell or than an average signal generated for the marker by a population of negative control cells, e.g., at least 2-fold, at least 4-fold, at least 10-fold, at least 20-fold, at least 30-fold, at least 40-fold, at least 50-fold higher or even higher. Further, a positive cell may generate a signal for the marker that is 3.0 or more standard deviations, e.g., 3.5 or more, 4.0 or more, 4.5 or more, or 5.0 or more standard deviations, higher than an average signal generated for the marker by a population of negative control cells.
[0168] The present invention is also directed to signatures and uses thereof. As used herein a “signature” may encompass any gene or genes, protein or proteins, or epigenetic element(s) whose expression profile or whose occurrence is associated with a specific cell type, subtype, or cell state of a specific cell type or subtype within a population of cells (e.g., tumor infiltrating lymphocytes). In certain embodiments, the expression of the signatures (e.g., T cell signature) are dependent on epigenetic modification of the genes or regulatory elements associated with the genes. Thus, in certain embodiments, use of signature genes includes epigenetic modifications that may be detected or modulated. For ease of discussion, when discussing gene expression, any gene or genes, protein or proteins, or epigenetic element(s) may be substituted. Reference to a gene name throughout the specification encompasses the human gene, mouse gene and all other orthologues as known in the art in other organisms. As used herein, the terms “signature”, “expression profile”, or “expression program” may be used interchangeably. It is to be understood that also when referring to proteins (e.g. differentially expressed proteins), such may fall within the definition of “gene” signature. Levels of expression or activity or prevalence may be compared between different cells in order to characterize or identify for instance signatures specific for cell (sub)populations. Increased or decreased expression or activity of signature genes may be compared between different cells in order to characterize or identify for instance specific cell (sub)populations. The detection of a signature in single cells may be used to identify and quantitate for instance specific cell (sub)populations. A signature may include a gene or genes, protein or proteins, or epigenetic element(s) whose expression or occurrence is specific to a cell (sub)population, such that expression or occurrence is exclusive to the cell (sub)population. A gene signature as used herein, may thus refer to any set of up- and down-regulated genes that are representative of a cell type or subtype. A gene signature as used herein, may also refer to any set of up- and down-regulated genes between different cells or cell (sub)populations derived from a gene-expression profile. For example, a gene signature may comprise a list of genes differentially expressed in a distinction of interest (e.g., a pattern of gene expression).
[0169] The signature as defined herein (being it a gene signature, protein signature or other genetic or epigenetic signature) can be used to indicate the presence of a cell type, a subtype of the cell type, the state of the microenvironment of a population of cells, a particular cell type population or subpopulation, and/or the overall status of the entire cell (sub)population. Furthermore, the signature may be indicative of cells within a population of cells in vivo. The signature may also be used to suggest for instance particular therapies, or to follow up treatment, or to suggest ways to modulate immune systems. The signatures of the present invention may be discovered by analysis of expression profiles of single-cells within a population of cells from isolated samples (e.g. tumor samples), thus allowing the discovery of novel cell subtypes or cell states that were previously invisible or unrecognized. The presence of subtypes or cell states may be determined by subtype specific or cell state specific signatures. The presence of these specific cell (sub)types or cell states may be determined by applying the signature genes to bulk sequencing data in a sample. Not being bound by a theory the signatures of the present invention may be microenvironment specific, such as their expression in a particular spatio-temporal context. Not being bound by a theory, signatures as discussed herein are specific to a particular pathological context. Not being bound by a theory, a combination of cell subtypes having a particular signature may indicate an outcome. Not being bound by a theory, the signatures can be used to deconvolute the network of cells present in a particular pathological condition. Not being bound by a theory the presence of specific cells and cell subtypes are indicative of a particular response to treatment, such as including increased or decreased susceptibility to treatment. The signature may indicate the presence of one particular cell type.
[0170] The signature according to certain embodiments of the present invention may comprise or consist of one or more genes, proteins and/or epigenetic elements, such as for instance 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more. In certain embodiments, the signature may comprise or consist of two or more genes, proteins and/or epigenetic elements, such as for instance 2, 3, 4, 5, 6, 7, 8, 9, 10 or more. In certain embodiments, the signature may comprise or consist of three or more genes, proteins and/or epigenetic elements, such as for instance 3, 4, 5, 6, 7, 8, 9, 10 or more. In certain embodiments, the signature may comprise or consist of four or more genes, proteins and/or epigenetic elements, such as for instance 4, 5, 6, 7, 8, 9, 10 or more. In certain embodiments, the signature may comprise or consist of five or more genes, proteins and/or epigenetic elements, such as for instance 5, 6, 7, 8, 9, 10 or more. In certain embodiments, the signature may comprise or consist of six or more genes, proteins and/or epigenetic elements, such as for instance 6, 7, 8, 9, 10 or more. In certain embodiments, the signature may comprise or consist of seven or more genes, proteins and/or epigenetic elements, such as for instance 7, 8, 9, 10 or more. In certain embodiments, the signature may comprise or consist of eight or more genes, proteins and/or epigenetic elements, such as for instance 8, 9, 10 or more. In certain embodiments, the signature may comprise or consist of nine or more genes, proteins and/or epigenetic elements, such as for instance 9, 10 or more. In certain embodiments, the signature may comprise or consist of ten or more genes, proteins and/or epigenetic elements, such as for instance 10, 11, 12, 13, 14, 15, or more. It is to be understood that a signature according to the invention may for instance also include genes or proteins as well as epigenetic elements combined.
[0171] In certain embodiments, a signature is characterized as being specific for a particular immune cell or immune cell (sub)population if it is upregulated or only present, detected or detectable in that particular immune cell or immune cell (sub)population, or alternatively is downregulated or only absent, or undetectable in that particular immune cell or immune cell (sub)population. In this context, a signature consists of one or more differentially expressed genes/proteins or differential epigenetic elements when comparing different cells or cell (sub)populations, including comparing different immune cell or immune cell (sub)populations, as well as comparing immune cell or immune cell (sub)populations with non-immune cell or non-immune cell (sub)populations. It is to be understood that “differentially expressed” genes/proteins include genes/proteins which are up- or down-regulated as well as genes/proteins which are turned on or off. When referring to up- or down-regulation, in certain embodiments, such up- or down-regulation is preferably at least two-fold, such as two-fold, three-fold, four-fold, five-fold, or more, such as for instance at least ten-fold, at least 20-fold, at least 30-fold, at least 40-fold, at least 50-fold, or more. Alternatively, or in addition, differential expression may be determined based on common statistical tests, as is known in the art.
[0172] As discussed herein, differentially expressed genes/proteins, or differential epigenetic elements may be differentially expressed on a single cell level, or may be differentially expressed on a cell population level. Preferably, the differentially expressed genes/proteins or epigenetic elements as discussed herein, such as constituting the gene signatures as discussed herein, when as to the cell population or subpopulation level, refer to genes that are differentially expressed in all or substantially all cells of the population or subpopulation (such as at least 80%, preferably at least 90%, such as at least 95% of the individual cells). This allows one to define a particular subpopulation of immune cells. As referred to herein, a “subpopulation” of cells preferably refers to a particular subset of cells of a particular cell type which can be distinguished or are uniquely identifiable and set apart from other cells of this cell type. The cell subpopulation may be phenotypically characterized, and is preferably characterized by the signature as discussed herein. A cell (sub)population as referred to herein may constitute of a (sub)population of cells of a particular cell type characterized by a specific cell state.
[0173] When referring to induction, or alternatively suppression of a particular signature, preferable is meant induction or alternatively suppression (or upregulation or downregulation) of at least one gene/protein and/or epigenetic element of the signature, such as for instance at least two, at least three, at least four, at least five, at least six, or all genes/proteins and/or epigenetic elements of the signature.
[0174] Various aspects and embodiments of the invention may involve analyzing gene signatures, protein signature, and/or other genetic or epigenetic signature based on single cell analyses (e.g. single cell RNA sequencing) or alternatively based on cell population analyses, as is defined herein elsewhere.
[0175] In certain example embodiments, the signature genes may be used to deconvolute the network of cells present in a tumor based on comparing them to data from bulk analysis of a tumor sample. In certain example embodiments, the presence of specific immune cells and immune cell subtypes may be indicative of tumor growth, invasiveness and/or resistance to treatment. In one example embodiment, detection of one or more signature genes may indicate the presence of a particular cell type or cell types. In certain example embodiments, the presence of immune cell types within a tumor may indicate that the tumor will be sensitive to a treatment (e.g., checkpoint blockade therapy). In one embodiment, the signature genes of the present invention are applied to bulk sequencing data from a tumor sample obtained from a subject, such that information relating to disease outcome and personalized treatments is determined. In certain embodiments, the presence of suppressive T cells in a tumor may be determined by deconvolution of bulk tumor sequencing data and the ratio of suppressive T cells compared to clinical outcomes. Not being bound by a theory, a prognosis may be determined based on the immune cell status of a tumor.
Detection, Quantification and Isolation of CD8.SUP.+ T Cells Subtypes
[0176] In one embodiment, the present invention provides for a method comprising detecting or quantifying CD8.sup.+ T cells in a biological sample. In preferred embodiments, one or more PD1+CD8.sup.+ T cells are detected or quantified in the biological sample. The CD8.sup.+ T cells may be detected or quantified using a set of markers comprising: one or more genes or polypeptides selected from the group consisting of TIM3, SERPINE2, HMMR, KIT, TNFRSF4, CD8, CD45, PD1, TNFRSF9, PRF1, BHLHE40 (DEC1), IRF8, GLDC, STAT3, CST7, IL1R2, EEF2, SLC2A3, SQSTM1, RBPJ, NABP1, ACTN1, TNFRSF4, SERPINB9, FOSL2, CAPG, KLRC1, IL18R1, JUNB, EEF1A1, TNFRSF18, RGS2, NFKB2, RPL5, PEX16, LAT2, KDM5B, HILPDA, GEM, DENND4A, BCL2L11, ADAM8, PGLYRP1, IKZF2 (HELIOS), KIT, SERPINE2, CCRL2, CSF1, EPAS1, RUNX2, SPRY2, XCL1, CCR8, MT1 and KI67. In certain embodiments, the markers include the following combinations: a) TIM3, SERPINE2 and HMMR; or b) SERPINE2 and HMMR; or c) TIM3, KIT and HMMR; or d) TIM3, TNFRSF4 and HMMR; or e) any of (a), (b), (c) or (d) and one or more of CD8, CD45 and PD1; or any of (a), (b), (c), (d) or (e) and one or more of TNFRSF9, PRF1, BHLHE40, IRF8, GLDC, STAT3, CST7, IL1R2, EEF2, SLC2A3, SQSTM1, RBPJ, NABP1, ACTN1, TNFRSF4, SERPINB9, FOSL2, CAPG, KLRC1, IL18R1, JUNB, EEF1A1, TNFRSF18, RGS2, NFKB2, RPL5, PEX16, LAT2, KDM5B, HILPDA, GEM, DENND4A, BCL2L11, ADAM8, PGLYRP1, IKZF2, KIT, SERPINE2, CCRL2, CSF1, EPAS1, RUNX2, SPRY2, XCL1, CCR8, MT1 and KI67. The T cells may be detected in intact cells by detecting surface markers (e.g., TNFRSF9, IL1R2, SLC2A3, TNFRSF4, KLRC1, IL18R1, TNFRSF18, LAT2, ADAM8, KIT, CCR8 and SERPINE2). The presence of the cells in a sample may also be detected after cells are broken (e.g., lysed, destroyed) or fixed and permeabilized. In an exemplary embodiment, cells are analyzed by single cell RNA sequencing (e.g., scRNA-seq) and the cells are sorted in silico based on gene expression attributed to each single cell. In another exemplary embodiment, fixed and permeabilized cells are analyzed by microscopy (e.g., fluorescent microscopy). In other embodiments, fixed and permeabilized cells may be detected and quantified using FACS. In other embodiments, cells may be detected and quantified using FISH or Flow-FISH. Thus, the specific cells may be detected in a biological sample and cell types quantitated even though the cells have been destroyed. In other embodiments, cells are detected or quantified from a sample without killing the cells, such as by using cell sorting with an affinity reagent specific to a cell surface marker (e.g., FACS).
[0177] In one embodiment, the method comprises isolating CD8.sup.+ T cells from a biological sample. In preferred embodiments, one or more PD1+CD8.sup.+ T cells are isolated from the biological sample. In certain embodiments, isolating CD8.sup.+ T cells from a biological sample results in depletion of the T cells from the biological sample or enrichment of T cells. The CD8.sup.+ T cells may be isolated using a set of markers comprising: one or more surface genes or polypeptides selected from the group consisting of TNFRSF9, IL1R2, SLC2A3, TNFRSF4, KLRC1, IL18R1, TNFRSF18, LAT2, ADAM8, KIT, CCR8 and SERPINE2. In certain embodiments, the markers include the following combinations: a) TIM3, SERPINE2 and HMMR; or b) SERPINE2 and HMMR; or c) TIM3, KIT and HMMR; or d) TIM3, TNFRSF4 and HMMR; or e) any of (a), (b), (c) or (d) and one or more of CD8, CD45 and PD1; or any of (a), (b), (c), (d) or (e) and one or more of TNFRSF9, IL1R2, SLC2A3, TNFRSF4, KLRC1, IL18R1, TNFRSF18, LAT2, ADAM8, KIT, CCR8 and SERPINE2. In certain embodiments, cells are isolated or depleted from a sample by using an affinity reagent specific to a cell surface marker.
[0178] The genes or polypeptides in the group consisting of TNFRSF9, PRF1, BHLHE40, IRF8, GLDC, STAT3, CST7, IL1R2, EEF2, SLC2A3, SQSTM1, RBPJ, NABP1, ACTN1, TNFRSF4, SERPINB9, FOSL2, CAPG, KLRC1, IL18R1, JUNB, EEF1A1, TNFRSF18, RGS2, NFKB2, RPL5, PEX16, LAT2, KDM5B, HILPDA, GEM, DENND4A, BCL2L11, ADAM8, and PGLYRP1 were upregulated in cluster 7 relative to clusters 9 and 10. Thus, the genes may be used to further distinguish between each subtype. Moreover, the overall signatures or subset of the signature genes characteristic of each identified cluster (i.e., CD8.sup.+ T cell subtype) may be used to identify each subtype. In further embodiments, surface markers selected from the group of genes may be used to isolate each subtype.
[0179] A marker, for example a gene or gene product, for example a peptide, polypeptide, protein, or nucleic acid, or a group of two or more markers, is “detected” or “measured” in a tested object (e.g., in or on a cell, cell population, tissue, organ, or organism, e.g., in a biological sample of a subject) when the presence or absence and/or quantity of said marker or said group of markers is detected or determined in the tested object, preferably substantially to the exclusion of other molecules and analytes, e.g., other genes or gene products.
[0180] The terms “increased” or “increase” or “upregulated” or “upregulate” as used herein generally mean an increase by a statically significant amount. For avoidance of doubt, “increased” means a statistically significant increase of at least 10% as compared to a reference level, including an increase of at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100% or more, including, for example at least 2-fold, at least 3-fold, at least 4-fold, at least 5-fold, at least 10-fold increase or greater as compared to a reference level, as that term is defined herein.
[0181] The term “reduced” or “reduce” or “decrease” or “decreased” or “downregulate” or “downregulated” as used herein generally means a decrease by a statistically significant amount relative to a reference. For avoidance of doubt, “reduced” means statistically significant decrease of at least 10% as compared to a reference level, for example a decrease by at least 20%, at least 30%, at least 40%, at least 50%, or at least 60%, or at least 70%, or at least 80%, at least 90% or more, up to and including a 100% decrease (i.e., absent level as compared to a reference sample), or any decrease between 10-100% as compared to a reference level, as that.
[0182] In certain embodiments, the biological sample may be a tumor sample obtained from a subject in need thereof and the CD8.sup.+ T cells may be CD8.sup.+ tumor infiltrating lymphocytes (TIL). In certain embodiments, the TILs may comprise suppressive and/or activated T cells. In certain embodiments, the biological sample may be a sample obtained from a subject suffering from an autoimmune disease. In certain embodiments, T cells may be isolated from the biological sample.
[0183] In certain embodiments, the biological sample may comprise ex vivo or in vitro CD8+ T cells. The ex vivo or in vitro biological sample may be treated with an antigen. The ex vivo or in vitro biological sample may be treated with a differentiation agent. The differentiating agent may be a cytokine. The ex vivo or in vitro biological sample may be treated with a test agent. Not being bound by a theory, the ex vivo or in vitro biological sample may be differentiated to comprise certain types of T cells (e.g., suppressive or effector T cells). The test agent may be any agent predicted to affect the function or gene expression of any of the cells described herein. The agent may affect the ratio of cells in a population of cells (i.e., in the ex vivo or in vitro biological sample). For example, T cells may be differentiated to the T cells of the present invention. Not being bound by a theory, suppressive T cells differentiated ex vivo or in vitro may be used to treat a subject suffering from an autoimmune disease. Not being bound by a theory, suppressive T cells differentiated into effector T cells ex vivo or in vitro may be used to treat a subject suffering from cancer. The test agent may be a drug candidate. The drug candidate may be used to differentiate or modulate T cell balance in vivo. In certain embodiments, the biological sample is assayed to determine the quantity or changes in composition of T cells in the sample after treatment.
[0184] The terms “sample” or “biological sample” as used throughout this specification include any biological specimen obtained from a subject. Particularly useful samples are those known to comprise, or expected or predicted to comprise immune cells as taught herein. Preferably, a sample may be readily obtainable by minimally invasive methods, such as blood collection or tissue biopsy, allowing the removal/isolation/provision of the sample from the subject. Examples of particularly useful samples include without limitation whole blood or a cell-containing fraction of whole blood, such as serum, white blood cells, or peripheral blood mononuclear cells (PBMC), lymph, lymphatic tissue, inflammation fluid, tissue specimens, or tissue biopsies. The term “tissue” as used throughout this specification refers to any animal tissue types including, but not limited to, bone, bone marrow, neural tissue, fibrous connective tissue, cartilage, muscle, vasculature, skin, adipose tissue, blood and glandular tissue or other non-bone tissue. The tissue may be healthy or affected by pathological alterations, e.g., tumor tissue or tissue affected by a disease comprising an immune component. The tissue may be from a living subject or may be cadaveric tissue. The tissue may be autologous tissue or syngeneic tissue or may be allograft or xenograft tissue. A biological sample may also include cells grown in tissue culture, such as cells used for screening drugs or primary cells grown in culture for expansion.
[0185] The terms “quantity”, “amount” and “level” are synonymous and generally well-understood in the art. The terms as used throughout this specification may particularly refer to an absolute quantification of a marker in a tested object (e.g., in or on a cell, cell population, tissue, organ, or organism, e.g., in a biological sample of a subject), or to a relative quantification of a marker in a tested object, i.e., relative to another value such as relative to a reference value, or to a range of values indicating a base-line of the marker. Such values or ranges may be obtained as conventionally known.
[0186] An absolute quantity of a marker may be advantageously expressed as weight or as molar amount, or more commonly as a concentration, e.g., weight per volume or mol per volume. A relative quantity of a marker may be advantageously expressed as an increase or decrease or as a fold-increase or fold-decrease relative to said another value, such as relative to a reference value. Performing a relative comparison between first and second variables (e.g., first and second quantities) may but need not require determining first the absolute values of said first and second variables. For example, a measurement method may produce quantifiable readouts (such as, e.g., signal intensities) for said first and second variables, wherein said readouts are a function of the value of said variables, and wherein said readouts may be directly compared to produce a relative value for the first variable vs. the second variable, without the actual need to first convert the readouts to absolute values of the respective variables.
[0187] Reference values may be established according to known procedures previously employed for other cell populations, biomarkers and gene or gene product signatures. For example, a reference value may be established in an individual or a population of individuals characterized by a particular diagnosis, prediction and/or prognosis of said disease or condition (i.e., for whom said diagnosis, prediction and/or prognosis of the disease or condition holds true). Such population may comprise without limitation 2 or more, 10 or more, 100 or more, or even several hundred or more individuals.
[0188] A “deviation” of a first value from a second value may generally encompass any direction (e.g., increase: first value >second value; or decrease: first value <second value) and any extent of alteration.
[0189] For example, a deviation may encompass a decrease in a first value by, without limitation, at least about 10% (about 0.9-fold or less), or by at least about 20% (about 0.8-fold or less), or by at least about 30% (about 0.7-fold or less), or by at least about 40% (about 0.6-fold or less), or by at least about 50% (about 0.5-fold or less), or by at least about 60% (about 0.4-fold or less), or by at least about 70% (about 0.3-fold or less), or by at least about 80% (about 0.2-fold or less), or by at least about 90% (about 0.1-fold or less), relative to a second value with which a comparison is being made.
[0190] For example, a deviation may encompass an increase of a first value by, without limitation, at least about 10% (about 1.1-fold or more), or by at least about 20% (about 1.2-fold or more), or by at least about 30% (about 1.3-fold or more), or by at least about 40% (about 1.4-fold or more), or by at least about 50% (about 1.5-fold or more), or by at least about 60% (about 1.6-fold or more), or by at least about 70% (about 1.7-fold or more), or by at least about 80% (about 1.8-fold or more), or by at least about 90% (about 1.9-fold or more), or by at least about 100% (about 2-fold or more), or by at least about 150% (about 2.5-fold or more), or by at least about 200% (about 3-fold or more), or by at least about 500% (about 6-fold or more), or by at least about 700% (about 8-fold or more), or like, relative to a second value with which a comparison is being made.
[0191] Preferably, a deviation may refer to a statistically significant observed alteration. For example, a deviation may refer to an observed alteration which falls outside of error margins of reference values in a given population (as expressed, for example, by standard deviation or standard error, or by a predetermined multiple thereof, e.g., ±1×SD or ±2×SD or ±3×SD, or ±1×SE or ±2×SE or ±3×SE). Deviation may also refer to a value falling outside of a reference range defined by values in a given population (for example, outside of a range which comprises ≥40%, ≥50%, ≥60%, ≥70%, ≥75% or ≥80% or ≥85% or ≥90% or ≥95% or even ≥100% of values in said population).
[0192] In a further embodiment, a deviation may be concluded if an observed alteration is beyond a given threshold or cut-off. Such threshold or cut-off may be selected as generally known in the art to provide for a chosen sensitivity and/or specificity of the prediction methods, e.g., sensitivity and/or specificity of at least 50%, or at least 60%, or at least 70%, or at least 80%, or at least 85%, or at least 90%, or at least 95%.
[0193] For example, receiver-operating characteristic (ROC) curve analysis can be used to select an optimal cut-off value of the quantity of a given immune cell population, biomarker or gene or gene product signatures, for clinical use of the present diagnostic tests, based on acceptable sensitivity and specificity, or related performance measures which are well-known per se, such as positive predictive value (PPV), negative predictive value (NPV), positive likelihood ratio (LR+), negative likelihood ratio (LR−), Youden index, or similar.
[0194] The terms “isolating” or “purifying” as used throughout this specification with reference to a particular component of a composition or mixture (e.g., the tested object such as the biological sample) encompass processes or techniques whereby such component is separated from one or more or (substantially) all other components of the composition or mixture (e.g., the tested object such as the biological sample). The terms do not require absolute purity. Instead, isolating or purifying the component will produce a discrete environment in which the abundance of the component relative to one or more or all other components is greater than in the starting composition or mixture (e.g., the tested object such as the biological sample). A discrete environment may denote a single medium, such as for example a single solution, dispersion, gel, precipitate, etc. Isolating or purifying the specified immune cells from the tested object such as the biological sample may increase the abundance of the specified immune cells relative to all other cells comprised in the tested object such as the biological sample, or relative to other cells of a select subset of the cells comprised in the tested object such as the biological sample, e.g., relative to other white blood cells, peripheral blood mononuclear cells, immune cells, antigen presenting cells, or dendritic cells comprised in the tested object such as the biological sample. By means of example, isolating or purifying the specified immune cells from the tested object such as the biological sample may yield a cell population, in which the specified immune cells constitute at least 40% (by number) of all cells of said cell population, for example, at least 45%, preferably at least 50%, at least 55%, more preferably at least 60%, at least 65%, still more preferably at least 70%, at least 75%, even more preferably at least 80%, at least 85%, and yet more preferably at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or even 100% of all cells of said cell population.
[0195] Any existing, available or conventional separation, detection and/or quantification methods may be used to measure the presence or absence (e.g., readout being present vs. absent; or detectable amount vs. undetectable amount) and/or quantity (e.g., readout being an absolute or relative quantity) of the specified immune cells in, or to isolate the specified immune cells from, a tested object (e.g., a cell population, tissue, organ, organism, or a biological sample of a subject). Such methods allow to detect, quantify or isolate the specified immune cells in or from the tested object (e.g., a cell population, tissue, organ, organism, or a biological sample of a subject) substantially to the exclusion of other cells comprised in the tested object. Such methods may allow to detect, quantify or isolate the specified immune cells with sensitivity of at least 50%, at least 55%, at least 60%, at least 65%, preferably at least 70%, at least 75%, more preferably at least 80%, at least 85%, even more preferably at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or even 100%, and/or with specificity of at least 50%, at least 55%, at least 60%, at least 65%, preferably at least 70%, at least 75%, more preferably at least 80%, at least 85%, even more preferably at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or even 100%. By means of example, at least 40% (by number), for example at least 45%, preferably at least 50%, at least 55%, more preferably at least 60%, at least 65%, still more preferably at least 70%, at least 75%, even more preferably at least 80%, at least 85%, and yet more preferably at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or even 100% of all cells detected, quantified or isolated by such methods may correspond to the specified immune cells.
Isolated Cells
[0196] In another aspect, the present invention provides for isolated CD8+ T cells as described herein. The isolated CD8+ T cell subtypes may be isolated using any of the markers described herein. The isolated CD8+ T cell subtypes may be isolated from a human subject. The isolated CD8+ T cell may be isolated from an ex vivo sample (e.g., CAR T cell, autologous T cells or allogenic T cells grown in culture). In preferred embodiments, the isolated CD8+ T cell may be obtained from a subject suffering from a disease (e.g., cancer, an autoimmune disease, or chronic infection).
[0197] In one aspect, the invention is directed to isolated cell populations (e.g., T cells) comprising the T cells described herein and/or as identified by the signatures defined herein. Accordingly, methods for detecting, quantifying or isolating the specified immune cells may be marker-based or gene or gene product signature-based, i.e., may involve isolation of cells expressing or not expressing marker(s) or combination(s) of markers the expression or lack of expression of which is taught herein as typifying or characterizing the specified immune cells, or may involve detection, quantification or isolation of cells comprising gene or gene product signature(s) taught herein as typifying or characterizing the specified immune cells.
[0198] In another aspect, the present invention provides for a population of CD8.sup.+ T cells comprising CD8.sup.+ T cells as defined in any embodiment herein or isolated according to a method of any embodiment herein. The isolated population may comprise greater than 30%, 40%, 50%, 60%, 70%, 80%, 90% or 95% of a CD8.sup.+ T cell as defined in any embodiment herein. In certain embodiments, the population of cells is less than 30% of any one cell type, such as when cells are directly isolated from a patient. In certain embodiments, a population of cells isolated from a subject will include a heterogeneous population of cells, such that specific cell subtypes make up less than a majority of the total cells (e.g., less than 30%, 20%, 10%, 5%, or 1%). In certain embodiments, a subtype of cells is expanded or enriched ex vivo to obtain a non-naturally occurring cell population enriched for certain cell types. In certain embodiments, T cells according to the present invention are depleted from a population of cells. The isolated population may comprise less than 5%, 1%, 0.1%, 0.01%, or 0.001%, or comprise 0% of a suppressive CD8.sup.+ T cell as defined in any embodiment herein. The population of cells depleted for the T cells may be further expanded. Not being bound by a theory suppressive T cells may be depleted from a population of T cells and upon expanding a population enriched for effector T cells may be obtained. Not being bound by a theory an expanded population of T cells may be obtained that does not include suppressive T cells. In certain embodiments, the population of T cells may express a chimeric antigen receptor targeting tumor cell antigens. Not being bound by a theory suppressive T cells may be depleted from a population of CAR T cells.
[0199] The isolated immune cells or immune cell populations as disclosed throughout this specification may be suitably cultured or cultivated in vitro. The terms “culturing” or “cell culture” are common in the art and broadly refer to maintenance of cells and potentially expansion (proliferation, propagation) of cells in vitro. Typically, animal cells, such as mammalian cells, such as human cells, are cultured by exposing them to (i.e., contacting them with) a suitable cell culture medium in a vessel or container adequate for the purpose (e.g., a 96-, 24-, or 6-well plate, a T-25, T-75, T-150 or T-225 flask, or a cell factory), at art-known conditions conducive to in vitro cell culture, such as temperature of 37° C., 5% v/v CO2 and >95% humidity.
[0200] The term “medium” as used herein broadly encompasses any cell culture medium conducive to maintenance of cells, preferably conducive to proliferation of cells. Typically, the medium will be a liquid culture medium, which facilitates easy manipulation (e.g., decantation, pipetting, centrifugation, filtration, and such) thereof.
[0201] Typically, the medium will comprise a basal medium formulation as known in the art. Many basal media formulations (available, e.g., from the American Type Culture Collection, ATCC; or from Invitrogen, Carlsbad, Calif.) can be used, including but not limited to Eagle's Minimum Essential Medium (MEM), Dulbecco's Modified Eagle's Medium (DMEM), alpha modified Minimum Essential Medium (alpha-MEM), Basal Medium Essential (BME), Iscove's Modified Dulbecco's Medium (IMDM), BGJb medium, F-12 Nutrient Mixture (Ham), Liebovitz L-15, DMEM/F-12, Essential Modified Eagle's Medium (EMEM), RPMI-1640, Medium 199, Waymouth's MB 752/1 or Williams Medium E, and modifications and/or combinations thereof. Compositions of basal media are generally known in the art and it is within the skill of one in the art to modify or modulate concentrations of media and/or media supplements as necessary for the cells cultured.
[0202] Such basal media formulations contain ingredients necessary for mammalian cell development, which are known per se. By means of illustration and not limitation, these ingredients may include inorganic salts (in particular salts containing Na, K, Mg, Ca, C1, P and possibly Cu, Fe, Se and Zn), physiological buffers (e.g., HEPES, bicarbonate), nucleotides, nucleosides and/or nucleic acid bases, ribose, deoxyribose, amino acids, vitamins, antioxidants (e.g., glutathione) and sources of carbon (e.g., glucose, sodium pyruvate, sodium acetate), etc.
[0203] For use in culture, basal media can be supplied with one or more further components. For example, additional supplements can be used to supply the cells with the necessary trace elements and substances for optimal growth and expansion. Furthermore, antioxidant supplements may be added, e.g., P-mercaptoethanol. While many basal media already contain amino acids, some amino acids may be supplemented later, e.g., L-glutamine, which is known to be less stable when in solution. A medium may be further supplied with antibiotic and/or antimycotic compounds, such as, typically, mixtures of penicillin and streptomycin, and/or other compounds, exemplified but not limited to, amphotericin, ampicillin, gentamicin, bleomycin, hygromycin, kanamycin, mitomycin, mycophenolic acid, nalidixic acid, neomycin, nystatin, paromomycin, polymyxin, puromycin, rifampicin, spectinomycin, tetracycline, tylosin, and zeocin.
[0204] Lipids and lipid carriers can also be used to supplement cell culture media. Such lipids and carriers can include, but are not limited to cyclodextrin, cholesterol, linoleic acid conjugated to albumin, linoleic acid and oleic acid conjugated to albumin, unconjugated linoleic acid, linoleic-oleic-arachidonic acid conjugated to albumin, oleic acid unconjugated and conjugated to albumin, among others. Albumin can similarly be used in fatty-acid free formulations.
[0205] Also contemplated is supplementation of cell culture media with mammalian plasma or sera. Plasma or sera often contain cellular factors and components that facilitate cell viability and expansion. Optionally, plasma or serum may be heat inactivated. Heat inactivation is used in the art mainly to remove the complement. Heat inactivation typically involves incubating the plasma or serum at 56° C. for 30 to 60 min, e.g., 30 min, with steady mixing, after which the plasma or serum is allowed to gradually cool to ambient temperature. A skilled person will be aware of any common modifications and requirements of the above procedure. Optionally, plasma or serum may be sterilized prior to storage or use. Usual means of sterilization may involve, e.g., filtration through one or more filters with pore size smaller than 1 μm, preferably smaller than 0.5p m, e.g., smaller than 0.45 μm, 0.40 μm, 0.35 μm, 0.30 μm or 0.25 μm, more preferably 0.2 μm or smaller, e.g., 0.15 μm or smaller, 0.10 μm or smaller. Suitable sera or plasmas for use in media as taught herein may include human serum or plasma, or serum or plasma from non-human animals, preferably non-human mammals, such as, e.g., non-human primates (e.g., lemurs, monkeys, apes), fetal or adult bovine, horse, porcine, lamb, goat, dog, rabbit, mouse or rat serum or plasma, etc., or any combination of such. In certain preferred embodiments, a medium as taught herein may comprise bovine serum or plasma, preferably fetal bovine (calf) serum or plasma, more preferably fetal bovine (calf) serum (FCS or FBS). When culturing human cells, media may preferably comprise human serum or plasma, such as autologous or allogeneic human serum or plasma, preferably human serum, such as autologous or allogeneic human serum, more preferably autologous human serum or plasma, even more preferably autologous human serum.
[0206] In certain preferred embodiments, serum or plasma can be substituted in media by serum replacements, such as to provide for serum-free media (i.e., chemically defined media). The provision of serum-free media may be advantageous particularly with view to administration of the media or fraction(s) thereof to subjects, especially to human subjects (e.g., improved bio-safety). By the term “serum replacement” it is broadly meant any a composition that may be used to replace the functions (e.g., cell maintenance and growth supportive function) of animal serum in a cell culture medium. A conventional serum replacement may typically comprise vitamins, albumin, lipids, amino acids, transferrin, antioxidants, insulin and trace elements. Many commercialized serum replacement additives, such as KnockOut Serum Replacement (KOSR), N2, B27, Insulin-Transferrin-Selenium Supplement (ITS), and G5 are well known and are readily available to those skilled in the art.
[0207] Plasma or serum or serum replacement may be comprised in media as taught herein at a proportion (volume of plasma or serum or serum replacement/volume of medium) between about 0.5% v/v and about 40.0% v/v, preferably between about 5.0% v/v and about 20.0% v/v, e.g., between about 5.0% v/v and about 15.0% v/v, more preferably between about 8.0% v/v and about 12.0% v/v, e.g., about 10.0% v/v.
Methods of Detection and Isolation of CD8.SUP.+ T Cells Using Biomarkers
[0208] In certain embodiments, the CD8.sup.+ T cell subtypes may be detected, quantified or isolated using a technique selected from the group consisting of flow cytometry, mass cytometry, fluorescence activated cell sorting (FACS), fluorescence microscopy, affinity separation, magnetic cell separation, microfluidic separation, RNA-seq (e.g., bulk or single cell), quantitative PCR, MERFISH (multiplex (in situ) RNA FISH, Flow-FISH) and combinations thereof. The technique may employ one or more agents capable of specifically binding to one or more gene products expressed or not expressed by the CD8.sup.+ T cells, preferably on the cell surface of the CD8.sup.+ T cells. The one or more agents may be one or more antibodies. Other methods including absorbance assays and colorimetric assays are known in the art and may be used herein.
[0209] Depending on factors that can be evaluated and decided on by a skilled person, such as, inter alia, the type of a marker (e.g., peptide, polypeptide, protein, or nucleic acid), the type of the tested object (e.g., a cell, cell population, tissue, organ, or organism, e.g., the type of biological sample of a subject, e.g., whole blood, plasma, serum, tissue biopsy), the expected abundance of the marker in the tested object, the type, robustness, sensitivity and/or specificity of the detection method used to detect the marker, etc., the marker may be measured directly in the tested object, or the tested object may be subjected to one or more processing steps aimed at achieving an adequate measurement of the marker.
[0210] In other example embodiments, detection of a marker may include immunological assay methods, wherein the ability of an assay to separate, detect and/or quantify a marker (such as, preferably, peptide, polypeptide, or protein) is conferred by specific binding between a separable, detectable and/or quantifiable immunological binding agent (antibody) and the marker. Immunological assay methods include without limitation immunohistochemistry, immunocytochemistry, flow cytometry, mass cytometry, fluorescence activated cell sorting (FACS), fluorescence microscopy, fluorescence based cell sorting using microfluidic systems, immunoaffinity adsorption based techniques such as affinity chromatography, magnetic particle separation, magnetic activated cell sorting or bead based cell sorting using microfluidic systems, enzyme-linked immunosorbent assay (ELISA) and ELISPOT based techniques, radioimmunoassay (RIA), Western blot, etc.
[0211] In certain example embodiments, detection of a marker or signature may include biochemical assay methods, including inter alia assays of enzymatic activity, membrane channel activity, substance-binding activity, gene regulatory activity, or cell signaling activity of a marker, e.g., peptide, polypeptide, protein, or nucleic acid.
[0212] In other example embodiments, detection of a marker may include mass spectrometry analysis methods. Generally, any mass spectrometric (MS) techniques that are capable of obtaining precise information on the mass of peptides, and preferably also on fragmentation and/or (partial) amino acid sequence of selected peptides (e.g., in tandem mass spectrometry, MS/MS; or in post source decay, TOF MS), may be useful herein for separation, detection and/or quantification of markers (such as, preferably, peptides, polypeptides, or proteins). Suitable peptide MS and MS/MS techniques and systems are well-known per se (see, e.g., Methods in Molecular Biology, vol. 146: “Mass Spectrometry of Proteins and Peptides”, by Chapman, ed., Humana Press 2000, ISBN 089603609x; Biemann 1990. Methods Enzymol 193: 455-79; or Methods in Enzymology, vol. 402: “Biological Mass Spectrometry”, by Burlingame, ed., Academic Press 2005, ISBN 9780121828073) and may be used herein. MS arrangements, instruments and systems suitable for biomarker peptide analysis may include, without limitation, matrix-assisted laser desorption/ionisation time-of-flight (MALDI-TOF) MS; MALDI-TOF post-source-decay (PSD); MALDI-TOF/TOF; surface-enhanced laser desorption/ionization time-of-flight mass spectrometry (SELDI-TOF) MS; electrospray ionization mass spectrometry (ESI-MS); ESI-MS/MS; ESI-MS/(MS)n (n is an integer greater than zero); ESI 3D or linear (2D) ion trap MS; ESI triple quadrupole MS; ESI quadrupole orthogonal TOF (Q-TOF); ESI Fourier transform MS systems; desorption/ionization on silicon (DIOS); secondary ion mass spectrometry (SIMS); atmospheric pressure chemical ionization mass spectrometry (APCI-MS); APCI-MS/MS; APCI-(MS)n; atmospheric pressure photoionization mass spectrometry (APPI-MS); APPI-MS/MS; and APPI-(MS)n. Peptide ion fragmentation in tandem MS (MS/MS) arrangements may be achieved using manners established in the art, such as, e.g., collision induced dissociation (CID). Detection and quantification of markers by mass spectrometry may involve multiple reaction monitoring (MRM), such as described among others by Kuhn et al. 2004 (Proteomics 4: 1175-86). MS peptide analysis methods may be advantageously combined with upstream peptide or protein separation or fractionation methods, such as for example with the chromatographic and other methods.
[0213] In other example embodiments, detection of a marker may include chromatography methods. In a one example embodiment, chromatography refers to a process in which a mixture of substances (analytes) carried by a moving stream of liquid or gas (“mobile phase”) is separated into components as a result of differential distribution of the analytes, as they flow around or over a stationary liquid or solid phase (“stationary phase”), between said mobile phase and said stationary phase. The stationary phase may be usually a finely divided solid, a sheet of filter material, or a thin film of a liquid on the surface of a solid, or the like. Chromatography may be columnar. While particulars of chromatography are well known in the art, for further guidance see, e.g., Meyer M., 1998, ISBN: 047198373X, and “Practical HPLC Methodology and Applications”, Bidlingmeyer, B. A., John Wiley & Sons Inc., 1993. Exemplary types of chromatography include, without limitation, high-performance liquid chromatography (HPLC), normal phase HPLC (NP-HPLC), reversed phase HPLC (RP-HPLC), ion exchange chromatography (IEC), such as cation or anion exchange chromatography, hydrophilic interaction chromatography (HILIC), hydrophobic interaction chromatography (HIC), size exclusion chromatography (SEC) including gel filtration chromatography or gel permeation chromatography, chromatofocusing, affinity chromatography such as immunoaffinity, immobilized metal affinity chromatography, and the like.
[0214] In certain embodiments, further techniques for separating, detecting and/or quantifying markers may be used in conjunction with any of the above described detection methods. Such methods include, without limitation, chemical extraction partitioning, isoelectric focusing (IEF) including capillary isoelectric focusing (CIEF), capillary isotachophoresis (CITP), capillary electrochromatography (CEC), and the like, one-dimensional polyacrylamide gel electrophoresis (PAGE), two-dimensional polyacrylamide gel electrophoresis (2D-PAGE), capillary gel electrophoresis (CGE), capillary zone electrophoresis (CZE), micellar electrokinetic chromatography (MEKC), free flow electrophoresis (FFE), etc.
[0215] In certain examples, such methods may include separating, detecting and/or quantifying markers at the nucleic acid level, more particularly RNA level, e.g., at the level of hnRNA, pre-mRNA, mRNA, or cDNA. Standard quantitative RNA or cDNA measurement tools known in the art may be used. Non-limiting examples include hybridization-based analysis, microarray expression analysis, digital gene expression profiling (DGE), RNA-in-situ hybridization (RISH), Northern-blot analysis and the like; PCR, RT-PCR, RT-qPCR, end-point PCR, digital PCR or the like; supported oligonucleotide detection, pyrosequencing, polony cyclic sequencing by synthesis, simultaneous bi-directional sequencing, single-molecule sequencing, single molecule real time sequencing, true single molecule sequencing, hybridization-assisted nanopore sequencing, sequencing by synthesis, single-cell RNA sequencing (sc-RNA seq), or the like.
[0216] In certain embodiments, the invention involves single cell RNA sequencing (see, e.g., Kalisky, T., Blainey, P. & Quake, S. R. Genomic Analysis at the Single-Cell Level. Annual review of genetics 45, 431-445, (2011); Kalisky, T. & Quake, S. R. Single-cell genomics. Nature Methods 8, 311-314 (2011); Islam, S. et al. Characterization of the single-cell transcriptional landscape by highly multiplex RNA-seq. Genome Research, (2011); Tang, F. et al. RNA-Seq analysis to capture the transcriptome landscape of a single cell. Nature Protocols 5, 516-535, (2010); Tang, F. et al. mRNA-Seq whole-transcriptome analysis of a single cell. Nature Methods 6, 377-382, (2009); Ramskold, D. et al. Full-length mRNA-Seq from single-cell levels of RNA and individual circulating tumor cells. Nature Biotechnology 30, 777-782, (2012); and Hashimshony, T., Wagner, F., Sher, N. & Yanai, I. CEL-Seq: Single-Cell RNA-Seq by Multiplexed Linear Amplification. Cell Reports, Cell Reports, Volume 2, Issue 3, p 666-673, 2012).
[0217] In certain embodiments, the invention involves plate based single cell RNA sequencing (see, e.g., Picelli, S. et al., 2014, “Full-length RNA-seq from single cells using Smart-seq2” Nature protocols 9, 171-181, doi:10.1038/nprot.2014.006).
[0218] In certain embodiments, the invention involves high-throughput single-cell RNA-seq. In this regard reference is made to Macosko et al., 2015, “Highly Parallel Genome-wide Expression Profiling of Individual Cells Using Nanoliter Droplets” Cell 161, 1202-1214; International patent application number PCT/US2015/049178, published as WO2016/040476 on Mar. 17, 2016; Klein et al., 2015, “Droplet Barcoding for Single-Cell Transcriptomics Applied to Embryonic Stem Cells” Cell 161, 1187-1201; International patent application number PCT/US2016/027734, published as WO2016168584A1 on Oct. 20, 2016; Zheng, et al., 2016, “Haplotyping germline and cancer genomes with high-throughput linked-read sequencing” Nature Biotechnology 34, 303-311; Zheng, et al., 2017, “Massively parallel digital transcriptional profiling of single cells” Nat. Commun. 8, 14049 doi: 10.1038/ncomms14049; International patent publication number WO2014210353A2; Zilionis, et al., 2017, “Single-cell barcoding and sequencing using droplet microfluidics” Nat Protoc. January; 12(1):44-73; Cao et al., 2017, “Comprehensive single cell transcriptional profiling of a multicellular organism by combinatorial indexing” bioRxiv preprint first posted online Feb. 2, 2017, doi: dx.doi.org/10.1101/104844; Rosenberg et al., 2017, “Scaling single cell transcriptomics through split pool barcoding” bioRxiv preprint first posted online Feb. 2, 2017, doi: dx.doi.org/10.1101/105163; Rosenberg et al., “Single-cell profiling of the developing mouse brain and spinal cord with split-pool barcoding” Science 15 Mar. 2018; Vitak, et al., “Sequencing thousands of single-cell genomes with combinatorial indexing” Nature Methods, 14(3):302-308, 2017; Cao, et al., Comprehensive single-cell transcriptional profiling of a multicellular organism. Science, 357(6352):661-667, 2017; and Gierahn et al., “Seq-Well: portable, low-cost RNA sequencing of single cells at high throughput” Nature Methods 14, 395-398 (2017), all the contents and disclosure of each of which are herein incorporated by reference in their entirety.
[0219] In certain embodiments, the invention involves single nucleus RNA sequencing. In this regard reference is made to Swiech et al., 2014, “In vivo interrogation of gene function in the mammalian brain using CRISPR-Cas9” Nature Biotechnology Vol. 33, pp. 102-106; Habib et al., 2016, “Div-Seq: Single-nucleus RNA-Seq reveals dynamics of rare adult newborn neurons” Science, Vol. 353, Issue 6302, pp. 925-928; Habib et al., 2017, “Massively parallel single-nucleus RNA-seq with DroNc-seq” Nat Methods. 2017 October; 14(10):955-958; and International patent application number PCT/US2016/059239, published as WO2017164936 on Sep. 28, 2017, which are herein incorporated by reference in their entirety.
[0220] In one embodiment, immune cells are stained for immune cell subtype specific signature genes. In one embodiment, the cells are fixed. In another embodiment, the cells are formalin fixed and paraffin embedded. In another example embodiment, the immune cell subtypes may be quantitated in a section of a tumor.
[0221] The method may allow to detect or conclude the presence or absence of the specified immune cells in a tested object (e.g., in a cell population, tissue, organ, organism, or in a biological sample of a subject). The method may also allow to quantify the specified immune cells in a tested object (e.g., in a cell population, tissue, organ, organism, or in a biological sample of a subject). The quantity of the specified immune cells in the tested object such as the biological sample may be suitably expressed for example as the number (count) of the specified immune cells per standard unit of volume (e.g., ml, μl or nl) or weight (e.g., g or mg or ng) of the tested object such as the biological sample. The quantity of the specified immune cells in the tested object such as the biological sample may also be suitably expressed as a percentage or fraction (by number) of all cells comprised in the tested object such as the biological sample, or as a percentage or fraction (by number) of a select subset of the cells comprised in the tested object such as the biological sample, e.g., as a percentage or fraction (by number) of white blood cells, peripheral blood mononuclear cells, immune cells, antigen presenting cells, or dendritic cells comprised in the tested object such as the biological sample. The quantity of the specified immune cells in the tested object such as the biological sample may also be suitably represented by an absolute or relative quantity of a suitable surrogate analyte, such as a peptide, polypeptide, protein, or nucleic acid expressed or comprised by the specified immune cells.
[0222] Where a marker is detected in or on a cell, the cell may be conventionally denoted as positive (+) or negative (−) for the marker. Semi-quantitative denotations of marker expression in cells are also commonplace in the art, such as particularly in flow cytometry quantifications, for example, “dim” vs. “bright”, or “low” vs. “medium”/“intermediate” vs. “high”, or “−” vs. “+” vs. “++”, commonly controlled in flow cytometry quantifications by setting of the gates. Where a marker is quantified in or on a cell, absolute quantity of the marker may also be expressed for example as the number of molecules of the marker comprised by the cell.
[0223] Where a marker is detected and/or quantified on a single cell level in a cell population, the quantity of the marker may also be expressed as a percentage or fraction (by number) of cells comprised in said population that are positive for said marker, or as percentages or fractions (by number) of cells comprised in said population that are “dim” or “bright”, or that are “low” or “medium”/“intermediate” or “high”, or that are “−” or “+” or “++”. By means of an example, a sizeable proportion of the tested cells of the cell population may be positive for the marker, e.g., at least about 20%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, or up to 100%.
[0224] In certain embodiments, methods for detecting, quantifying or isolating the specified immune cells may be single-cell-based, i.e., may allow to discretely detect, quantify or isolate the specified immune cells as individual cells. In other embodiments, methods for detecting, quantifying or isolating the specified immune cells may be cell population-based, i.e., may only allow to detect, quantify or isolate the specified immune cells as a group or collection of cells, without providing information on or allowing to isolate individual cells.
[0225] Methods for detecting, quantifying or isolating the specified immune cells may employ any of the above-described techniques for measuring markers, insofar the separation or the qualitative and/or quantitative measurement of the marker(s) can be correlated with or translated into detection, quantification or isolation of the specified immune cells. For example, any of the above-described biochemical assay methods, immunological assay methods, mass spectrometry analysis methods, chromatography methods, or nucleic acid analysis method, or combinations thereof for measuring markers, may be employed for detecting, quantifying or isolating the specified immune cells.
[0226] In certain embodiments, the cells are detected, quantified or isolated using a technique selected from the group consisting of flow cytometry, fluorescence activated cell sorting, mass cytometry, fluorescence microscopy, affinity separation, magnetic cell separation, microfluidic separation, and combinations thereof.
[0227] Flow cytometry encompasses methods by which individual cells of a cell population are analyzed by their optical properties (e.g., light absorbance, light scattering and fluorescence properties, etc.) as they pass in a narrow stream in single file through a laser beam. Flow cytometry methods include fluorescence activated cell sorting (FACS) methods by which a population of cells having particular optical properties are separated from other cells.
[0228] Elemental mass spectrometry-based flow cytometry, or mass cytometry, offers an approach to analyze cells by replacing fluorochrome-labelled binding reagents with mass tagged binding reagents, i.e., tagged with an element or isotope having a defined mass. In these methods, labeled particles are introduced into a mass cytometer, where they are individually atomized and ionized. The individual particles are then subjected to elemental analysis, which identifies and measures the abundance of the mass tags used. The identities and the amounts of the isotopic elements associated with each particle are then stored and analyzed. Due to the resolution of elemental analysis and the number of elemental isotopes that can be used, it is possible to simultaneously measure up to 100 or more parameters on a single particle.
[0229] Fluorescence microscopy broadly encompasses methods by which individual cells of a cell population are microscopically analyzed by their fluorescence properties. Fluorescence microscopy approaches may be manual or preferably automated.
[0230] Affinity separation also referred to as affinity chromatography broadly encompasses techniques involving specific interactions of cells present in a mobile phase, such as a suitable liquid phase (e.g., cell population in an aqueous suspension) with, and thereby adsorption of the cells to, a stationary phase, such as a suitable solid phase; followed by separation of the stationary phase from the remainder of the mobile phase; and recovery (e.g., elution) of the adsorbed cells from the stationary phase. Affinity separation may be columnar, or alternatively, may entail batch treatment, wherein the stationary phase is collected/separated from the liquid phases by suitable techniques, such as centrifugation or application of magnetic field (e.g., where the stationary phase comprises magnetic substrate, such as magnetic particles or beads). Accordingly, magnetic cell separation is also envisaged herein.
[0231] Microfluidic systems allow for accurate and high throughput cell detection, quantification and/or sorting, exploiting a variety of physical principles. Cell sorting on microchips provides numerous advantages by reducing the size of necessary equipment, eliminating potentially biohazardous aerosols, and simplifying the complex protocols commonly associated with cell sorting. The term “microfluidic system” as used throughout this specification broadly refers to systems having one or more fluid microchannels. Microchannels denote fluid channels having cross-sectional dimensions the largest of which are typically less than 1 mm, preferably less than 500 m, more preferably less than 400 m, more preferably less than 300 m, more preferably less than 200 m, e.g., 100 m or smaller. Such microfluidic systems can be used for manipulating fluid and/or objects such as droplets, bubbles, capsules, particles, cells and the like. Microfluidic systems may allow for example for fluorescent label-based (e.g., employing fluorophore-conjugated binding agent(s), such as fluorophore-conjugated antibody(ies)), bead-based (e.g., bead-conjugated binding agent(s), such as bead-conjugated antibody(ies)), or label-free cell sorting (reviewed in Shields et al., Lab Chip. 2015, vol. 15: 1230-1249).
Use of Specific Binding Agents
[0232] In certain embodiments, the aforementioned methods and techniques may employ agent(s) capable of specifically binding to one or more gene products, e.g., peptides, polypeptides, proteins, or nucleic acids, expressed or not expressed by the immune cells as taught herein. In certain preferred embodiments, such one or more gene products, e.g., peptides, polypeptides, or proteins, may be expressed on the cell surface of the immune cells (i.e., cell surface markers, e.g., transmembrane peptides, polypeptides or proteins, or secreted peptides, polypeptides or proteins which remain associated with the cell surface). Hence, further disclosed are binding agents capable of specifically binding to markers, such as genes or gene products, e.g., peptides, polypeptides, proteins, or nucleic acids as taught herein. Binding agents as intended throughout this specification may include inter alia antibodies, aptamers, spiegelmers (L-aptamers), photoaptamers, protein, peptides, peptidomimetics, nucleic acids such as oligonucleotides (e.g., hybridization probes or amplification or sequencing primers and primer pairs), small molecules, or combinations thereof.
[0233] The term “aptamer” refers to single-stranded or double-stranded oligo-DNA, oligo-RNA or oligo-DNA/RNA or any analogue thereof that specifically binds to a target molecule such as a peptide. Advantageously, aptamers display fairly high specificity and affinity (e.g., K.sub.A in the order 1×10.sup.9 M.sup.−1) for their targets. Aptamer production is described inter alia in U.S. Pat. No. 5,270,163; Ellington & Szostak 1990 (Nature 346: 818-822); Tuerk & Gold 1990 (Science 249: 505-510); or “The Aptamer Handbook: Functional Oligonucleotides and Their Applications”, by Klussmann, ed., Wiley-VCH 2006, ISBN 3527310592, incorporated by reference herein. The term “photoaptamer” refers to an aptamer that contains one or more photoreactive functional groups that can covalently bind to or crosslink with a target molecule. The term “spiegelmer” refers to an aptamer which includes L-DNA, L-RNA, or other left-handed nucleotide derivatives or nucleotide-like molecules. Aptamers containing left-handed nucleotides are resistant to degradation by naturally occurring enzymes, which normally act on substrates containing right-handed nucleotides. The term “peptidomimetic” refers to a non-peptide agent that is a topological analogue of a corresponding peptide. Methods of rationally designing peptidomimetics of peptides are known in the art. For example, the rational design of three peptidomimetics based on the sulphated 8-mer peptide CCK26-33, and of two peptidomimetics based on the 11-mer peptide Substance P, and related peptidomimetic design principles, are described in Horwell 1995 (Trends Biotechnol 13: 132-134).
[0234] Binding agents may be in various forms, e.g., lyophilised, free in solution, or immobilised on a solid phase. They may be, e.g., provided in a multi-well plate or as an array or microarray, or they may be packaged separately, individually, or in combination.
[0235] The term “specifically bind” as used throughout this specification means that an agent (denoted herein also as “specific-binding agent”) binds to one or more desired molecules or analytes (e.g., peptides, polypeptides, proteins, or nucleic acids) substantially to the exclusion of other molecules which are random or unrelated, and optionally substantially to the exclusion of other molecules that are structurally related. The term “specifically bind” does not necessarily require that an agent binds exclusively to its intended target(s). For example, an agent may be said to specifically bind to target(s) of interest if its affinity for such intended target(s) under the conditions of binding is at least about 2-fold greater, preferably at least about 5-fold greater, more preferably at least about 10-fold greater, yet more preferably at least about 25-fold greater, still more preferably at least about 50-fold greater, and even more preferably at least about 100-fold, or at least about 1000-fold, or at least about 104-fold, or at least about 105-fold, or at least about 106-fold or more greater, than its affinity for a non-target molecule, such as for a suitable control molecule (e.g., bovine serum albumin, casein).
[0236] Preferably, the specific binding agent may bind to its intended target(s) with affinity constant (K.sub.A) of such binding K.sub.A≥1×10.sup.6 M.sup.−1, more preferably K.sub.A≥1×10.sup.7 M.sup.−1, yet more preferably K.sub.A≥1×108 M.sup.−1, even more preferably K.sub.A≥1×10.sup.9 M.sup.−1, and still more preferably K.sub.A≥1×10.sup.10 M.sup.−1 or K.sub.A≥1×10.sup.11 M.sup.−1 or K.sub.A≥1×10.sup.12 M.sup.−1, wherein K.sub.A=[SBA_T]/[SBA][T], SBA denotes the specific-binding agent, T denotes the intended target. Determination of K.sub.A can be carried out by methods known in the art, such as for example, using equilibrium dialysis and Scatchard plot analysis.
[0237] In certain embodiments, the one or more binding agents may be one or more antibodies. As used herein, the term “antibody” is used in its broadest sense and generally refers to any immunologic binding agent. The term specifically encompasses intact monoclonal antibodies, polyclonal antibodies, multivalent (e.g., 2-, 3- or more-valent) and/or multi-specific antibodies (e.g., bi- or more-specific antibodies) formed from at least two intact antibodies, and antibody fragments insofar they exhibit the desired biological activity (particularly, ability to specifically bind an antigen of interest, i.e., antigen-binding fragments), as well as multivalent and/or multi-specific composites of such fragments. The term “antibody” is not only inclusive of antibodies generated by methods comprising immunization, but also includes any polypeptide, e.g., a recombinantly expressed polypeptide, which is made to encompass at least one complementarity-determining region (CDR) capable of specifically binding to an epitope on an antigen of interest. Hence, the term applies to such molecules regardless whether they are produced in vitro or in vivo. Antibodies also encompasses chimeric, humanized and fully humanized antibodies.
[0238] An antibody may be any of IgA, IgD, IgE, IgG and IgM classes, and preferably IgG class antibody. An antibody may be a polyclonal antibody, e.g., an antiserum or immunoglobulins purified there from (e.g., affinity-purified). An antibody may be a monoclonal antibody or a mixture of monoclonal antibodies. Monoclonal antibodies can target a particular antigen or a particular epitope within an antigen with greater selectivity and reproducibility. By means of example and not limitation, monoclonal antibodies may be made by the hybridoma method first described by Kohler et al. 1975 (Nature 256: 495), or may be made by recombinant DNA methods (e.g., as in U.S. Pat. No. 4,816,567). Monoclonal antibodies may also be isolated from phage antibody libraries using techniques as described by Clackson et al. 1991 (Nature 352: 624-628) and Marks et al. 1991 (J Mol Biol 222: 581-597), for example.
[0239] Antibody binding agents may be antibody fragments. “Antibody fragments” comprise a portion of an intact antibody, comprising the antigen-binding or variable region thereof. Examples of antibody fragments include Fab, Fab′, F(ab′)2, Fv and scFv fragments, single domain (sd) Fv, such as VH domains, VL domains and VHH domains; diabodies; linear antibodies; single-chain antibody molecules, in particular heavy-chain antibodies; and multivalent and/or multispecific antibodies formed from antibody fragment(s), e.g., dibodies, tribodies, and multibodies. The above designations Fab, Fab′, F(ab′)2, Fv, scFv etc. are intended to have their art-established meaning.
[0240] The term antibody includes antibodies originating from or comprising one or more portions derived from any animal species, preferably vertebrate species, including, e.g., birds and mammals. Without limitation, the antibodies may be chicken, turkey, goose, duck, guinea fowl, quail or pheasant. Also without limitation, the antibodies may be human, murine (e.g., mouse, rat, etc.), donkey, rabbit, goat, sheep, guinea pig, camel (e.g., Camelus bactrianus and Camelus dromaderius), llama (e.g., Lama paccos, Lama glama or Lama vicugna) or horse.
[0241] A skilled person will understand that an antibody can include one or more amino acid deletions, additions and/or substitutions (e.g., conservative substitutions), insofar such alterations preserve its binding of the respective antigen. An antibody may also include one or more native or artificial modifications of its constituent amino acid residues (e.g., glycosylation, etc.).
[0242] Methods of producing polyclonal and monoclonal antibodies as well as fragments thereof are well known in the art, as are methods to produce recombinant antibodies or fragments thereof (see for example, Harlow and Lane, “Antibodies: A Laboratory Manual”, Cold Spring Harbour Laboratory, New York, 1988; Harlow and Lane, “Using Antibodies: A Laboratory Manual”, Cold Spring Harbour Laboratory, New York, 1999, ISBN 0879695447; “Monoclonal Antibodies: A Manual of Techniques”, by Zola, ed., CRC Press 1987, ISBN 0849364760; “Monoclonal Antibodies: A Practical Approach”, by Dean & Shepherd, eds., Oxford University Press 2000, ISBN 0199637229; Methods in Molecular Biology, vol. 248: “Antibody Engineering: Methods and Protocols”, Lo, ed., Humana Press 2004, ISBN 1588290921).
[0243] As used herein, a “blocking” antibody or an antibody “antagonist” is one which inhibits or reduces biological activity of the antigen(s) it binds. In certain embodiments, the blocking antibodies or antagonist antibodies or portions thereof described herein completely inhibit the biological activity of the antigen(s).
[0244] Antibodies may act as agonists or antagonists of the recognized polypeptides. For example, the present invention includes antibodies which disrupt receptor/ligand interactions either partially or fully. The invention features both receptor-specific antibodies and ligand-specific antibodies. The invention also features receptor-specific antibodies which do not prevent ligand binding but prevent receptor activation. Receptor activation (i.e., signaling) may be determined by techniques described herein or otherwise known in the art. For example, receptor activation can be determined by detecting the phosphorylation (e.g., tyrosine or serine/threonine) of the receptor or of one of its down-stream substrates by immunoprecipitation followed by western blot analysis. In specific embodiments, antibodies are provided that inhibit ligand activity or receptor activity by at least 95%, at least 90%, at least 85%, at least 80%, at least 75%, at least 70%, at least 60%, or at least 50% of the activity in absence of the antibody.
[0245] The invention also features receptor-specific antibodies which both prevent ligand binding and receptor activation as well as antibodies that recognize the receptor-ligand complex. Likewise, encompassed by the invention are neutralizing antibodies which bind the ligand and prevent binding of the ligand to the receptor, as well as antibodies which bind the ligand, thereby preventing receptor activation, but do not prevent the ligand from binding the receptor. Further included in the invention are antibodies which activate the receptor. These antibodies may act as receptor agonists, i.e., potentiate or activate either all or a subset of the biological activities of the ligand-mediated receptor activation, for example, by inducing dimerization of the receptor. The antibodies may be specified as agonists, antagonists or inverse agonists for biological activities comprising the specific biological activities of the peptides disclosed herein. The antibody agonists and antagonists can be made using methods known in the art. See, e.g., PCT publication WO 96/40281; U.S. Pat. No. 5,811,097; Deng et al., Blood 92(6):1981-1988 (1998); Chen et al., Cancer Res. 58(16):3668-3678 (1998); Harrop et al., J. Immunol. 161(4):1786-1794 (1998); Zhu et al., Cancer Res. 58(15):3209-3214 (1998); Yoon et al., J. Immunol. 160(7):3170-3179 (1998); Prat et al., J. Cell. Sci. III (Pt2):237-247 (1998); Pitard et al., J. Immunol. Methods 205(2):177-190 (1997); Liautard et al., Cytokine 9(4):233-241 (1997); Carlson et al., J. Biol. Chem. 272(17):11295-11301 (1997); Taryman et al., Neuron 14(4):755-762 (1995); Muller et al., Structure 6(9):1153-1167 (1998); Bartunek et al., Cytokine 8(1):14-20 (1996).
[0246] The antibodies as defined for the present invention include derivatives that are modified, i.e., by the covalent attachment of any type of molecule to the antibody such that covalent attachment does not prevent the antibody from generating an anti-idiotypic response. For example, but not by way of limitation, the antibody derivatives include antibodies that have been modified, e.g., by glycosylation, acetylation, pegylation, phosphylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein, etc. Any of numerous chemical modifications may be carried out by known techniques, including, but not limited to specific chemical cleavage, acetylation, formylation, metabolic synthesis of tunicamycin, etc. Additionally, the derivative may contain one or more non-classical amino acids.
[0247] Simple binding assays can be used to screen for or detect agents that bind to a target protein, or disrupt the interaction between proteins (e.g., a receptor and a ligand). Because certain targets of the present invention are transmembrane proteins, assays that use the soluble forms of these proteins rather than full-length protein can be used, in some embodiments. Soluble forms include, for example, those lacking the transmembrane domain and/or those comprising the IgV domain or fragments thereof which retain their ability to bind their cognate binding partners. Further, agents that inhibit or enhance protein interactions for use in the compositions and methods described herein, can include recombinant peptido-mimetics.
[0248] Detection methods useful in screening assays include antibody-based methods, detection of a reporter moiety, detection of cytokines as described herein, and detection of a gene signature as described herein.
[0249] Another variation of assays to determine binding of a receptor protein to a ligand protein is through the use of affinity biosensor methods. Such methods may be based on the piezoelectric effect, electrochemistry, or optical methods, such as ellipsometry, optical wave guidance, and surface plasmon resonance (SPR).
[0250] The term “antibody-like protein scaffolds” or “engineered protein scaffolds” broadly encompasses proteinaceous non-immunoglobulin specific-binding agents, typically obtained by combinatorial engineering (such as site-directed random mutagenesis in combination with phage display or other molecular selection techniques). Usually, such scaffolds are derived from robust and small soluble monomeric proteins (such as Kunitz inhibitors or lipocalins) or from a stably folded extra-membrane domain of a cell surface receptor (such as protein A, fibronectin or the ankyrin repeat).
[0251] Such scaffolds have been extensively reviewed in Binz et al. (Engineering novel binding proteins from nonimmunoglobulin domains. Nat Biotechnol 2005, 23:1257-1268), Gebauer and Skerra (Engineered protein scaffolds as next-generation antibody therapeutics. Curr Opin Chem Biol. 2009, 13:245-55), Gill and Damle (Biopharmaceutical drug discovery using novel protein scaffolds. Curr Opin Biotechnol 2006, 17:653-658), Skerra (Engineered protein scaffolds for molecular recognition. J Mol Recognit 2000, 13:167-187), and Skerra (Alternative non-antibody scaffolds for molecular recognition. Curr Opin Biotechnol 2007, 18:295-304), and include without limitation affibodies, based on the Z-domain of staphylococcal protein A, a three-helix bundle of 58 residues providing an interface on two of its alpha-helices (Nygren, Alternative binding proteins: Affibody binding proteins developed from a small three-helix bundle scaffold. FEBS J 2008, 275:2668-2676); engineered Kunitz domains based on a small (ca. 58 residues) and robust, disulphide-crosslinked serine protease inhibitor, typically of human origin (e.g. LACI-D1), which can be engineered for different protease specificities (Nixon and Wood, Engineered protein inhibitors of proteases. Curr Opin Drug Discov Dev 2006, 9:261-268); monobodies or adnectins based on the 10th extracellular domain of human fibronectin III (1° F.n3), which adopts an Ig-like beta-sandwich fold (94 residues) with 2-3 exposed loops, but lacks the central disulphide bridge (Koide and Koide, Monobodies: antibody mimics based on the scaffold of the fibronectin type III domain. Methods Mol Biol 2007, 352:95-109); anticalins derived from the lipocalins, a diverse family of eight-stranded beta-barrel proteins (ca. 180 residues) that naturally form binding sites for small ligands by means of four structurally variable loops at the open end, which are abundant in humans, insects, and many other organisms (Skerra, Alternative binding proteins: Anticalins harnessing the structural plasticity of the lipocalin ligand pocket to engineer novel binding activities. FEBS J 2008, 275:2677-2683); DARPins, designed ankyrin repeat domains (166 residues), which provide a rigid interface arising from typically three repeated beta-turns (Stumpp et al., DARPins: a new generation of protein therapeutics. Drug Discov Today 2008, 13:695-701); avimers (multimerized LDLR-A module) (Silverman et al., Multivalent avimer proteins evolved by exon shuffling of a family of human receptor domains. Nat Biotechnol 2005, 23:1556-1561); and cysteine-rich knottin peptides (Kolmar, Alternative binding proteins: biological activity and therapeutic potential of cystine-knot miniproteins. FEBS J 2008, 275:2684-2690).
[0252] Nucleic acid binding agents, such as oligonucleotide binding agents, are typically at least partly antisense to a target nucleic acid of interest. The term “antisense” generally refers to an agent (e.g., an oligonucleotide) configured to specifically anneal with (hybridize to) a given sequence in a target nucleic acid, such as for example in a target DNA, hnRNA, pre-mRNA or mRNA, and typically comprises, consist essentially of or consist of a nucleic acid sequence that is complementary or substantially complementary to said target nucleic acid sequence. Antisense agents suitable for use herein, such as hybridisation probes or amplification or sequencing primers and primer pairs) may typically be capable of annealing with (hybridizing to) the respective target nucleic acid sequences at high stringency conditions, and capable of hybridizing specifically to the target under physiological conditions. The terms “complementary” or “complementarity” as used throughout this specification with reference to nucleic acids, refer to the normal binding of single-stranded nucleic acids under permissive salt (ionic strength) and temperature conditions by base pairing, preferably Watson-Crick base pairing. By means of example, complementary Watson-Crick base pairing occurs between the bases A and T, A and U or G and C. For example, the sequence 5′-A-G-U-3′ is complementary to sequence 5′-A-C-U-3′.
[0253] The reference to oligonucleotides may in particular but without limitation include hybridization probes and/or amplification primers and/or sequencing primers, etc., as commonly used in nucleic acid detection technologies.
[0254] Binding agents as discussed herein may suitably comprise a detectable label. The term “label” refers to any atom, molecule, moiety or biomolecule that may be used to provide a detectable and preferably quantifiable read-out or property, and that may be attached to or made part of an entity of interest, such as a binding agent. Labels may be suitably detectable by for example mass spectrometric, spectroscopic, optical, colourimetric, magnetic, photochemical, biochemical, immunochemical or chemical means. Labels include without limitation dyes; radiolabels such as .sup.32p, .sup.33p, .sup.35S, .sup.125I, .sup.131I; electron-dense reagents; enzymes (e.g., horse-radish peroxidase or alkaline phosphatase as commonly used in immunoassays); binding moieties such as biotin-streptavidin; haptens such as digoxigenin; luminogenic, phosphorescent or fluorogenic moieties; mass tags; and fluorescent dyes alone or in combination with moieties that may suppress or shift emission spectra by fluorescence resonance energy transfer (FRET).
[0255] In some embodiments, binding agents may be provided with a tag that permits detection with another agent (e.g., with a probe binding partner). Such tags may be, for example, biotin, streptavidin, his-tag, myc tag, maltose, maltose binding protein or any other kind of tag known in the art that has a binding partner. Example of associations which may be utilised in the probe:binding partner arrangement may be any, and includes, for example biotin:streptavidin, his-tag:metal ion (e.g., Ni2+), maltose:maltose binding protein, etc.
[0256] The marker-binding agent conjugate may be associated with or attached to a detection agent to facilitate detection. Examples of detection agents include, but are not limited to, luminescent labels; colourimetric labels, such as dyes; fluorescent labels; or chemical labels, such as electroactive agents (e.g., ferrocyanide); enzymes; radioactive labels; or radiofrequency labels. The detection agent may be a particle. Examples of such particles include, but are not limited to, colloidal gold particles; colloidal sulphur particles; colloidal selenium particles; colloidal barium sulfate particles; colloidal iron sulfate particles; metal iodate particles; silver halide particles; silica particles; colloidal metal (hydrous) oxide particles; colloidal metal sulfide particles; colloidal lead selenide particles; colloidal cadmium selenide particles; colloidal metal phosphate particles; colloidal metal ferrite particles; any of the above-mentioned colloidal particles coated with organic or inorganic layers; protein or peptide molecules; liposomes; or organic polymer latex particles, such as polystyrene latex beads. Preferable particles may be colloidal gold particles.
[0257] In certain embodiments, the one or more binding agents are configured for use in a technique selected from the group consisting of flow cytometry, fluorescence activated cell sorting, mass cytometry, fluorescence microscopy, affinity separation, magnetic cell separation, microfluidic separation, and combinations thereof.
Pharmaceutical Compositions Using Isolated Cells
[0258] In another aspect, the present invention provides for a pharmaceutical composition comprising the CD8.sup.+ T cell or the CD8.sup.+ T cell population as defined in any embodiment herein. In certain embodiments, the CD8.sup.+ T cell or the CD8.sup.+ T cell population may be formulated into a pharmaceutical composition.
[0259] In certain embodiments, the immune cell or immune cell population is autologous to said subject, i.e., the immune cell or immune cell population is isolated from the same subject as the subject to which/whom the immune cell or immune cell population is to be administered. In certain further embodiments, the immune cell or immune cell population is syngeneic to said subject, i.e., the immune cell or immune cell population is isolated from an identical twin of the subject to which/whom the immune cell or immune cell population is to be administered. In certain further embodiments, the immune cell or immune cell population is allogeneic to said subject, i.e., the immune cell or immune cell population is isolated from a different subject of the same species as the subject to which/whom the immune cell or immune cell population is to be administered. In certain embodiments, the immune cell or immune cell population may even be xenogeneic to said subject, i.e., the immune cell or immune cell population may be isolated from a subject of a different species than the subject to which/whom the immune cell or immune cell population is to be administered.
[0260] Preferably, non-autologous, such as allogeneic cells may be selected such as to maximize the tissue compatibility between the subject and the administered cells, thereby reducing the chance of rejection of the administered cells by patient's immune system or graft-vs.-host reaction. For example, advantageously the cells may be typically selected which have either identical HLA haplotypes (including one or preferably more HLA-A, HLA-B, HLA-C, HLA-D, HLA-DR, HLA-DP and HLA-DQ) to the subject, or which have the most HLA antigen alleles common to the subject and none or the least of HLA antigens to which the subject contains pre-existing anti-HLA antibodies. In certain embodiments, allogenic T cells may be modified to prevent rejection from an allogenic healthy donor (described further herein).
[0261] A “pharmaceutical composition” refers to a composition that usually contains an excipient, such as a pharmaceutically acceptable carrier that is conventional in the art and that is suitable for administration to cells or to a subject.
[0262] The term “pharmaceutically acceptable” as used throughout this specification is consistent with the art and means compatible with the other ingredients of a pharmaceutical composition and not deleterious to the recipient thereof.
[0263] As used herein, “carrier” or “excipient” includes any and all solvents, diluents, buffers (such as, e.g., neutral buffered saline or phosphate buffered saline), solubilizers, colloids, dispersion media, vehicles, fillers, chelating agents (such as, e.g., EDTA or glutathione), amino acids (such as, e.g., glycine), proteins, disintegrants, binders, lubricants, wetting agents, emulsifiers, sweeteners, colorants, flavorings, aromatizers, thickeners, agents for achieving a depot effect, coatings, antifungal agents, preservatives, stabilizers, antioxidants, tonicity controlling agents, absorption delaying agents, and the like. The use of such media and agents for pharmaceutical active components is well known in the art. Such materials should be non-toxic and should not interfere with the activity of the cells or active components.
[0264] The precise nature of the carrier or excipient or other material will depend on the route of administration. For example, the composition may be in the form of a parenterally acceptable aqueous solution, which is pyrogen-free and has suitable pH, isotonicity and stability. For general principles in medicinal formulation, the reader is referred to Cell Therapy: Stem Cell Transplantation, Gene Therapy, and Cellular Immunotherapy, by G. Morstyn & W. Sheridan eds., Cambridge University Press, 1996; and Hematopoietic Stem Cell Therapy, E. D. Ball, J. Lister & P. Law, Churchill Livingstone, 2000.
[0265] The pharmaceutical composition can be applied parenterally, rectally, orally or topically. Preferably, the pharmaceutical composition may be used for intravenous, intramuscular, subcutaneous, peritoneal, peridural, rectal, nasal, pulmonary, mucosal, or oral application. In a preferred embodiment, the pharmaceutical composition according to the invention is intended to be used as an infusion. The skilled person will understand that compositions which are to be administered orally or topically will usually not comprise cells, although it may be envisioned for oral compositions to also comprise cells, for example when gastro-intestinal tract indications are treated. Each of the cells or active components (e.g., immunomodulants) as discussed herein may be administered by the same route or may be administered by a different route. By means of example, and without limitation, cells may be administered parenterally and other active components may be administered orally.
[0266] Liquid pharmaceutical compositions may generally include a liquid carrier such as water or a pharmaceutically acceptable aqueous solution. For example, physiological saline solution, tissue or cell culture media, dextrose or other saccharide solution or glycols such as ethylene glycol, propylene glycol or polyethylene glycol may be included.
[0267] The composition may include one or more cell protective molecules, cell regenerative molecules, growth factors, anti-apoptotic factors or factors that regulate gene expression in the cells. Such substances may render the cells independent of their environment.
[0268] Such pharmaceutical compositions may contain further components ensuring the viability of the cells therein. For example, the compositions may comprise a suitable buffer system (e.g., phosphate or carbonate buffer system) to achieve desirable pH, more usually near neutral pH, and may comprise sufficient salt to ensure isoosmotic conditions for the cells to prevent osmotic stress. For example, suitable solution for these purposes may be phosphate-buffered saline (PBS), sodium chloride solution, Ringer's Injection or Lactated Ringer's Injection, as known in the art. Further, the composition may comprise a carrier protein, e.g., albumin (e.g., bovine or human albumin), which may increase the viability of the cells.
[0269] Further suitably pharmaceutically acceptable carriers or additives are well known to those skilled in the art and for instance may be selected from proteins such as collagen or gelatine, carbohydrates such as starch, polysaccharides, sugars (dextrose, glucose and sucrose), cellulose derivatives like sodium or calcium carboxymethylcellulose, hydroxypropyl cellulose or hydroxypropylmethyl cellulose, pregeletanized starches, pectin agar, carrageenan, clays, hydrophilic gums (acacia gum, guar gum, arabic gum and xanthan gum), alginic acid, alginates, hyaluronic acid, polyglycolic and polylactic acid, dextran, pectins, synthetic polymers such as water-soluble acrylic polymer or polyvinylpyrrolidone, proteoglycans, calcium phosphate and the like.
[0270] In certain embodiments, a pharmaceutical cell preparation as taught herein may be administered in a form of liquid composition. In embodiments, the cells or pharmaceutical composition comprising such can be administered systemically, topically, within an organ or at a site of organ dysfunction or lesion.
[0271] Preferably, the pharmaceutical compositions may comprise a therapeutically effective amount of the specified immune cells and/or other active components (e.g., immunomodulants). The term “therapeutically effective amount” refers to an amount which can elicit a biological or medicinal response in a tissue, system, animal or human that is being sought by a researcher, veterinarian, medical doctor or other clinician, and in particular can prevent or alleviate one or more of the local or systemic symptoms or features of a disease or condition being treated.
Activated T Cell Compositions
[0272] A further aspect of the invention relates to a method for preparing a composition comprising activated T cells, the method comprising depleting suppressive T cells from a biological sample of a subject and contacting the remaining T cells in vitro with an immune cell or immune cell population, wherein the immune cell or immune cell population has been loaded with an antigen.
[0273] “Activation” generally refers to the state of a cell, such as preferably T cell, following sufficient cell surface moiety ligation (e.g., interaction between the T cell receptor on the surface of a T cell (such as naturally-occurring TCR or genetically engineered TCR, e.g., chimeric antigen receptor, CAR) and MHIC-bound antigen peptide presented on the surface of an antigen presenting cell (e.g., dendritic cell) to induce a noticeable biochemical or morphological change of the cell, such as preferably T cell. In particular, “activation” may refer to the state of a T cell that has been sufficiently stimulated to induce detectable cellular proliferation of the T cell. Activation can also encompass induced cytokine production, and detectable T cell effector functions, e.g., regulatory or cytolytic effector functions. The T cells and antigen presenting cells may be suitably contacted by admixing the T cells and antigen presenting cells in an aqueous composition, e.g., in a culture medium, in sufficient numbers and for a sufficient duration of time to produce the desired T cell activation.
[0274] A further aspect of the invention relates to a method for adoptive immunotherapy in a subject in need thereof comprising administering to said subject a composition comprising activated T cells prepared with the method as taught above.
[0275] In certain embodiments, said T cells are CD8.sup.+ T cells, i.e., T cells expressing the CD8+ cell surface marker. More preferably, said T cells may be CD8.sup.+ T cells and said subject is suffering from proliferative disease.
[0276] In certain embodiments, the T cell, preferably a CD8.sup.+ T cell, may display specificity to a desired antigen, such as specificity to a tumor antigen (tumor antigen specificity). By means of an example, the T cell, preferably a CD8.sup.+ T cell, may have been isolated from a tumor of a subject. More preferably, the immune cell may be a tumor infiltrating lymphocyte (TIL). Generally, “tumor infiltrating lymphocytes” or “TILs” refer to white blood cells that have left the bloodstream and migrated into a tumor. Such T cells typically endogenously express a T cell receptor having specificity to an antigen expressed by the tumor cells (tumor antigen specificity).
[0277] In alternative embodiments, a T cell, preferably a CD8.sup.+ T cell, may be engineered to express a T cell receptor having specificity to a desired antigen, such as specificity to a tumor antigen (tumor antigen specificity). For example, the T cell, preferably a CD8.sup.+ T cell, may comprise a chimeric antigen receptor (CAR) having specificity to a desired antigen, such as a tumor-specific chimeric antigen receptor (CAR).
Adoptive Cell Transfer
[0278] In certain embodiments, cells as described herein and below may be used for adoptive cell transfer (ACT). As used herein, “ACT”, “adoptive cell therapy” and “adoptive cell transfer” may be used interchangeably. In certain embodiments, the interaction of immune cells is advantageously used, such as modulating and/or transferring one immune cell subtype to cause an effect in another immune cell subtype. The transferred cells may include and be modulated by immune cells or immune cell populations as taught herein. In certain embodiments, the suppressive T cells of the present invention are depleted from cells used in ACT and the depleted cells may be transferred to a subject suffering from a disease (e.g., cancer). In certain embodiments, the cells of the present invention may be transferred to a subject suffering from a disease characteristic of an over reactive immune response (e.g., autoimmune disease). In certain embodiments, adoptive cell transfer may comprise: isolating from a biological sample of the subject a CD4+ and/or CD8.sup.+ T cell or CD4+ and/or CD8.sup.+ T cell population as described herein; in vitro expanding the T cell or T cell population; and administering the in vitro expanded T cell or T cell population to the subject. The method may further comprise enriching the expanded T cells for one subtype. In certain embodiments, the method may further comprise formulating the in vitro expanded immune cell or immune cell population into a pharmaceutical composition.
[0279] In certain embodiments, Adoptive cell therapy (ACT) can refer to the transfer of cells to a patient with the goal of transferring the functionality and characteristics into the new host by engraftment of the cells (see, e.g., Mettananda et al., Editing an α-globin enhancer in primary human hematopoietic stem cells as a treatment for P-thalassemia, Nat Commun. 2017 Sep. 4; 8(1):424). As used herein, the term “engraft” or “engraftment” refers to the process of cell incorporation into a tissue of interest in vivo through contact with existing cells of the tissue. Adoptive cell therapy (ACT) can refer to the transfer of cells, most commonly immune-derived cells, back into the same patient or into a new recipient host with the goal of transferring the immunologic functionality and characteristics into the new host. If possible, use of autologous cells helps the recipient by minimizing GVHD issues. The adoptive transfer of autologous tumor infiltrating lymphocytes (TIL) (Besser et al., (2010) Clin. Cancer Res 16 (9) 2646-55; Dudley et al., (2002) Science 298 (5594): 850-4; and Dudley et al., (2005) Journal of Clinical Oncology 23 (10): 2346-57.) or genetically re-directed peripheral blood mononuclear cells (Johnson et al., (2009) Blood 114 (3): 535-46; and Morgan et al., (2006) Science 314(5796) 126-9) has been used to successfully treat patients with advanced solid tumors, including melanoma and colorectal carcinoma, as well as patients with CD19-expressing hematologic malignancies (Kalos et al., (2011) Science Translational Medicine 3 (95): 95ra73). In certain embodiments, allogenic cells immune cells are transferred (see, e.g., Ren et al., (2017) Clin Cancer Res 23 (9) 2255-2266). As described further herein, allogenic cells can be edited to reduce alloreactivity and prevent graft-versus-host disease. Thus, use of allogenic cells allows for cells to be obtained from healthy donors and prepared for use in patients as opposed to preparing autologous cells from a patient after diagnosis.
[0280] Aspects of the invention involve the adoptive transfer of immune system cells, such as T cells, specific for selected antigens, such as tumor associated antigens or tumor specific neoantigens (see, e.g., Maus et al., 2014, Adoptive Immunotherapy for Cancer or Viruses, Annual Review of Immunology, Vol. 32: 189-225; Rosenberg and Restifo, 2015, Adoptive cell transfer as personalized immunotherapy for human cancer, Science Vol. 348 no. 6230 pp. 62-68; Restifo et al., 2015, Adoptive immunotherapy for cancer: harnessing the T cell response. Nat. Rev. Immunol. 12(4): 269-281; and Jenson and Riddell, 2014, Design and implementation of adoptive therapy with chimeric antigen receptor-modified T cells. Immunol Rev. 257(1): 127-144; and Rajasagi et al., 2014, Systematic identification of personal tumor-specific neoantigens in chronic lymphocytic leukemia. Blood. 2014 Jul. 17; 124(3):453-62).
[0281] In certain embodiments, an antigen (such as a tumor antigen) to be targeted in adoptive cell therapy (such as particularly CAR or TCR T-cell therapy) of a disease (such as particularly of tumor or cancer) may be selected from a group consisting of: B cell maturation antigen (BCMA) (see, e.g., Friedman et al., Effective Targeting of Multiple BCMA-Expressing Hematological Malignancies by Anti-BCMA CAR T Cells, Hum Gene Ther. 2018 Mar. 8; Berdeja J G, et al. Durable clinical responses in heavily pretreated patients with relapsed/refractory multiple myeloma: updated results from a multicenter study of bb2121 anti-Bcma CAR T cell therapy. Blood. 2017; 130:740; and Mouhieddine and Ghobrial, Immunotherapy in Multiple Myeloma: The Era of CAR T Cell Therapy, Hematologist, May-June 2018, Volume 15, issue 3); PSA (prostate-specific antigen); prostate-specific membrane antigen (PSMA); PSCA (Prostate stem cell antigen); Tyrosine-protein kinase transmembrane receptor ROR1; fibroblast activation protein (FAP); Tumor-associated glycoprotein 72 (TAG72); Carcinoembryonic antigen (CEA); Epithelial cell adhesion molecule (EPCAM); Mesothelin; Human Epidermal growth factor Receptor 2 (ERBB2 (Her2/neu)); Prostase; Prostatic acid phosphatase (PAP); elongation factor 2 mutant (ELF2M); Insulin-like growth factor 1 receptor (IGF-1R); gplOO; BCR-ABL (breakpoint cluster region-Abelson); tyrosinase; New York esophageal squamous cell carcinoma 1 (NY-ESO-1); κ-light chain, LAGE (L antigen); MAGE (melanoma antigen); Melanoma-associated antigen 1 (MAGE-A1); MAGE A3; MAGE A6; legumain; Human papillomavirus (HPV) E6; HPV E7; prostein; survivin; PCTA1 (Galectin 8); Melan-A/MART-1; Ras mutant; TRP-1 (tyrosinase related protein 1, or gp75); Tyrosinase-related Protein 2 (TRP2); TRP-2/INT2 (TRP-2/intron 2); RAGE (renal antigen); receptor for advanced glycation end products 1 (RAGE1); Renal ubiquitous 1, 2 (RU1, RU2); intestinal carboxyl esterase (iCE); Heat shock protein 70-2 (HSP70-2) mutant; thyroid stimulating hormone receptor (TSHR); CD123; CD171; CD19; CD20; CD22; CD26; CD30; CD33; CD44v7/8 (cluster of differentiation 44, exons 7/8); CD53; CD92; CD100; CD148; CD150; CD200; CD261; CD262; CD362; CS-1 (CD2 subset 1, CRACC, SLAMF7, CD319, and 19A24); C-type lectin-like molecule-1 (CLL-1); ganglioside GD3 (aNeu5Ac(2-8)aNeu5Ac(2-3)bDGalp(1-4)bDGlcp(1-1)Cer); Tn antigen (Tn Ag); Fms-Like Tyrosine Kinase 3 (FLT3); CD38; CD138; CD44v6; B7H3 (CD276); KIT (CD117); Interleukin-13 receptor subunit alpha-2 (IL-13Ra2); Interleukin 11 receptor alpha (IL-11Ra); prostate stem cell antigen (PSCA); Protease Serine 21 (PRSS21); vascular endothelial growth factor receptor 2 (VEGFR2); Lewis(Y) antigen; CD24; Platelet-derived growth factor receptor beta (PDGFR-beta); stage-specific embryonic antigen-4 (SSEA-4); Mucin 1, cell surface associated (MUC1); mucin 16 (MUC16); epidermal growth factor receptor (EGFR); epidermal growth factor receptor variant III (EGFRvIII); neural cell adhesion molecule (NCAM); carbonic anhydrase IX (CAIX); Proteasome (Prosome, Macropain) Subunit, Beta Type, 9 (LMP2); ephrin type-A receptor 2 (EphA2); Ephrin B2; Fucosyl GM1; sialyl Lewis adhesion molecule (sLe); ganglioside GM3 (aNeu5Ac(2-3)bDGalp(1-4)bDGlcp(1-1)Cer); TGS5; high molecular weight-melanoma-associated antigen (HMWMAA); o-acetyl-GD2 ganglioside (OAcGD2); Folate receptor alpha; Folate receptor beta; tumor endothelial marker 1 (TEM1/CD248); tumor endothelial marker 7-related (TEM7R); claudin 6 (CLDN6); G protein-coupled receptor class C group 5, member D (GPRC5D); chromosome X open reading frame 61 (CXORF61); CD97; CD179a; anaplastic lymphoma kinase (ALK); Polysialic acid; placenta-specific 1 (PLAC1); hexasaccharide portion of globoH glycoceramide (GloboH); mammary gland differentiation antigen (NY-BR-1); uroplakin 2 (UPK2); Hepatitis A virus cellular receptor 1 (HAVCR1); adrenoceptor beta 3 (ADRB3); pannexin 3 (PANX3); G protein-coupled receptor 20 (GPR20); lymphocyte antigen 6 complex, locus K 9 (LY6K); Olfactory receptor 51E2 (OR51E2); TCR Gamma Alternate Reading Frame Protein (TARP); Wilms tumor protein (WT1); ETS translocation-variant gene 6, located on chromosome 12p (ETV6-AML); sperm protein 17 (SPA17); X Antigen Family, Member 1A (XAGE1); angiopoietin-binding cell surface receptor 2 (Tie 2); CT (cancer/testis (antigen)); melanoma cancer testis antigen-1 (MAD-CT-1); melanoma cancer testis antigen-2 (MAD-CT-2); Fos-related antigen 1; p53; p53 mutant; human Telomerase reverse transcriptase (hTERT); sarcoma translocation breakpoints; melanoma inhibitor of apoptosis (ML-IAP); ERG (transmembrane protease, serine 2 (TMPRSS2) ETS fusion gene); N-Acetyl glucosaminyl-transferase V (NA17); paired box protein Pax-3 (PAX3); Androgen receptor; Cyclin Bi; Cyclin Di; v-myc avian myelocytomatosis viral oncogene neuroblastoma derived homolog (MYCN); Ras Homolog Family Member C (RhoC); Cytochrome P450 1B1 (CYP1B1); CCCTC-Binding Factor (Zinc Finger Protein)-Like (BORIS); Squamous Cell Carcinoma Antigen Recognized By T Cells-1 or 3 (SART1, SART3); Paired box protein Pax-5 (PAX5); proacrosin binding protein sp32 (OY-TES1); lymphocyte-specific protein tyrosine kinase (LCK); A kinase anchor protein 4 (AKAP-4); synovial sarcoma, X breakpoint-1, -2, -3 or -4 (SSX1, SSX2, SSX3, SSX4); CD79a; CD79b; CD72; Leukocyte-associated immunoglobulin-like receptor 1 (LAIR1); Fc fragment of IgA receptor (FCAR); Leukocyte immunoglobulin-like receptor subfamily A member 2 (LILRA2); CD300 molecule-like family member f (CD300LF); C-type lectin domain family 12 member A (CLECi2A); bone marrow stromal cell antigen 2 (BST2); EGF-like module-containing mucin-like hormone receptor-like 2 (EMR2); lymphocyte antigen 75 (LY75); Glypican-3 (GPC3); Fc receptor-like 5 (FCRL5); mouse double minute 2 homolog (MDM2); livin; alphafetoprotein (AFP); transmembrane activator and CAML Interactor (TACI); B-cell activating factor receptor (BAFF-R); V-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog (KRAS); immunoglobulin lambda-like polypeptide 1 (IGLL1); 707-AP (707 alanine proline); ART-4 (adenocarcinoma antigen recognized by T4 cells); BAGE (B antigen; b-catenin/m, b-catenin/mutated); CAMEL (CTL-recognized antigen on melanoma); CAP1 (carcinoembryonic antigen peptide 1); CASP-8 (caspase-8); CDCl27m (cell-division cycle 27 mutated); CDK4/m (cycline-dependent kinase 4 mutated); Cyp-B (cyclophilin B); DAM (differentiation antigen melanoma); EGP-2 (epithelial glycoprotein 2); EGP-40 (epithelial glycoprotein 40); Erbb2, 3, 4 (erythroblastic leukemia viral oncogene homolog-2, -3, 4); FBP (folate binding protein); fAchR (Fetal acetylcholine receptor); G250 (glycoprotein 250); GAGE (G antigen); GnT-V (N-acetylglucosaminyltransferase V); HAGE (helicose antigen); ULA-A (human leukocyte antigen-A); HST2 (human signet ring tumor 2); KIAA0205; KDR (kinase insert domain receptor); LDLR/FUT (low density lipid receptor/GDP L-fucose: b-D-galactosidase 2-a-L fucosyltransferase); L1CAM (L1 cell adhesion molecule); MC1R (melanocortin 1 receptor); Myosin/m (myosin mutated); MUM-1, -2, -3 (melanoma ubiquitous mutated 1, 2, 3); NA88-A (NA cDNA clone of patient M88); KG2D (Natural killer group 2, member D) ligands; oncofetal antigen (h5T4); p190 minor bcr-abl (protein of 190KD bcr-abl); Pml/RARa (promyelocytic leukaemia/retinoic acid receptor a); PRANE (preferentially expressed antigen of melanoma); SAGE (sarcoma antigen); TEL/AML1 (translocation Ets-family leukemia/acute myeloid leukemia 1); TPI/m (triosephosphate isomerase mutated); CD70; and any combination thereof.
[0282] In certain embodiments, an antigen to be targeted in adoptive cell therapy (such as particularly CAR or TCR T-cell therapy) of a disease (such as particularly of tumor or cancer) is a tumor-specific antigen (TSA).
[0283] In certain embodiments, an antigen to be targeted in adoptive cell therapy (such as particularly CAR or TCR T-cell therapy) of a disease (such as particularly of tumor or cancer) is a neoantigen.
[0284] In certain embodiments, an antigen to be targeted in adoptive cell therapy (such as particularly CAR or TCR T-cell therapy) of a disease (such as particularly of tumor or cancer) is a tumor-associated antigen (TAA).
[0285] In certain embodiments, an antigen to be targeted in adoptive cell therapy (such as particularly CAR or TCR T-cell therapy) of a disease (such as particularly of tumor or cancer) is a universal tumor antigen. In certain preferred embodiments, the universal tumor antigen is selected from the group consisting of: a human telomerase reverse transcriptase (hTERT), survivin, mouse double minute 2 homolog (MDM2), cytochrome P450 1B 1 (CYP1B), HER2/neu, Wilms' tumor gene 1 (WT1), livin, alphafetoprotein (AFP), carcinoembryonic antigen (CEA), mucin 16 (MUC16), MUC1, prostate-specific membrane antigen (PSMA), p53, cyclin (D1), and any combinations thereof.
[0286] In certain embodiments, an antigen (such as a tumor antigen) to be targeted in adoptive cell therapy (such as particularly CAR or TCR T-cell therapy) of a disease (such as particularly of tumor or cancer) may be selected from a group consisting of: CD19, BCMA, CD70, CLL-1, MAGE A3, MAGE A6, HPV E6, HPV E7, WT1, CD22, CD171, ROR1, MUC16, and SSX2. In certain preferred embodiments, the antigen may be CD19. For example, CD19 may be targeted in hematologic malignancies, such as in lymphomas, more particularly in B-cell lymphomas, such as without limitation in diffuse large B-cell lymphoma, primary mediastinal b-cell lymphoma, transformed follicular lymphoma, marginal zone lymphoma, mantle cell lymphoma, acute lymphoblastic leukemia including adult and pediatric ALL, non-Hodgkin lymphoma, indolent non-Hodgkin lymphoma, or chronic lymphocytic leukemia. For example, BCMA may be targeted in multiple myeloma or plasma cell leukemia (see, e.g., 2018 American Association for Cancer Research (AACR) Annual meeting Poster: Allogeneic Chimeric Antigen Receptor T Cells Targeting B Cell Maturation Antigen). For example, CLL1 may be targeted in acute myeloid leukemia. For example, MAGE A3, MAGE A6, SSX2, and/or KRAS may be targeted in solid tumors. For example, HPV E6 and/or HPV E7 may be targeted in cervical cancer or head and neck cancer. For example, WT1 may be targeted in acute myeloid leukemia (AML), myelodysplastic syndromes (MDS), chronic myeloid leukemia (CML), non-small cell lung cancer, breast, pancreatic, ovarian or colorectal cancers, or mesothelioma. For example, CD22 may be targeted in B cell malignancies, including non-Hodgkin lymphoma, diffuse large B-cell lymphoma, or acute lymphoblastic leukemia. For example, CD171 may be targeted in neuroblastoma, glioblastoma, or lung, pancreatic, or ovarian cancers. For example, ROR1 may be targeted in ROR1+ malignancies, including non-small cell lung cancer, triple negative breast cancer, pancreatic cancer, prostate cancer, ALL, chronic lymphocytic leukemia, or mantle cell lymphoma. For example, MUC16 may be targeted in MUC16ecto+ epithelial ovarian, fallopian tube or primary peritoneal cancer. For example, CD70 may be targeted in both hematologic malignancies as well as in solid cancers such as renal cell carcinoma (RCC), gliomas (e.g., GBM), and head and neck cancers (HNSCC). CD70 is expressed in both hematologic malignancies as well as in solid cancers, while its expression in normal tissues is restricted to a subset of lymphoid cell types (see, e.g., 2018 American Association for Cancer Research (AACR) Annual meeting Poster: Allogeneic CRISPR Engineered Anti-CD70 CAR-T Cells Demonstrate Potent Preclinical Activity Against Both Solid and Hematological Cancer Cells).
[0287] Various strategies may for example be employed to genetically modify T cells by altering the specificity of the T cell receptor (TCR) for example by introducing new TCR α and β chains with selected peptide specificity (see U.S. Pat. No. 8,697,854; PCT Patent Publications: WO2003020763, WO2004033685, WO2004044004, WO2005114215, WO2006000830, WO2008038002, WO2008039818, WO2004074322, WO2005113595, WO2006125962, WO2013166321, WO2013039889, WO2014018863, WO2014083173; U.S. Pat. No. 8,088,379).
[0288] As an alternative to, or addition to, TCR modifications, chimeric antigen receptors (CARs) may be used in order to generate immunoresponsive cells, such as T cells, specific for selected targets, such as malignant cells, with a wide variety of receptor chimera constructs having been described (see U.S. Pat. Nos. 5,843,728; 5,851,828; 5,912,170; 6,004,811; 6,284,240; 6,392,013; 6,410,014; 6,753,162; 8,211,422; and, PCT Publication WO9215322).
[0289] In general, CARs are comprised of an extracellular domain, a transmembrane domain, and an intracellular domain, wherein the extracellular domain comprises an antigen-binding domain that is specific for a predetermined target. While the antigen-binding domain of a CAR is often an antibody or antibody fragment (e.g., a single chain variable fragment, scFv), the binding domain is not particularly limited so long as it results in specific recognition of a target. For example, in some embodiments, the antigen-binding domain may comprise a receptor, such that the CAR is capable of binding to the ligand of the receptor. Alternatively, the antigen-binding domain may comprise a ligand, such that the CAR is capable of binding the endogenous receptor of that ligand.
[0290] The antigen-binding domain of a CAR is generally separated from the transmembrane domain by a hinge or spacer. The spacer is also not particularly limited, and it is designed to provide the CAR with flexibility. For example, a spacer domain may comprise a portion of a human Fc domain, including a portion of the CH3 domain, or the hinge region of any immunoglobulin, such as IgA, IgD, IgE, IgG, or IgM, or variants thereof. Furthermore, the hinge region may be modified so as to prevent off-target binding by FcRs or other potential interfering objects. For example, the hinge may comprise an IgG4 Fc domain with or without a S228P, L235E, and/or N297Q mutation (according to Kabat numbering) in order to decrease binding to FcRs. Additional spacers/hinges include, but are not limited to, CD4, CD8, and CD28 hinge regions.
[0291] The transmembrane domain of a CAR may be derived either from a natural or from a synthetic source. Where the source is natural, the domain may be derived from any membrane bound or transmembrane protein. Transmembrane regions of particular use in this disclosure may be derived from CD8, CD28, CD3, CD45, CD4, CD5, CDS, CD9, CD 16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, TCR. Alternatively, the transmembrane domain may be synthetic, in which case it will comprise predominantly hydrophobic residues such as leucine and valine. Preferably a triplet of phenylalanine, tryptophan and valine will be found at each end of a synthetic transmembrane domain. Optionally, a short oligo- or polypeptide linker, preferably between 2 and 10 amino acids in length may form the linkage between the transmembrane domain and the cytoplasmic signaling domain of the CAR. A glycine-serine doublet provides a particularly suitable linker.
[0292] Alternative CAR constructs may be characterized as belonging to successive generations. First-generation CARs typically consist of a single-chain variable fragment of an antibody specific for an antigen, for example comprising a VL linked to a VH of a specific antibody, linked by a flexible linker, for example by a CD8α hinge domain and a CD8α transmembrane domain, to the transmembrane and intracellular signaling domains of either CD3ζ or FcRγ (scFv-CD3ζ or scFv-FcRγ; see U.S. Pat. Nos. 7,741,465; 5,912,172; U.S. Pat. No. 5,906,936). Second-generation CARs incorporate the intracellular domains of one or more costimulatory molecules, such as CD28, OX40 (CD134), or 4-1BB (CD137) within the endodomain (for example scFv-CD28/OX40/4-1BB-CD3ζ; see U.S. Pat. Nos. 8,911,993; 8,916,381; 8,975,071; 9,101,584; 9,102,760; 9,102,761). Third-generation CARs include a combination of costimulatory endodomains, such a CD3ζ-chain, CD97, GDI 1a-CD18, CD2, ICOS, CD27, CD154, CDS, OX40, 4-1BB, CD2, CD7, LIGHT, LFA-1, NKG2C, B7-H3, CD30, CD40, PD-1, or CD28 signaling domains (for example scFv-CD28-4-1BB-CD3ζ or scFv-CD28-OX40-CD3ζ; see U.S. Pat. Nos. 8,906,682; 8,399,645; 5,686,281; PCT Publication No. WO2014134165; PCT Publication No. WO2012079000). In certain embodiments, the primary signaling domain comprises a functional signaling domain of a protein selected from the group consisting of CD3 zeta, CD3 gamma, CD3 delta, CD3 epsilon, common FcR gamma (FCERIG), FcR beta (Fc Epsilon Rib), CD79a, CD79b, Fe gamma RIIa, DAP10, and DAP12. In certain preferred embodiments, the primary signaling domain comprises a functional signaling domain of CD3ζ or FcRγ. In certain embodiments, the one or more costimulatory signaling domains comprise a functional signaling domain of a protein selected, each independently, from the group consisting of: CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83, CDS, ICAM-1, GITR, BAFFR, HVEM (LIGHTR), SLAMF7, NKp80 (KLRF1), CD160, CD19, CD4, CD8 alpha, CD8 beta, IL2R beta, IL2R gamma, IL7R alpha, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD11d, ITGAE, CD103, ITGAL, CD11a, LFA-1, ITGAM, CD11b, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, ITGB7, TNFR2, TRANCE/RANKL, DNAM1 (CD226), SLAMF4 (CD244, 2B4), CD84, CD96 (Tactile), CEACAM1, CRTAM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Ly108), SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, LAT, GADS, SLP-76, PAG/Cbp, NKp44, NKp30, NKp46, and NKG2D. In certain embodiments, the one or more costimulatory signaling domains comprise a functional signaling domain of a protein selected, each independently, from the group consisting of: 4-1BB, CD27, and CD28. In certain embodiments, a chimeric antigen receptor may have the design as described in U.S. Pat. No. 7,446,190, comprising an intracellular domain of CD3ζ chain (such as amino acid residues 52-163 of the human CD3 zeta chain, as shown in SEQ ID NO: 14 of U.S. Pat. No. 7,446,190), a signaling region from CD28 and an antigen-binding element (or portion or domain; such as scFv). The CD28 portion, when between the zeta chain portion and the antigen-binding element, may suitably include the transmembrane and signaling domains of CD28 (such as amino acid residues 114-220 of SEQ ID NO: 10, full sequence shown in SEQ ID NO: 6 of U.S. Pat. No. 7,446,190; these can include the following portion of CD28 as set forth in Genbank identifier NM_006139 (sequence version 1, 2 or 3): IEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVA FIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS)) (SEQ ID NO: 1). Alternatively, when the zeta sequence lies between the CD28 sequence and the antigen-binding element, intracellular domain of CD28 can be used alone (such as amino sequence set forth in SEQ ID NO: 9 of U.S. Pat. No. 7,446,190). Hence, certain embodiments employ a CAR comprising (a) a zeta chain portion comprising the intracellular domain of human CD3ζ chain, (b) a costimulatory signaling region, and (c) an antigen-binding element (or portion or domain), wherein the costimulatory signaling region comprises the amino acid sequence encoded by SEQ ID NO: 6 of U.S. Pat. No. 7,446,190.
[0293] Alternatively, costimulation may be orchestrated by expressing CARs in antigen-specific T cells, chosen so as to be activated and expanded following engagement of their native αβTCR, for example by antigen on professional antigen-presenting cells, with attendant costimulation. In addition, additional engineered receptors may be provided on the immunoresponsive cells, for example to improve targeting of a T-cell attack and/or minimize side effects
[0294] By means of an example and without limitation, Kochenderfer et al., (2009) J Immunother. 32 (7): 689-702 described anti-CD19 chimeric antigen receptors (CAR). FMC63-28Z CAR contained a single chain variable region moiety (scFv) recognizing CD19 derived from the FMC63 mouse hybridoma (described in Nicholson et al., (1997) Molecular Immunology 34: 1157-1165), a portion of the human CD28 molecule, and the intracellular component of the human TCR-ζ molecule. FMC63-CD828BBZ CAR contained the FMC63 scFv, the hinge and transmembrane regions of the CD8 molecule, the cytoplasmic portions of CD28 and 4-1BB, and the cytoplasmic component of the TCR-ζ molecule. The exact sequence of the CD28 molecule included in the FMC63-28Z CAR corresponded to Genbank identifier NM_006139; the sequence included all amino acids starting with the amino acid sequence IEVMYPPPY (SEQ ID No. 2) and continuing all the way to the carboxy-terminus of the protein. To encode the anti-CD19 scFv component of the vector, the authors designed a DNA sequence which was based on a portion of a previously published CAR (Cooper et al., (2003) Blood 101: 1637-1644). This sequence encoded the following components in frame from the 5′ end to the 3′ end: an XhoI site, the human granulocyte-macrophage colony-stimulating factor (GM-CSF) receptor α-chain signal sequence, the FMC63 light chain variable region (as in Nicholson et al., supra), a linker peptide (as in Cooper et al., supra), the FMC63 heavy chain variable region (as in Nicholson et al., supra), and a NotI site. A plasmid encoding this sequence was digested with XhoI and NotI. To form the MSGV-FMC63-28Z retroviral vector, the XhoI and NotI-digested fragment encoding the FMC63 scFv was ligated into a second XhoI and NotI-digested fragment that encoded the MSGV retroviral backbone (as in Hughes et al., (2005) Human Gene Therapy 16: 457-472) as well as part of the extracellular portion of human CD28, the entire transmembrane and cytoplasmic portion of human CD28, and the cytoplasmic portion of the human TCR-ζ molecule (as in Maher et al., 2002) Nature Biotechnology 20: 70-75). The FMC63-28Z CAR is included in the KTE-C19 (axicabtagene ciloleucel) anti-CD19 CAR-T therapy product in development by Kite Pharma, Inc. for the treatment of inter alia patients with relapsed/refractory aggressive B-cell non-Hodgkin lymphoma (NHL). Accordingly, in certain embodiments, cells intended for adoptive cell therapies, more particularly immunoresponsive cells such as T cells, may express the FMC63-28Z CAR as described by Kochenderfer et al. (supra). Hence, in certain embodiments, cells intended for adoptive cell therapies, more particularly immunoresponsive cells such as T cells, may comprise a CAR comprising an extracellular antigen-binding element (or portion or domain; such as scFv) that specifically binds to an antigen, an intracellular signaling domain comprising an intracellular domain of a CD3ζ chain, and a costimulatory signaling region comprising a signaling domain of CD28. Preferably, the CD28 amino acid sequence is as set forth in Genbank identifier NM_006139 (sequence version 1, 2 or 3) starting with the amino acid sequence IEVMYPPPY (SEQ ID NO: 2) and continuing all the way to the carboxy-terminus of the protein. The sequence is reproduced herein: IEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVA FIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (SEQ ID No. 1). Preferably, the antigen is CD19, more preferably the antigen-binding element is an anti-CD19 scFv, even more preferably the anti-CD19 scFv as described by Kochenderfer et al. (supra).
[0295] Additional anti-CD19 CARs are further described in WO2015187528. More particularly Example 1 and Table 1 of WO2015187528, incorporated by reference herein, demonstrate the generation of anti-CD19 CARs based on a fully human anti-CD19 monoclonal antibody (47G4, as described in US20100104509) and murine anti-CD19 monoclonal antibody (as described in Nicholson et al. and explained above). Various combinations of a signal sequence (human CD8-alpha or GM-CSF receptor), extracellular and transmembrane regions (human CD8-alpha) and intracellular T-cell signalling domains (CD28-CD3ζ; 4-1BB-CD3ζ; CD27-CD3ζ; CD28-CD27-CD3ζ, 4-1BB-CD27-CD3ζ; CD27-4-1BB-CD3ζ; CD28-CD27-FcεRI gamma chain; or CD28-FcεRI gamma chain) were disclosed. Hence, in certain embodiments, cells intended for adoptive cell therapies, more particularly immunoresponsive cells such as T cells, may comprise a CAR comprising an extracellular antigen-binding element that specifically binds to an antigen, an extracellular and transmembrane region as set forth in Table 1 of WO2015187528 and an intracellular T-cell signalling domain as set forth in Table 1 of WO2015187528. Preferably, the antigen is CD19, more preferably the antigen-binding element is an anti-CD19 scFv, even more preferably the mouse or human anti-CD19 scFv as described in Example 1 of WO2015187528. In certain embodiments, the CAR comprises, consists essentially of or consists of an amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, or SEQ ID NO: 13 as set forth in Table 1 of WO2015187528.
[0296] By means of an example and without limitation, chimeric antigen receptor that recognizes the CD70 antigen is described in WO2012058460A2 (see also, Park et al., CD70 as a target for chimeric antigen receptor T cells in head and neck squamous cell carcinoma, Oral Oncol. 2018 March; 78:145-150; and Jin et al., CD70, a novel target of CAR T-cell therapy for gliomas, Neuro Oncol. 2018 Jan. 10; 20(1):55-65). CD70 is expressed by diffuse large B-cell and follicular lymphoma and also by the malignant cells of Hodgkins lymphoma, Waldenstrom's macroglobulinemia and multiple myeloma, and by HTLV-1- and EBV-associated malignancies. (Agathanggelou et al. Am.J.Pathol. 1995; 147: 1152-1160; Hunter et al., Blood 2004; 104:4881. 26; Lens et al., J Immunol. 2005; 174:6212-6219; Baba et al., J Virol. 2008; 82:3843-3852.) In addition, CD70 is expressed by non-hematological malignancies such as renal cell carcinoma and glioblastoma. (Junker et al., J Urol. 2005; 173:2150-2153; Chahlavi et al., Cancer Res 2005; 65:5428-5438) Physiologically, CD70 expression is transient and restricted to a subset of highly activated T, B, and dendritic cells.
[0297] By means of an example and without limitation, chimeric antigen receptor that recognizes BCMA has been described (see, e.g., US20160046724A1; WO2016014789A2; WO2017211900A1; WO2015158671A1; US20180085444A1; WO2018028647A1; US20170283504A1; and WO2013154760A1).
[0298] In certain embodiments, the immune cell may, in addition to a CAR or exogenous TCR as described herein, further comprise a chimeric inhibitory receptor (inhibitory CAR) that specifically binds to a second target antigen and is capable of inducing an inhibitory or immunosuppressive or repressive signal to the cell upon recognition of the second target antigen. In certain embodiments, the chimeric inhibitory receptor comprises an extracellular antigen-binding element (or portion or domain) configured to specifically bind to a target antigen, a transmembrane domain, and an intracellular immunosuppressive or repressive signaling domain. In certain embodiments, the second target antigen is an antigen that is not expressed on the surface of a cancer cell or infected cell or the expression of which is downregulated on a cancer cell or an infected cell. In certain embodiments, the second target antigen is an MHC-class I molecule. In certain embodiments, the intracellular signaling domain comprises a functional signaling portion of an immune checkpoint molecule, such as for example PD-1 or CTLA4. Advantageously, the inclusion of such inhibitory CAR reduces the chance of the engineered immune cells attacking non-target (e.g., non-cancer) tissues.
[0299] Alternatively, T-cells expressing CARs may be further modified to reduce or eliminate expression of endogenous TCRs in order to reduce off-target effects. Reduction or elimination of endogenous TCRs can reduce off-target effects and increase the effectiveness of the T cells (U.S. Pat. No. 9,181,527). T cells stably lacking expression of a functional TCR may be produced using a variety of approaches. T cells internalize, sort, and degrade the entire T cell receptor as a complex, with a half-life of about 10 hours in resting T cells and 3 hours in stimulated T cells (von Essen, M. et al. 2004. J. Immunol. 173:384-393). Proper functioning of the TCR complex requires the proper stoichiometric ratio of the proteins that compose the TCR complex. TCR function also requires two functioning TCR zeta proteins with ITAM motifs. The activation of the TCR upon engagement of its MHC-peptide ligand requires the engagement of several TCRs on the same T cell, which all must signal properly. Thus, if a TCR complex is destabilized with proteins that do not associate properly or cannot signal optimally, the T cell will not become activated sufficiently to begin a cellular response.
[0300] Accordingly, in some embodiments, TCR expression may eliminated using RNA interference (e.g., shRNA, siRNA, miRNA, etc.), CRISPR, or other methods that target the nucleic acids encoding specific TCRs (e.g., TCR-α and TCR-β) and/or CD3 chains in primary T cells. By blocking expression of one or more of these proteins, the T cell will no longer produce one or more of the key components of the TCR complex, thereby destabilizing the TCR complex and preventing cell surface expression of a functional TCR.
[0301] In some instances, CAR may also comprise a switch mechanism for controlling expression and/or activation of the CAR. For example, a CAR may comprise an extracellular, transmembrane, and intracellular domain, in which the extracellular domain comprises a target-specific binding element that comprises a label, binding domain, or tag that is specific for a molecule other than the target antigen that is expressed on or by a target cell. In such embodiments, the specificity of the CAR is provided by a second construct that comprises a target antigen binding domain (e.g., an scFv or a bispecific antibody that is specific for both the target antigen and the label or tag on the CAR) and a domain that is recognized by or binds to the label, binding domain, or tag on the CAR. See, e.g., WO 2013/044225, WO 2016/000304, WO 2015/057834, WO 2015/057852, WO 2016/070061, U.S. Pat. No. 9,233,125, US 2016/0129109. In this way, a T-cell that expresses the CAR can be administered to a subject, but the CAR cannot bind its target antigen until the second composition comprising an antigen-specific binding domain is administered.
[0302] Alternative switch mechanisms include CARs that require multimerization in order to activate their signaling function (see, e.g., US 2015/0368342, US 2016/0175359, US 2015/0368360) and/or an exogenous signal, such as a small molecule drug (US 2016/0166613, Yung et al., Science, 2015), in order to elicit a T-cell response. Some CARs may also comprise a “suicide switch” to induce cell death of the CAR T-cells following treatment (Buddee et al., PLoS One, 2013) or to downregulate expression of the CAR following binding to the target antigen (WO 2016/011210).
[0303] Alternative techniques may be used to transform target immunoresponsive cells, such as protoplast fusion, lipofection, transfection or electroporation. A wide variety of vectors may be used, such as retroviral vectors, lentiviral vectors, adenoviral vectors, adeno-associated viral vectors, plasmids or transposons, such as a Sleeping Beauty transposon (see U.S. Pat. Nos. 6,489,458; 7,148,203; 7,160,682; 7,985,739; 8,227,432), may be used to introduce CARs, for example using 2nd generation antigen-specific CARs signaling through CD3ζ and either CD28 or CD137. Viral vectors may for example include vectors based on HIV, SV40, EBV, HSV or BPV.
[0304] Cells that are targeted for transformation may for example include T cells, Natural Killer (NK) cells, cytotoxic T lymphocytes (CTL), regulatory T cells, human embryonic stem cells, tumor-infiltrating lymphocytes (TIL) or a pluripotent stem cell from which lymphoid cells may be differentiated. T cells expressing a desired CAR may for example be selected through co-culture with γ-irradiated activating and propagating cells (AaPC), which co-express the cancer antigen and co-stimulatory molecules. The engineered CAR T-cells may be expanded, for example by co-culture on AaPC in presence of soluble factors, such as IL-2 and IL-21. This expansion may for example be carried out so as to provide memory CAR+ T cells (which may for example be assayed by non-enzymatic digital array and/or multi-panel flow cytometry). In this way, CAR T cells may be provided that have specific cytotoxic activity against antigen-bearing tumors (optionally in conjunction with production of desired chemokines such as interferon-γ). CAR T cells of this kind may for example be used in animal models, for example to treat tumor xenografts.
[0305] In certain embodiments, ACT includes co-transferring CD4+Th1 cells and CD8+ CTLs to induce a synergistic antitumour response (see, e.g., Li et al., Adoptive cell therapy with CD4+T helper 1 cells and CD8.sup.+ cytotoxic T cells enhances complete rejection of an established tumour, leading to generation of endogenous memory responses to non-targeted tumour epitopes. Clin Transl Immunology. 2017 October; 6(10): e160).
[0306] In certain embodiments, Th17 cells are transferred to a subject in need thereof Th17 cells have been reported to directly eradicate melanoma tumors in mice to a greater extent than Th1 cells (Muranski P, et al., Tumor-specific Th17-polarized cells eradicate large established melanoma. Blood. 2008 Jul. 15; 112(2):362-73; and Martin-Orozco N, et al., T helper 17 cells promote cytotoxic T cell activation in tumor immunity. Immunity. 2009 Nov. 20; 31(5):787-98). Those studies involved an adoptive T cell transfer (ACT) therapy approach, which takes advantage of CD4+ T cells that express a TCR recognizing tyrosinase tumor antigen. Exploitation of the TCR leads to rapid expansion of Th17 populations to large numbers ex vivo for reinfusion into the autologous tumor-bearing hosts.
[0307] In certain embodiments, ACT may include autologous iPSC-based vaccines, such as irradiated iPSCs in autologous anti-tumor vaccines (see e.g., Kooreman, Nigel G. et al., Autologous iPSC-Based Vaccines Elicit Anti-tumor Responses In Vivo, Cell Stem Cell 22, 1-13, 2018, doi.org/10.1016/j.stem.2018.01.016).
[0308] Unlike T-cell receptors (TCRs) that are MHC restricted, CARs can potentially bind any cell surface-expressed antigen and can thus be more universally used to treat patients (see Irving et al., Engineering Chimeric Antigen Receptor T-Cells for Racing in Solid Tumors: Don't Forget the Fuel, Front. Immunol., 3 Apr. 2017, doi.org/10.3389/fimmu.2017.00267). In certain embodiments, in the absence of endogenous T-cell infiltrate (e.g., due to aberrant antigen processing and presentation), which precludes the use of TIL therapy and immune checkpoint blockade, the transfer of CAR T-cells may be used to treat patients (see, e.g., Hinrichs C S, Rosenberg S A. Exploiting the curative potential of adoptive T-cell therapy for cancer. Immunol Rev (2014) 257(1):56-71. doi:10.1111/imr.12132).
[0309] Approaches such as the foregoing may be adapted to provide methods of treating and/or increasing survival of a subject having a disease, such as a neoplasia, for example by administering an effective amount of an immunoresponsive cell comprising an antigen recognizing receptor that binds a selected antigen, wherein the binding activates the immunoresponsive cell, thereby treating or preventing the disease (such as a neoplasia, a pathogen infection, an autoimmune disorder, or an allogeneic transplant reaction).
[0310] In certain embodiments, the treatment can be administered after lymphodepleting pretreatment in the form of chemotherapy (typically a combination of cyclophosphamide and fludarabine) or radiation therapy. Initial studies in ACT had short lived responses and the transferred cells did not persist in vivo for very long (Houot et al., T-cell-based immunotherapy: adoptive cell transfer and checkpoint inhibition. Cancer Immunol Res (2015) 3(10):1115-22; and Kamta et al., Advancing Cancer Therapy with Present and Emerging Immuno-Oncology Approaches. Front. Oncol. (2017) 7:64). Immune suppressor cells like Tregs and MDSCs may attenuate the activity of transferred cells by outcompeting them for the necessary cytokines. Not being bound by a theory lymphodepleting pretreatment may eliminate the suppressor cells allowing the TILs to persist.
[0311] In one embodiment, the treatment can be administrated into patients undergoing an immunosuppressive treatment (e.g., glucocorticoid treatment). The cells or population of cells, may be made resistant to at least one immunosuppressive agent due to the inactivation of a gene encoding a receptor for such immunosuppressive agent. In certain embodiments, the immunosuppressive treatment provides for the selection and expansion of the immunoresponsive T cells within the patient.
[0312] In certain embodiments, the treatment can be administered before primary treatment (e.g., surgery or radiation therapy) to shrink a tumor before the primary treatment. In another embodiment, the treatment can be administered after primary treatment to remove any remaining cancer cells.
[0313] In certain embodiments, immunometabolic barriers can be targeted therapeutically prior to and/or during ACT to enhance responses to ACT or CAR T-cell therapy and to support endogenous immunity (see, e.g., Irving et al., Engineering Chimeric Antigen Receptor T-Cells for Racing in Solid Tumors: Don't Forget the Fuel, Front. Immunol., 3 Apr. 2017, doi.org/10.3389/fimmu.2017.00267).
[0314] The administration of cells or population of cells, such as immune system cells or cell populations, such as more particularly immunoresponsive cells or cell populations, as disclosed herein may be carried out in any convenient manner, including by aerosol inhalation, injection, ingestion, transfusion, implantation or transplantation. The cells or population of cells may be administered to a patient subcutaneously, intradermally, intratumorally, intranodally, intramedullary, intramuscularly, intrathecally, by intravenous or intralymphatic injection, or intraperitoneally. In some embodiments, the disclosed CARs may be delivered or administered into a cavity formed by the resection of tumor tissue (i.e. intracavity delivery) or directly into a tumor prior to resection (i.e. intratumoral delivery). In one embodiment, the cell compositions of the present invention are preferably administered by intravenous injection.
[0315] The administration of the cells or population of cells can consist of the administration of 10.sup.4-10.sup.9 cells per kg body weight, preferably 10.sup.1 to 10.sup.6 cells/kg body weight including all integer values of cell numbers within those ranges. Dosing in CAR T cell therapies may for example involve administration of from 10.sup.6 to 10.sup.9 cells/kg, with or without a course of lymphodepletion, for example with cyclophosphamide. The cells or population of cells can be administrated in one or more doses. In another embodiment, the effective amount of cells are administrated as a single dose. In another embodiment, the effective amount of cells are administrated as more than one dose over a period time. Timing of administration is within the judgment of managing physician and depends on the clinical condition of the patient. The cells or population of cells may be obtained from any source, such as a blood bank or a donor. While individual needs vary, determination of optimal ranges of effective amounts of a given cell type for a particular disease or conditions are within the skill of one in the art. An effective amount means an amount which provides a therapeutic or prophylactic benefit. The dosage administrated will be dependent upon the age, health and weight of the recipient, kind of concurrent treatment, if any, frequency of treatment and the nature of the effect desired.
[0316] In another embodiment, the effective amount of cells or composition comprising those cells are administrated parenterally. The administration can be an intravenous administration. The administration can be directly done by injection within a tumor.
[0317] To guard against possible adverse reactions, engineered immunoresponsive cells may be equipped with a transgenic safety switch, in the form of a transgene that renders the cells vulnerable to exposure to a specific signal. For example, the herpes simplex viral thymidine kinase (TK) gene may be used in this way, for example by introduction into allogeneic T lymphocytes used as donor lymphocyte infusions following stem cell transplantation (Greco, et al., Improving the safety of cell therapy with the TK-suicide gene. Front. Pharmacol. 2015; 6: 95). In such cells, administration of a nucleoside prodrug such as ganciclovir or acyclovir causes cell death. Alternative safety switch constructs include inducible caspase 9, for example triggered by administration of a small-molecule dimerizer that brings together two nonfunctional icasp9 molecules to form the active enzyme. A wide variety of alternative approaches to implementing cellular proliferation controls have been described (see U.S. Patent Publication No. 20130071414; PCT Patent Publication WO2011146862; PCT Patent Publication WO2014011987; PCT Patent Publication WO2013040371; Zhou et al. BLOOD, 2014, 123/25:3895-3905; Di Stasi et al., The New England Journal of Medicine 2011; 365:1673-1683; Sadelain M, The New England Journal of Medicine 2011; 365:1735-173; Ramos et al., Stem Cells 28(6):1107-15 (2010)).
[0318] In a further refinement of adoptive therapies, genome editing may be used to tailor immunoresponsive cells to alternative implementations, for example providing edited CAR T cells (see Poirot et al., 2015, Multiplex genome edited T-cell manufacturing platform for “off-the-shelf” adoptive T-cell immunotherapies, Cancer Res 75 (18): 3853; Ren et al., 2017, Multiplex genome editing to generate universal CAR T cells resistant to PD1 inhibition, Clin Cancer Res. 2017 May 1; 23(9):2255-2266. doi: 10.1158/1078-0432.CCR-16-1300. Epub 2016 Nov. 4; Qasim et al., 2017, Molecular remission of infant B-ALL after infusion of universal TALEN gene-edited CAR T cells, Sci Transl Med. 2017 Jan. 25; 9(374); Legut, et al., 2018, CRISPR-mediated TCR replacement generates superior anticancer transgenic T cells. Blood, 131(3), 311-322; and Georgiadis et al., Long Terminal Repeat CRISPR-CAR-Coupled “Universal” T Cells Mediate Potent Anti-leukemic Effects, Molecular Therapy, In Press, Corrected Proof, Available online 6 Mar. 2018). Cells may be edited using any CRISPR system and method of use thereof as described herein. CRISPR systems may be delivered to an immune cell by any method described herein. In preferred embodiments, cells are edited ex vivo and transferred to a subject in need thereof. Immunoresponsive cells, CAR T cells or any cells used for adoptive cell transfer may be edited. Editing may be performed for example to insert or knock-in an exogenous gene, such as an exogenous gene encoding a CAR or a TCR, at a preselected locus in a cell (e.g. TRAC locus); to eliminate potential alloreactive T-cell receptors (TCR) or to prevent inappropriate pairing between endogenous and exogenous TCR chains, such as to knock-out or knock-down expression of an endogenous TCR in a cell; to disrupt the target of a chemotherapeutic agent in a cell; to block an immune checkpoint, such as to knock-out or knock-down expression of an immune checkpoint protein or receptor in a cell; to knock-out or knock-down expression of other gene or genes in a cell, the reduced expression or lack of expression of which can enhance the efficacy of adoptive therapies using the cell; to knock-out or knock-down expression of an endogenous gene in a cell, said endogenous gene encoding an antigen targeted by an exogenous CAR or TCR; to knock-out or knock-down expression of one or more MHC constituent proteins in a cell; to activate a T cell; to modulate cells such that the cells are resistant to exhaustion or dysfunction; and/or increase the differentiation and/or proliferation of functionally exhausted or dysfunctional CD8.sup.+ T-cells (see PCT Patent Publications: WO2013176915, WO2014059173, WO2014172606, WO2014184744, and WO2014191128).
[0319] In certain embodiments, editing may result in inactivation of a gene. By inactivating a gene, it is intended that the gene of interest is not expressed in a functional protein form. In a particular embodiment, the CRISPR system specifically catalyzes cleavage in one targeted gene thereby inactivating said targeted gene. The nucleic acid strand breaks caused are commonly repaired through the distinct mechanisms of homologous recombination or non-homologous end joining (NHEJ). However, NHEJ is an imperfect repair process that often results in changes to the DNA sequence at the site of the cleavage. Repair via non-homologous end joining (NHEJ) often results in small insertions or deletions (Indel) and can be used for the creation of specific gene knockouts. Cells in which a cleavage induced mutagenesis event has occurred can be identified and/or selected by well-known methods in the art. In certain embodiments, homology directed repair (HDR) is used to concurrently inactivate a gene (e.g., TRAC) and insert an endogenous TCR or CAR into the inactivated locus.
[0320] Hence, in certain embodiments, editing of cells (such as by CRISPR/Cas), particularly cells intended for adoptive cell therapies, more particularly immunoresponsive cells such as T cells, may be performed to insert or knock-in an exogenous gene, such as an exogenous gene encoding a CAR or a TCR, at a preselected locus in a cell. Conventionally, nucleic acid molecules encoding CARs or TCRs are transfected or transduced to cells using randomly integrating vectors, which, depending on the site of integration, may lead to clonal expansion, oncogenic transformation, variegated transgene expression and/or transcriptional silencing of the transgene. Directing of transgene(s) to a specific locus in a cell can minimize or avoid such risks and advantageously provide for uniform expression of the transgene(s) by the cells. Without limitation, suitable ‘safe harbor’ loci for directed transgene integration include CCR5 or AAVS1. Homology-directed repair (HDR) strategies are known and described elsewhere in this specification allowing to insert transgenes into desired loci (e.g., TRAC locus).
[0321] Further suitable loci for insertion of transgenes, in particular CAR or exogenous TCR transgenes, include without limitation loci comprising genes coding for constituents of endogenous T-cell receptor, such as T-cell receptor alpha locus (TRA) or T-cell receptor beta locus (TRB), for example T-cell receptor alpha constant (TRAC) locus, T-cell receptor beta constant 1 (TRBC1) locus or T-cell receptor beta constant 2 (TRBC1) locus. Advantageously, insertion of a transgene into such locus can simultaneously achieve expression of the transgene, potentially controlled by the endogenous promoter, and knock-out expression of the endogenous TCR. This approach has been exemplified in Eyquem et al., (2017) Nature 543: 113-117, wherein the authors used CRISPR/Cas9 gene editing to knock-in a DNA molecule encoding a CD19-specific CAR into the TRAC locus downstream of the endogenous promoter; the CAR-T cells obtained by CRISPR were significantly superior in terms of reduced tonic CAR signaling and exhaustion.
[0322] T cell receptors (TCR) are cell surface receptors that participate in the activation of T cells in response to the presentation of antigen. The TCR is generally made from two chains, α and β, which assemble to form a heterodimer and associates with the CD3-transducing subunits to form the T cell receptor complex present on the cell surface. Each α and β chain of the TCR consists of an immunoglobulin-like N-terminal variable (V) and constant (C) region, a hydrophobic transmembrane domain, and a short cytoplasmic region. As for immunoglobulin molecules, the variable region of the α and β chains are generated by V(D)J recombination, creating a large diversity of antigen specificities within the population of T cells. However, in contrast to immunoglobulins that recognize intact antigen, T cells are activated by processed peptide fragments in association with an MHC molecule, introducing an extra dimension to antigen recognition by T cells, known as MHC restriction. Recognition of MHC disparities between the donor and recipient through the T cell receptor leads to T cell proliferation and the potential development of graft versus host disease (GVHD). The inactivation of TCRα or TCRβ can result in the elimination of the TCR from the surface of T cells preventing recognition of alloantigen and thus GVHD. However, TCR disruption generally results in the elimination of the CD3 signaling component and alters the means of further T cell expansion.
[0323] Hence, in certain embodiments, editing of cells (such as by CRISPR/Cas), particularly cells intended for adoptive cell therapies, more particularly immunoresponsive cells such as T cells, may be performed to knock-out or knock-down expression of an endogenous TCR in a cell. For example, NHEJ-based or HDR-based gene editing approaches can be employed to disrupt the endogenous TCR alpha and/or beta chain genes. For example, gene editing system or systems, such as CRISPR/Cas system or systems, can be designed to target a sequence found within the TCR beta chain conserved between the beta 1 and beta 2 constant region genes (TRBC1 and TRBC2) and/or to target the constant region of the TCR alpha chain (TRAC) gene.
[0324] Allogeneic cells are rapidly rejected by the host immune system. It has been demonstrated that, allogeneic leukocytes present in non-irradiated blood products will persist for no more than 5 to 6 days (Boni, Muranski et al. 2008 Blood 1; 112(12):4746-54). Thus, to prevent rejection of allogeneic cells, the host's immune system usually has to be suppressed to some extent. However, in the case of adoptive cell transfer the use of immunosuppressive drugs also have a detrimental effect on the introduced therapeutic T cells. Therefore, to effectively use an adoptive immunotherapy approach in these conditions, the introduced cells would need to be resistant to the immunosuppressive treatment. Thus, in a particular embodiment, the present invention further comprises a step of modifying T cells to make them resistant to an immunosuppressive agent, preferably by inactivating at least one gene encoding a target for an immunosuppressive agent. An immunosuppressive agent is an agent that suppresses immune function by one of several mechanisms of action. An immunosuppressive agent can be, but is not limited to a calcineurin inhibitor, a target of rapamycin, an interleukin-2 receptor α-chain blocker, an inhibitor of inosine monophosphate dehydrogenase, an inhibitor of dihydrofolic acid reductase, a corticosteroid or an immunosuppressive antimetabolite. The present invention allows conferring immunosuppressive resistance to T cells for immunotherapy by inactivating the target of the immunosuppressive agent in T cells. As non-limiting examples, targets for an immunosuppressive agent can be a receptor for an immunosuppressive agent such as: CD52, glucocorticoid receptor (GR), a FKBP family gene member and a cyclophilin family gene member.
[0325] In certain embodiments, editing of cells (such as by CRISPR/Cas), particularly cells intended for adoptive cell therapies, more particularly immunoresponsive cells such as T cells, may be performed to block an immune checkpoint, such as to knock-out or knock-down expression of an immune checkpoint protein or receptor in a cell. Immune checkpoints are inhibitory pathways that slow down or stop immune reactions and prevent excessive tissue damage from uncontrolled activity of immune cells. In certain embodiments, the immune checkpoint targeted is the programmed death-1 (PD-1 or CD279) gene (PDCD1). In other embodiments, the immune checkpoint targeted is cytotoxic T-lymphocyte-associated antigen (CTLA-4). In additional embodiments, the immune checkpoint targeted is another member of the CD28 and CTLA4 Ig superfamily such as BTLA, LAG3, ICOS, PDL1 or KIR. In further additional embodiments, the immune checkpoint targeted is a member of the TNFR superfamily such as CD40, OX40, CD137, GITR, CD27 or TIM-3.
[0326] Additional immune checkpoints include Src homology 2 domain-containing protein tyrosine phosphatase 1 (SHP-1) (Watson H A, et al., SHP-1: the next checkpoint target for cancer immunotherapy? Biochem Soc Trans. 2016 Apr. 15; 44(2):356-62). SHP-1 is a widely expressed inhibitory protein tyrosine phosphatase (PTP). In T-cells, it is a negative regulator of antigen-dependent activation and proliferation. It is a cytosolic protein, and therefore not amenable to antibody-mediated therapies, but its role in activation and proliferation makes it an attractive target for genetic manipulation in adoptive transfer strategies, such as chimeric antigen receptor (CAR) T cells. Immune checkpoints may also include T cell immunoreceptor with Ig and ITIM domains (TIGIT/Vstm3/WUCAM/VSIG9) and VISTA (Le Mercier I, et al., (2015) Beyond CTLA-4 and PD-1, the generation Z of negative checkpoint regulators. Front. Immunol. 6:418).
[0327] WO2014172606 relates to the use of MT1 and/or MT2 inhibitors to increase proliferation and/or activity of exhausted CD8.sup.+ T-cells and to decrease CD8.sup.+ T-cell exhaustion (e.g., decrease functionally exhausted or unresponsive CD8.sup.+ immune cells). In certain embodiments, metallothioneins are targeted by gene editing in adoptively transferred T cells.
[0328] In certain embodiments, targets of gene editing may be at least one targeted locus involved in the expression of an immune checkpoint protein. Such targets may include, but are not limited to CTLA4, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, ICOS (CD278), PDL1, KIR, LAG3, HAVCR2, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244 (2B4), TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, TGFBRII, TGFRBRI, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, VISTA, GUCY1A2, GUCY1A3, GUCY1B2, GUCY1B3, MT1, MT2, CD40, OX40, CD137, GITR, CD27, SHP-1, TIM-3, CEACAM-1, CEACAM-3, or CEACAM-5. In preferred embodiments, the gene locus involved in the expression of PD-1 or CTLA-4 genes is targeted. In other preferred embodiments, combinations of genes are targeted, such as but not limited to PD-1 and TIGIT.
[0329] By means of an example and without limitation, WO2016196388 concerns an engineered T cell comprising (a) a genetically engineered antigen receptor that specifically binds to an antigen, which receptor may be a CAR; and (b) a disrupted gene encoding a PD-L1, an agent for disruption of a gene encoding a PD-L1, and/or disruption of a gene encoding PD-L1, wherein the disruption of the gene may be mediated by a gene editing nuclease, a zinc finger nuclease (ZFN), CRISPR/Cas9 and/or TALEN. WO2015142675 relates to immune effector cells comprising a CAR in combination with an agent (such as CRISPR, TALEN or ZFN) that increases the efficacy of the immune effector cells in the treatment of cancer, wherein the agent may inhibit an immune inhibitory molecule, such as PD1, PD-L1, CTLA-4, TIM-3, LAG-3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4, TGFR beta, CEACAM-1, CEACAM-3, or CEACAM-5. Ren et al., (2017) Clin Cancer Res 23 (9) 2255-2266 performed lentiviral delivery of CAR and electro-transfer of Cas9 mRNA and gRNAs targeting endogenous TCR, β-2 microglobulin (B2M) and PD1 simultaneously, to generate gene-disrupted allogeneic CAR T cells deficient of TCR, HLA class I molecule and PD1.
[0330] In certain embodiments, cells may be engineered to express a CAR, wherein expression and/or function of methylcytosine dioxygenase genes (TET1, TET2 and/or TET3) in the cells has been reduced or eliminated, such as by CRISPR, ZNF or TALEN (for example, as described in WO201704916).
[0331] In certain embodiments, editing of cells (such as by CRISPR/Cas), particularly cells intended for adoptive cell therapies, more particularly immunoresponsive cells such as T cells, may be performed to knock-out or knock-down expression of an endogenous gene in a cell, said endogenous gene encoding an antigen targeted by an exogenous CAR or TCR, thereby reducing the likelihood of targeting of the engineered cells. In certain embodiments, the targeted antigen may be one or more antigen selected from the group consisting of CD38, CD138, CS-1, CD33, CD26, CD30, CD53, CD92, CD100, CD148, CD150, CD200, CD261, CD262, CD362, human telomerase reverse transcriptase (hTERT), survivin, mouse double minute 2 homolog (MDM2), cytochrome P450 1B1 (CYP1B), HER2/neu, Wilms' tumor gene 1 (WT1), livin, alphafetoprotein (AFP), carcinoembryonic antigen (CEA), mucin 16 (MUC16), MUC1, prostate-specific membrane antigen (PSMA), p53, cyclin (D1), B cell maturation antigen (BCMA), transmembrane activator and CAML Interactor (TACI), and B-cell activating factor receptor (BAFF-R) (for example, as described in WO2016011210 and WO2017011804).
[0332] In certain embodiments, editing of cells (such as by CRISPR/Cas), particularly cells intended for adoptive cell therapies, more particularly immunoresponsive cells such as T cells, may be performed to knock-out or knock-down expression of one or more MHC constituent proteins, such as one or more HLA proteins and/or beta-2 microglobulin (B2M), in a cell, whereby rejection of non-autologous (e.g., allogeneic) cells by the recipient's immune system can be reduced or avoided. In preferred embodiments, one or more HLA class I proteins, such as HLA-A, B and/or C, and/or B2M may be knocked-out or knocked-down. Preferably, B2M may be knocked-out or knocked-down. By means of an example, Ren et al., (2017) Clin Cancer Res 23 (9) 2255-2266 performed lentiviral delivery of CAR and electro-transfer of Cas9 mRNA and gRNAs targeting endogenous TCR, β-2 microglobulin (B2M) and PD1 simultaneously, to generate gene-disrupted allogeneic CAR T cells deficient of TCR, HLA class I molecule and PD1.
[0333] In other embodiments, at least two genes are edited. Pairs of genes may include, but are not limited to PD1 and TCRα, PD1 and TCRβ, CTLA-4 and TCRα, CTLA-4 and TCRβ, LAG3 and TCRα, LAG3 and TCRβ, Tim3 and TCRα, Tim3 and TCRβ, BTLA and TCRα, BTLA and TCRβ, BY55 and TCRα, BY55 and TCRβ, TIGIT and TCRα, TIGIT and TCRβ, B7H5 and TCRα, B7H5 and TCRβ, LAIR1 and TCRα, LAIR1 and TCRβ, SIGLEC10 and TCRα, SIGLEC10 and TCRβ, 2B4 and TCRα, 2B4 and TCRβ, B2M and TCRα, B2M and TCRβ.
[0334] In certain embodiments, a cell may be multiply edited (multiplex genome editing) as taught herein to (1) knock-out or knock-down expression of an endogenous TCR (for example, TRBC1, TRBC2 and/or TRAC), (2) knock-out or knock-down expression of an immune checkpoint protein or receptor (for example PD1, PD-L1 and/or CTLA4); and (3) knock-out or knock-down expression of one or more MHC constituent proteins (for example, HLA-A, B and/or C, and/or B2M, preferably B2M).
[0335] Whether prior to or after genetic modification of the T cells, the T cells can be activated and expanded generally using methods as described, for example, in U.S. Pat. Nos. 6,352,694; 6,534,055; 6,905,680; 5,858,358; 6,887,466; 6,905,681; 7,144,575; 7,232,566; 7,175,843; 5,883,223; 6,905,874; 6,797,514; 6,867,041; and 7,572,631. T cells can be expanded in vitro or in vivo.
[0336] Immune cells may be obtained using any method known in the art. In one embodiment, allogenic T cells may be obtained from healthy subjects. In one embodiment T cells that have infiltrated a tumor are isolated. T cells may be removed during surgery. T cells may be isolated after removal of tumor tissue by biopsy. T cells may be isolated by any means known in the art. In one embodiment, T cells are obtained by apheresis. In one embodiment, the method may comprise obtaining a bulk population of T cells from a tumor sample by any suitable method known in the art. For example, a bulk population of T cells can be obtained from a tumor sample by dissociating the tumor sample into a cell suspension from which specific cell populations can be selected. Suitable methods of obtaining a bulk population of T cells may include, but are not limited to, any one or more of mechanically dissociating (e.g., mincing) the tumor, enzymatically dissociating (e.g., digesting) the tumor, and aspiration (e.g., as with a needle).
[0337] The bulk population of T cells obtained from a tumor sample may comprise any suitable type of T cell. Preferably, the bulk population of T cells obtained from a tumor sample comprises tumor infiltrating lymphocytes (TILs).
[0338] The tumor sample may be obtained from any mammal. Unless stated otherwise, as used herein, the term “mammal” refers to any mammal including, but not limited to, mammals of the order Logomorpha, such as rabbits; the order Carnivora, including Felines (cats) and Canines (dogs); the order Artiodactyla, including Bovines (cows) and Swines (pigs); or of the order Perssodactyla, including Equines (horses). The mammals may be non-human primates, e.g., of the order Primates, Ceboids, or Simoids (monkeys) or of the order Anthropoids (humans and apes). In some embodiments, the mammal may be a mammal of the order Rodentia, such as mice and hamsters. Preferably, the mammal is a non-human primate or a human. An especially preferred mammal is the human.
[0339] T cells can be obtained from a number of sources, including peripheral blood mononuclear cells (PBMC), bone marrow, lymph node tissue, spleen tissue, and tumors. In certain embodiments of the present invention, T cells can be obtained from a unit of blood collected from a subject using any number of techniques known to the skilled artisan, such as Ficoll separation. In one preferred embodiment, cells from the circulating blood of an individual are obtained by apheresis or leukapheresis. The apheresis product typically contains lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and platelets. In one embodiment, the cells collected by apheresis may be washed to remove the plasma fraction and to place the cells in an appropriate buffer or media for subsequent processing steps. In one embodiment of the invention, the cells are washed with phosphate buffered saline (PBS). In an alternative embodiment, the wash solution lacks calcium and may lack magnesium or may lack many if not all divalent cations. Initial activation steps in the absence of calcium lead to magnified activation. As those of ordinary skill in the art would readily appreciate a washing step may be accomplished by methods known to those in the art, such as by using a semi-automated “flow-through” centrifuge (for example, the Cobe 2991 cell processor) according to the manufacturer's instructions. After washing, the cells may be resuspended in a variety of biocompatible buffers, such as, for example, Ca-free, Mg-free PBS. Alternatively, the undesirable components of the apheresis sample may be removed and the cells directly resuspended in culture media.
[0340] In another embodiment, T cells are isolated from peripheral blood lymphocytes by lysing the red blood cells and depleting the monocytes, for example, by centrifugation through a PERCOLL™ gradient. A specific subpopulation of T cells, such as CD28+, CD4+, CDC, CD45RA+, and CD45RO+ T cells, can be further isolated by positive or negative selection techniques. For example, in one preferred embodiment, T cells are isolated by incubation with anti-CD3/anti-CD28 (i.e., 3×28)-conjugated beads, such as DYNABEADS® M-450 CD3/CD28 T, or XCYTE DYNABEADS™ for a time period sufficient for positive selection of the desired T cells. In one embodiment, the time period is about 30 minutes. In a further embodiment, the time period ranges from 30 minutes to 36 hours or longer and all integer values there between. In a further embodiment, the time period is at least 1, 2, 3, 4, 5, or 6 hours. In yet another preferred embodiment, the time period is 10 to 24 hours. In one preferred embodiment, the incubation time period is 24 hours. For isolation of T cells from patients with leukemia, use of longer incubation times, such as 24 hours, can increase cell yield. Longer incubation times may be used to isolate T cells in any situation where there are few T cells as compared to other cell types, such in isolating tumor infiltrating lymphocytes (TIL) from tumor tissue or from immunocompromised individuals. Further, use of longer incubation times can increase the efficiency of capture of CD8.sup.+ T cells.
[0341] Enrichment of a T cell population by negative selection can be accomplished with a combination of antibodies directed to surface markers unique to the negatively selected cells. A preferred method is cell sorting and/or selection via negative magnetic immunoadherence or flow cytometry that uses a cocktail of monoclonal antibodies directed to cell surface markers present on the cells negatively selected. For example, to enrich for CD4+ cells by negative selection, a monoclonal antibody cocktail typically includes antibodies to CD14, CD20, CD11b, CD16, HLA-DR, and CD8.
[0342] Further, monocyte populations (i.e., CD14+ cells) may be depleted from blood preparations by a variety of methodologies, including anti-CD14 coated beads or columns, or utilization of the phagocytotic activity of these cells to facilitate removal. Accordingly, in one embodiment, the invention uses paramagnetic particles of a size sufficient to be engulfed by phagocytotic monocytes. In certain embodiments, the paramagnetic particles are commercially available beads, for example, those produced by Life Technologies under the trade name Dynabeads™. In one embodiment, other non-specific cells are removed by coating the paramagnetic particles with “irrelevant” proteins (e.g., serum proteins or antibodies). Irrelevant proteins and antibodies include those proteins and antibodies or fragments thereof that do not specifically target the T cells to be isolated. In certain embodiments, the irrelevant beads include beads coated with sheep anti-mouse antibodies, goat anti-mouse antibodies, and human serum albumin.
[0343] In brief, such depletion of monocytes is performed by preincubating T cells isolated from whole blood, apheresed peripheral blood, or tumors with one or more varieties of irrelevant or non-antibody coupled paramagnetic particles at any amount that allows for removal of monocytes (approximately a 20:1 bead:cell ratio) for about 30 minutes to 2 hours at 22 to 37 degrees C., followed by magnetic removal of cells which have attached to or engulfed the paramagnetic particles. Such separation can be performed using standard methods available in the art. For example, any magnetic separation methodology may be used including a variety of which are commercially available, (e.g., DYNAL® Magnetic Particle Concentrator (DYNAL MPC®)). Assurance of requisite depletion can be monitored by a variety of methodologies known to those of ordinary skill in the art, including flow cytometric analysis of CD14 positive cells, before and after depletion.
[0344] For isolation of a desired population of cells by positive or negative selection, the concentration of cells and surface (e.g., particles such as beads) can be varied. In certain embodiments, it may be desirable to significantly decrease the volume in which beads and cells are mixed together (i.e., increase the concentration of cells), to ensure maximum contact of cells and beads. For example, in one embodiment, a concentration of 2 billion cells/ml is used. In one embodiment, a concentration of 1 billion cells/ml is used. In a further embodiment, greater than 100 million cells/ml is used. In a further embodiment, a concentration of cells of 10, 15, 20, 25, 30, 35, 40, 45, or 50 million cells/ml is used. In yet another embodiment, a concentration of cells from 75, 80, 85, 90, 95, or 100 million cells/ml is used. In further embodiments, concentrations of 125 or 150 million cells/ml can be used. Using high concentrations can result in increased cell yield, cell activation, and cell expansion. Further, use of high cell concentrations allows more efficient capture of cells that may weakly express target antigens of interest, such as CD28-negative T cells, or from samples where there are many tumor cells present (i.e., leukemic blood, tumor tissue, etc). Such populations of cells may have therapeutic value and would be desirable to obtain. For example, using high concentration of cells allows more efficient selection of CD8.sup.+ T cells that normally have weaker CD28 expression.
[0345] In a related embodiment, it may be desirable to use lower concentrations of cells. By significantly diluting the mixture of T cells and surface (e.g., particles such as beads), interactions between the particles and cells is minimized. This selects for cells that express high amounts of desired antigens to be bound to the particles. For example, CD4+ T cells express higher levels of CD28 and are more efficiently captured than CD8.sup.+ T cells in dilute concentrations. In one embodiment, the concentration of cells used is 5×10.sup.6/ml. In other embodiments, the concentration used can be from about 1×10.sup.5/ml to 1×10.sup.6/ml, and any integer value in between.
[0346] T cells can also be frozen. Wishing not to be bound by theory, the freeze and subsequent thaw step provides a more uniform product by removing granulocytes and to some extent monocytes in the cell population. After a washing step to remove plasma and platelets, the cells may be suspended in a freezing solution. While many freezing solutions and parameters are known in the art and will be useful in this context, one method involves using PBS containing 20% DMSO and 8% human serum albumin, or other suitable cell freezing media, the cells then are frozen to −80° C. at a rate of 1° per minute and stored in the vapor phase of a liquid nitrogen storage tank. Other methods of controlled freezing may be used as well as uncontrolled freezing immediately at −20° C. or in liquid nitrogen.
[0347] T cells for use in the present invention may also be antigen-specific T cells. For example, tumor-specific T cells can be used. In certain embodiments, antigen-specific T cells can be isolated from a patient of interest, such as a patient afflicted with a cancer or an infectious disease. In one embodiment, neoepitopes are determined for a subject and T cells specific to these antigens are isolated. Antigen-specific cells for use in expansion may also be generated in vitro using any number of methods known in the art, for example, as described in U.S. Patent Publication No. US 20040224402 entitled, Generation and Isolation of Antigen-Specific T Cells, or in U.S. Pat. Nos. 6,040,177. Antigen-specific cells for use in the present invention may also be generated using any number of methods known in the art, for example, as described in Current Protocols in Immunology, or Current Protocols in Cell Biology, both published by John Wiley & Sons, Inc., Boston, Mass.
[0348] In a related embodiment, it may be desirable to sort or otherwise positively select (e.g. via magnetic selection) the antigen specific cells prior to or following one or two rounds of expansion. Sorting or positively selecting antigen-specific cells can be carried out using peptide-MHC tetramers (Altman, et al., Science. 1996 Oct. 4; 274(5284):94-6). In another embodiment, the adaptable tetramer technology approach is used (Andersen et al., 2012 Nat Protoc. 7:891-902). Tetramers are limited by the need to utilize predicted binding peptides based on prior hypotheses, and the restriction to specific HLAs. Peptide-MHC tetramers can be generated using techniques known in the art and can be made with any MHC molecule of interest and any antigen of interest as described herein. Specific epitopes to be used in this context can be identified using numerous assays known in the art. For example, the ability of a polypeptide to bind to MHC class I may be evaluated indirectly by monitoring the ability to promote incorporation of .sup.125I labeled β2-microglobulin (β2m) into MHC class I/β2m/peptide heterotrimeric complexes (see Parker et al., J. Immunol. 152:163, 1994).
[0349] In one embodiment cells are directly labeled with an epitope-specific reagent for isolation by flow cytometry followed by characterization of phenotype and TCRs. In one embodiment, T cells are isolated by contacting with T cell specific antibodies. Sorting of antigen-specific T cells, or generally any cells of the present invention, can be carried out using any of a variety of commercially available cell sorters, including, but not limited to, MoFlo sorter (DakoCytomation, Fort Collins, Colo.), FACSAria™, FACSArray™, FACSVantage™, BD™ LSR II, and FACSCalibur™ (BD Biosciences, San Jose, Calif.).
[0350] In a preferred embodiment, the method comprises selecting cells that also express CD3. The method may comprise specifically selecting the cells in any suitable manner. Preferably, the selecting is carried out using flow cytometry. The flow cytometry may be carried out using any suitable method known in the art. The flow cytometry may employ any suitable antibodies and stains. Preferably, the antibody is chosen such that it specifically recognizes and binds to the particular biomarker being selected. For example, the specific selection of CD3, CD8, TIM-3, LAG-3, 4-1BB, or PD-1 may be carried out using anti-CD3, anti-CD8, anti-TIM-3, anti-LAG-3, anti-4-1BB, or anti-PD-1 antibodies, respectively. The antibody or antibodies may be conjugated to a bead (e.g., a magnetic bead) or to a fluorochrome. Preferably, the flow cytometry is fluorescence-activated cell sorting (FACS). TCRs expressed on T cells can be selected based on reactivity to autologous tumors. Additionally, T cells that are reactive to tumors can be selected for based on markers using the methods described in patent publication Nos. WO2014133567 and WO2014133568, herein incorporated by reference in their entirety. Additionally, activated T cells can be selected for based on surface expression of CD107a.
[0351] In one embodiment of the invention, the method further comprises expanding the numbers of T cells in the enriched cell population. Such methods are described in U.S. Pat. No. 8,637,307 and is herein incorporated by reference in its entirety. The numbers of T cells may be increased at least about 3-fold (or 4-, 5-, 6-, 7-, 8-, or 9-fold), more preferably at least about 10-fold (or 20-, 30-, 40-, 50-, 60-, 70-, 80-, or 90-fold), more preferably at least about 100-fold, more preferably at least about 1,000 fold, or most preferably at least about 100,000-fold. The numbers of T cells may be expanded using any suitable method known in the art. Exemplary methods of expanding the numbers of cells are described in patent publication No. WO 2003057171, U.S. Pat. No. 8,034,334, and U.S. Patent Application Publication No. 2012/0244133, each of which is incorporated herein by reference.
[0352] In one embodiment, ex vivo T cell expansion can be performed by isolation of T cells and subsequent stimulation or activation followed by further expansion. In one embodiment of the invention, the T cells may be stimulated or activated by a single agent. In another embodiment, T cells are stimulated or activated with two agents, one that induces a primary signal and a second that is a co-stimulatory signal. Ligands useful for stimulating a single signal or stimulating a primary signal and an accessory molecule that stimulates a second signal may be used in soluble form. Ligands may be attached to the surface of a cell, to an Engineered Multivalent Signaling Platform (EMSP), or immobilized on a surface. In a preferred embodiment both primary and secondary agents are co-immobilized on a surface, for example a bead or a cell. In one embodiment, the molecule providing the primary activation signal may be a CD3 ligand, and the co-stimulatory molecule may be a CD28 ligand or 4-1BB ligand.
[0353] In certain embodiments, T cells comprising a CAR or an exogenous TCR, may be manufactured as described in WO2015120096, by a method comprising: enriching a population of lymphocytes obtained from a donor subject; stimulating the population of lymphocytes with one or more T-cell stimulating agents to produce a population of activated T cells, wherein the stimulation is performed in a closed system using serum-free culture medium; transducing the population of activated T cells with a viral vector comprising a nucleic acid molecule which encodes the CAR or TCR, using a single cycle transduction to produce a population of transduced T cells, wherein the transduction is performed in a closed system using serum-free culture medium; and expanding the population of transduced T cells for a predetermined time to produce a population of engineered T cells, wherein the expansion is performed in a closed system using serum-free culture medium. In certain embodiments, T cells comprising a CAR or an exogenous TCR, may be manufactured as described in WO2015120096, by a method comprising: obtaining a population of lymphocytes; stimulating the population of lymphocytes with one or more stimulating agents to produce a population of activated T cells, wherein the stimulation is performed in a closed system using serum-free culture medium; transducing the population of activated T cells with a viral vector comprising a nucleic acid molecule which encodes the CAR or TCR, using at least one cycle transduction to produce a population of transduced T cells, wherein the transduction is performed in a closed system using serum-free culture medium; and expanding the population of transduced T cells to produce a population of engineered T cells, wherein the expansion is performed in a closed system using serum-free culture medium. The predetermined time for expanding the population of transduced T cells may be 3 days. The time from enriching the population of lymphocytes to producing the engineered T cells may be 6 days. The closed system may be a closed bag system. Further provided is population of T cells comprising a CAR or an exogenous TCR obtainable or obtained by said method, and a pharmaceutical composition comprising such cells.
[0354] In certain embodiments, T cell maturation or differentiation in vitro may be delayed or inhibited by the method as described in WO2017070395, comprising contacting one or more T cells from a subject in need of a T cell therapy with an AKT inhibitor (such as, e.g., one or a combination of two or more AKT inhibitors disclosed in claim 8 of WO2017070395) and at least one of exogenous Interleukin-7 (IL-7) and exogenous Interleukin-15 (IL-15), wherein the resulting T cells exhibit delayed maturation or differentiation, and/or wherein the resulting T cells exhibit improved T cell function (such as, e.g., increased T cell proliferation; increased cytokine production; and/or increased cytolytic activity) relative to a T cell function of a T cell cultured in the absence of an AKT inhibitor.
[0355] In certain embodiments, a patient in need of a T cell therapy may be conditioned by a method as described in WO2016191756 comprising administering to the patient a dose of cyclophosphamide between 200 mg/m2/day and 2000 mg/m2/day and a dose of fludarabine between 20 mg/m2/day and 900 mg/m.sup.2/day.
[0356] In one embodiment, adoptive cell transfer may comprise: depleting T cells as defined herein from a population of T cells obtained from the subject; in vitro expanding the T cell population; and administering the in vitro expanded T cell population to the subject. In one embodiment, adoptive cell transfer may comprise: enriching T cells as defined herein from a population of T cells obtained from the subject; in vitro expanding the enriched T cell population; and administering the in vitro expanded T cell population to the subject. In certain embodiments, the method may further comprise formulating the in vitro expanded immune cell or immune cell population into a pharmaceutical composition.
[0357] In certain embodiments, suppressive CD8.sup.+ T cells are administered in combination with an autoimmune drug. Non-limiting examples of such drugs include methotrexate, cyclophosphamide, Imuran (azathioprine), cyclosporin, and steroid compounds such as prednisone and methylprednisolone.
Cancer
[0358] In certain example embodiments, the pharmaceutical compositions and adoptive cell transfer strategies may be used to treat various forms of cancer. Examples of cancer include but are not limited to carcinoma, lymphoma, blastoma, sarcoma, and leukemia or lymphoid malignancies. More particular examples of such cancers include without limitation: squamous cell cancer (e.g., epithelial squamous cell cancer), lung cancer including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, squamous carcinoma of the lung and large cell carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer including gastrointestinal cancer, pancreatic cancer, glioma, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, rectal cancer, colorectal cancer, endometrial cancer or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, anal carcinoma, penile carcinoma, as well as CNS cancer, melanoma, head and neck cancer, bone cancer, bone marrow cancer, duodenum cancer, oesophageal cancer, thyroid cancer, or hematological cancer.
[0359] Other non-limiting examples of cancers or malignancies include, but are not limited to: Acute Childhood Lymphoblastic Leukemia, Acute Lymphoblastic Leukemia, Acute Lymphocytic Leukemia, Acute Myeloid Leukemia, Adrenocortical Carcinoma, Adult (Primary) Hepatocellular Cancer, Adult (Primary) Liver Cancer, Adult Acute Lymphocytic Leukemia, Adult Acute Myeloid Leukemia, Adult Hodgkin's Disease, Adult Hodgkin's Lymphoma, Adult Lymphocytic Leukemia, Adult Non-Hodgkin's Lymphoma, Adult Primary Liver Cancer, Adult Soft Tissue Sarcoma, AIDS-Related Lymphoma, AIDS-Related Malignancies, Anal Cancer, Astrocytoma, Bile Duct Cancer, Bladder Cancer, Bone Cancer, Brain Stem Glioma, Brain Tumours, Breast Cancer, Cancer of the Renal Pelvis and Urethra, Central Nervous System (Primary) Lymphoma, Central Nervous System Lymphoma, Cerebellar Astrocytoma, Cerebral Astrocytoma, Cervical Cancer, Childhood (Primary) Hepatocellular Cancer, Childhood (Primary) Liver Cancer, Childhood Acute Lymphoblastic Leukemia, Childhood Acute Myeloid Leukemia, Childhood Brain Stem Glioma, Glioblastoma, Childhood Cerebellar Astrocytoma, Childhood Cerebral Astrocytoma, Childhood Extracranial Germ Cell Tumours, Childhood Hodgkin's Disease, Childhood Hodgkin's Lymphoma, Childhood Hypothalamic and Visual Pathway Glioma, Childhood Lymphoblastic Leukemia, Childhood Medulloblastoma, Childhood Non-Hodgkin's Lymphoma, Childhood Pineal and Supratentorial Primitive Neuroectodermal Tumours, Childhood Primary Liver Cancer, Childhood Rhabdomyosarcoma, Childhood Soft Tissue Sarcoma, Childhood Visual Pathway and Hypothalamic Glioma, Chronic Lymphocytic Leukemia, Chronic Myelogenous Leukemia, Colon Cancer, Cutaneous T-Cell Lymphoma, Endocrine Pancreas Islet Cell Carcinoma, Endometrial Cancer, Ependymoma, Epithelial Cancer, Esophageal Cancer, Ewing's Sarcoma and Related Tumours, Exocrine Pancreatic Cancer, Extracranial Germ Cell Tumour, Extragonadal Germ Cell Tumour, Extrahepatic Bile Duct Cancer, Eye Cancer, Female Breast Cancer, Gaucher's Disease, Gallbladder Cancer, Gastric Cancer, Gastrointestinal Carcinoid Tumour, Gastrointestinal Tumours, Germ Cell Tumours, Gestational Trophoblastic Tumour, Hairy Cell Leukemia, Head and Neck Cancer, Hepatocellular Cancer, Hodgkin's Disease, Hodgkin's Lymphoma, Hypergammaglobulinemia, Hypopharyngeal Cancer, Intestinal Cancers, Intraocular Melanoma, Islet Cell Carcinoma, Islet Cell Pancreatic Cancer, Kaposi's Sarcoma, Kidney Cancer, Laryngeal Cancer, Lip and Oral Cavity Cancer, Liver Cancer, Lung Cancer, Lymphoproliferative Disorders, Macroglobulinemia, Male Breast Cancer, Malignant Mesothelioma, Malignant Thymoma, Medulloblastoma, Melanoma, Mesothelioma, Metastatic Occult Primary Squamous Neck Cancer, Metastatic Primary Squamous Neck Cancer, Metastatic Squamous Neck Cancer, Multiple Myeloma, Multiple Myeloma/Plasma Cell Neoplasm, Myelodysplastic Syndrome, Myelogenous Leukemia, Myeloid Leukemia, Myeloproliferative Disorders, Nasal Cavity and Paranasal Sinus Cancer, Nasopharyngeal Cancer, Neuroblastoma, Non-Hodgkin's Lymphoma During Pregnancy, Nonmelanoma Skin Cancer, Non-Small Cell Lung Cancer, Occult Primary Metastatic Squamous Neck Cancer, Oropharyngeal Cancer, Osteo-/Malignant Fibrous Sarcoma, Osteosarcoma/Malignant Fibrous Histiocytoma, Osteosarcoma/Malignant Fibrous Histiocytoma of Bone, Ovarian Epithelial Cancer, Ovarian Germ Cell Tumour, Ovarian Low Malignant Potential Tumour, Pancreatic Cancer, Paraproteinemias, Purpura, Parathyroid Cancer, Penile Cancer, Pheochromocytoma, Pituitary Tumour, Plasma Cell Neoplasm/Multiple Myeloma, Primary Central Nervous System Lymphoma, Primary Liver Cancer, Prostate Cancer, Rectal Cancer, Renal Cell Cancer, Renal Pelvis and Urethra Cancer, Retinoblastoma, Rhabdomyosarcoma, Salivary Gland Cancer, Sarcoidosis Sarcomas, Sezary Syndrome, Skin Cancer, Small Cell Lung Cancer, Small Intestine Cancer, Soft Tissue Sarcoma, Squamous Neck Cancer, Stomach Cancer, Supratentorial Primitive Neuroectodermal and Pineal Tumours, T-Cell Lymphoma, Testicular Cancer, Thymoma, Thyroid Cancer, Transitional Cell Cancer of the Renal Pelvis and Urethra, Transitional Renal Pelvis and Urethra Cancer, Trophoblastic Tumours, Urethra and Renal Pelvis Cell Cancer, Urethral Cancer, Uterine Cancer, Uterine Sarcoma, Vaginal Cancer, Visual Pathway and Hypothalamic Glioma, Vulvar Cancer, Waldenstrom's Macroglobulinemia, or Wilms' Tumour.
[0360] In further examples, any combinations of methods such as discussed herein may be employed.
Autoimmune Diseases
[0361] In certain example embodiments, the pharmaceutical compositions and adoptive cell transfer strategies may be used to treat various autoimmune diseases. As used throughout the present specification, the terms “autoimmune disease” or “autoimmune disorder” used interchangeably refer to a diseases or disorders caused by an immune response against a self-tissue or tissue component (self-antigen) and include a self-antibody response and/or cell-mediated response. The terms encompass organ-specific autoimmune diseases, in which an autoimmune response is directed against a single tissue, as well as non-organ specific autoimmune diseases, in which an autoimmune response is directed against a component present in two or more, several or many organs throughout the body.
[0362] Non-limiting examples of autoimmune diseases include but are not limited to acute disseminated encephalomyelitis (ADEM); Addison's disease; ankylosing spondylitis; antiphospholipid antibody syndrome (APS); aplastic anemia; autoimmune gastritis; autoimmune hepatitis; autoimmune thrombocytopenia; Behçet's disease; coeliac disease; dermatomyositis; diabetes mellitus type I; Goodpasture's syndrome; Graves' disease; Guillain-Barre syndrome (GBS); Hashimoto's disease; idiopathic thrombocytopenic purpura; inflammatory bowel disease (IBD) including Crohn's disease and ulcerative colitis; mixed connective tissue disease; multiple sclerosis (MS); myasthenia gravis; opsoclonus myoclonus syndrome (OMS); optic neuritis; Ord's thyroiditis; pemphigus; pernicious anaemia; polyarteritis nodosa; polymyositis; primary biliary cirrhosis; primary myoxedema; psoriasis; rheumatic fever; rheumatoid arthritis; Reiter's syndrome; scleroderma; Sjögren's syndrome; systemic lupus erythematosus; Takayasu's arteritis; temporal arteritis; vitiligo; warm autoimmune hemolytic anemia; or Wegener's granulomatosis.
Identifying Immunomodulators
[0363] A further aspect of the invention relates to a method for identifying an immunomodulant capable of modulating one or more phenotypic aspects of an immune cell or immune cell population as disclosed herein, comprising: a) applying a candidate immunomodulant to the immune cell or immune cell population; b) detecting modulation of one or more phenotypic aspects of the immune cell or immune cell population by the candidate immunomodulant, thereby identifying the immunomodulant.
[0364] The term “modulate” broadly denotes a qualitative and/or quantitative alteration, change or variation in that which is being modulated. Where modulation can be assessed quantitatively—for example, where modulation comprises or consists of a change in a quantifiable variable such as a quantifiable property of a cell or where a quantifiable variable provides a suitable surrogate for the modulation—modulation specifically encompasses both increase (e.g., activation) or decrease (e.g., inhibition) in the measured variable. The term encompasses any extent of such modulation, e.g., any extent of such increase or decrease, and may more particularly refer to statistically significant increase or decrease in the measured variable. By means of example, modulation may encompass an increase in the value of the measured variable by at least about 10%, e.g., by at least about 20%, preferably by at least about 30%, e.g., by at least about 40%, more preferably by at least about 50%, e.g., by at least about 75%, even more preferably by at least about 100%, e.g., by at least about 150%, 200%, 250%, 300%, 400% or by at least about 500%, compared to a reference situation without said modulation; or modulation may encompass a decrease or reduction in the value of the measured variable by at least about 10%, e.g., by at least about 20%, by at least about 30%, e.g., by at least about 40%, by at least about 50%, e.g., by at least about 60%, by at least about 70%, e.g., by at least about 80%, by at least about 90%, e.g., by at least about 95%, such as by at least about 96%, 97%, 98%, 99% or even by 100%, compared to a reference situation without said modulation. Preferably, modulation may be specific or selective, hence, one or more desired phenotypic aspects of an immune cell or immune cell population may be modulated without substantially altering other (unintended, undesired) phenotypic aspect(s).
[0365] The term “immunomodulant” broadly encompasses any condition, substance or agent capable of modulating one or more phenotypic aspects of an immune cell or immune cell population as disclosed herein. Such conditions, substances or agents may be of physical, chemical, biochemical and/or biological nature. The term “candidate immunomodulant” refers to any condition, substance or agent that is being examined for the ability to modulate one or more phenotypic aspects of an immune cell or immune cell population as disclosed herein in a method comprising applying the candidate immunomodulant to the immune cell or immune cell population (e.g., exposing the immune cell or immune cell population to the candidate immunomodulant or contacting the immune cell or immune cell population with the candidate immunomodulant) and observing whether the desired modulation takes place.
[0366] Immunomodulants may include any potential class of biologically active conditions, substances or agents, such as for instance antibodies, proteins, peptides, nucleic acids, oligonucleotides, small molecules, or combinations thereof.
[0367] By means of example but without limitation, immunomodulants can include low molecular weight compounds, but may also be larger compounds, or any organic or inorganic molecule effective in the given situation, including modified and unmodified nucleic acids such as antisense nucleic acids, RNAi, such as siRNA or shRNA, CRISPR/Cas systems, peptides, peptidomimetics, receptors, ligands, and antibodies, aptamers, polypeptides, nucleic acid analogues or variants thereof. Examples include an oligomer of nucleic acids, amino acids, or carbohydrates including without limitation proteins, oligonucleotides, ribozymes, DNAzymes, glycoproteins, siRNAs, lipoproteins, aptamers, and modifications and combinations thereof. Agents can be selected from a group comprising: chemicals; small molecules; nucleic acid sequences; nucleic acid analogues; proteins; peptides; aptamers; antibodies; or fragments thereof. A nucleic acid sequence can be RNA or DNA, and can be single or double stranded, and can be selected from a group comprising; nucleic acid encoding a protein of interest, oligonucleotides, nucleic acid analogues, for example peptide-nucleic acid (PNA), pseudo-complementary PNA (pc-PNA), locked nucleic acid (LNA), modified RNA (mod-RNA), single guide RNA etc. Such nucleic acid sequences include, for example, but are not limited to, nucleic acid sequence encoding proteins, for example that act as transcriptional repressors, antisense molecules, ribozymes, small inhibitory nucleic acid sequences, for example but are not limited to RNAi, shRNAi, siRNA, micro RNAi (mRNAi), antisense oligonucleotides, CRISPR guide RNA, for example that target a CRISPR enzyme to a specific DNA target sequence etc. A protein and/or peptide or fragment thereof can be any protein of interest, for example, but are not limited to: mutated proteins; therapeutic proteins and truncated proteins, wherein the protein is normally absent or expressed at lower levels in the cell. Proteins can also be selected from a group comprising; mutated proteins, genetically engineered proteins, peptides, synthetic peptides, recombinant proteins, chimeric proteins, antibodies, midibodies, minibodies, triabodies, humanized proteins, humanized antibodies, chimeric antibodies, modified proteins and fragments thereof. Alternatively, the agent can be intracellular within the cell as a result of introduction of a nucleic acid sequence into the cell and its transcription resulting in the production of the nucleic acid and/or protein modulator of a gene within the cell. In some embodiments, the agent is any chemical, entity or moiety, including without limitation synthetic and naturally-occurring non-proteinaceous entities. In certain embodiments, the agent is a small molecule having a chemical moiety. Agents can be known to have a desired activity and/or property, or can be selected from a library of diverse compounds.
[0368] In certain embodiments, an immunomodulant may be a hormone, a cytokine, a lymphokine, a growth factor, a chemokine, a cell surface receptor ligand such as a cell surface receptor agonist or antagonist, or a mitogen.
[0369] Non-limiting examples of hormones include growth hormone (GH), adrenocorticotropic hormone (ACTH), dehydroepiandrosterone (DHEA), cortisol, epinephrine, thyroid hormone, estrogen, progesterone, testosterone, or combinations thereof.
[0370] Non-limiting examples of cytokines include lymphokines (e.g., interferon-y, IL-2, IL-3, IL-4, IL-6, granulocyte-macrophage colony-stimulating factor (GM-CSF), interferon-y, leukocyte migration inhibitory factors (T-LIF, B-LIF), lymphotoxin-alpha, macrophage-activating factor (MAF), macrophage migration-inhibitory factor (MIF), neuroleukin, immunologic suppressor factors, transfer factors, or combinations thereof), monokines (e.g., IL-1, TNF-alpha, interferon-α, interferon-β, colony stimulating factors, e.g., CSF2, CSF3, macrophage CSF or GM-CSF, or combinations thereof), chemokines (e.g., beta-thromboglobulin, C chemokines, CC chemokines, CXC chemokines, CX3C chemokines, macrophage inflammatory protein (MIP), or combinations thereof), interleukins (e.g., IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL-12, IL-13, IL-14, IL-15, IL-17, IL-18, IL-19, IL-20, IL-21, IL-22, IL-23, IL-24, IL-25, IL-26, IL-27, IL-28, IL-29, IL-30, IL-31, IL-32, IL-33, IL-34, IL-35, IL-36, or combinations thereof), and several related signalling molecules, such as tumour necrosis factor (TNF) and interferons (e.g., interferon-α, interferon-β, interferon-γ, interferon-λ, or combinations thereof).
[0371] Non-limiting examples of growth factors include those of fibroblast growth factor (FGF) family, bone morphogenic protein (BMP) family, platelet derived growth factor (PDGF) family, transforming growth factor beta (TGFbeta) family, nerve growth factor (NGF) family, epidermal growth factor (EGF) family, insulin related growth factor (IGF) family, hepatocyte growth factor (HGF) family, hematopoietic growth factors (HeGFs), platelet-derived endothelial cell growth factor (PD-ECGF), angiopoietin, vascular endothelial growth factor (VEGF) family, glucocorticoids, or combinations thereof.
[0372] Non-limiting examples of mitogens include phytohaemagglutinin (PHA), concanavalin A (conA), lipopolysaccharide (LPS), pokeweed mitogen (PWM), phorbol ester such as phorbol myristate acetate (PMA) with or without ionomycin, or combinations thereof.
[0373] Non-limiting examples of cell surface receptors the ligands of which may act as immunomodulants include Toll-like receptors (TLRs) (e.g., TLR1, TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9, TLR10, TLR11, TLR12 or TLR13), CD80, CD86, CD40, CCR7, or C-type lectin receptors.
Altering Expression Using Immunomodulants
[0374] In certain embodiments, an immunomodulant may alter expression and/or activity of one or more endogenous genes of the CD8.sup.+ T cells. The term “altered expression” denotes that the modification of the immune cell alters, i.e., changes or modulates, the expression of the recited gene(s) or polypeptides(s). The term “altered expression” encompasses any direction and any extent of said alteration. Hence, “altered expression” may reflect qualitative and/or quantitative change(s) of expression, and specifically encompasses both increase (e.g., activation or stimulation) or decrease (e.g., inhibition) of expression.
[0375] In certain embodiments, the present invention provides for gene signature screening. The concept of signature screening was introduced by Stegmaier et al. (Gene expression-based high-throughput screening (GE-HTS) and application to leukemia differentiation. Nature Genet. 36, 257-263 (2004)), who realized that if a gene-expression signature was the proxy for a phenotype of interest, it could be used to find small molecules that effect that phenotype without knowledge of a validated drug target. The signatures of the present may be used to screen for drugs that induce or reduce the signature in immune cells as described herein. The signature may be used for GE-HTS. In certain embodiments, pharmacological screens may be used to identify drugs that selectively reduce or increase activity of immune cells. In certain embodiments, drugs that selectively activate or repress suppressive or activated T cells are used for treatment of a cancer patient or a patient suffering from an autoimmune disease.
[0376] In certain embodiments, cmap can be used to screen for small molecules capable of modulating a signature of the present invention in silico. The Connectivity Map (cmap) is a collection of genome-wide transcriptional expression data from cultured human cells treated with bioactive small molecules and simple pattern-matching algorithms that together enable the discovery of functional connections between drugs, genes and diseases through the transitory feature of common gene-expression changes (see, Lamb et al., The Connectivity Map: Using Gene-Expression Signatures to Connect Small Molecules, Genes, and Disease. Science 29 Sep. 2006: Vol. 313, Issue 5795, pp. 1929-1935, DOI: 10.1126/science.1132939; and Lamb, J., The Connectivity Map: a new tool for biomedical research. Nature Reviews Cancer January 2007: Vol. 7, pp. 54-60).
[0377] Any one or more of the several successive molecular mechanisms involved in the expression of a given gene or polypeptide may be targeted by the immune cell modification as intended herein. Without limitation, these may include targeting the gene sequence (e.g., targeting the polypeptide-encoding, non-coding and/or regulatory portions of the gene sequence), the transcription of the gene into RNA, the polyadenylation and where applicable splicing and/or other post-transcriptional modifications of the RNA into mRNA, the localization of the mRNA into cell cytoplasm, where applicable other post-transcriptional modifications of the mRNA, the translation of the mRNA into a polypeptide chain, where applicable post-translational modifications of the polypeptide, and/or folding of the polypeptide chain into the mature conformation of the polypeptide. For compartmentalized polypeptides, such as secreted polypeptides and transmembrane polypeptides, this may further include targeting trafficking of the polypeptides, i.e., the cellular mechanism by which polypeptides are transported to the appropriate sub-cellular compartment or organelle, membrane, e.g. the plasma membrane, or outside the cell.
[0378] Hence, “altered expression” may particularly denote altered production of the recited gene products by the modified immune cell. As used herein, the term “gene product(s)” includes RNA transcribed from a gene (e.g., mRNA), or a polypeptide encoded by a gene or translated from RNA.
[0379] Also, “altered expression” as intended herein may encompass modulating the activity of one or more endogenous gene products. Accordingly, “altered expression”, “altering expression”, “modulating expression”, or “detecting expression” or similar may be used interchangeably with respectively “altered expression or activity”, “altering expression or activity”, “modulating expression or activity”, or “detecting expression or activity” or similar. As used herein, “modulating” or “to modulate” generally means either reducing or inhibiting the activity of a target or antigen, or alternatively increasing the activity of the target or antigen, as measured using a suitable in vitro, cellular or in vivo assay. In particular, “modulating” or “to modulate” can mean either reducing or inhibiting the (relevant or intended) activity of, or alternatively increasing the (relevant or intended) biological activity of the target or antigen, as measured using a suitable in vitro, cellular or in vivo assay (which will usually depend on the target or antigen involved), by at least 5%, at least 10%, at least 25%, at least 50%, at least 60%, at least 70%, at least 80%, or 90% or more, compared to activity of the target or antigen in the same assay under the same conditions but without the presence of the inhibitor/antagonist agents or activator/agonist agents described herein.
[0380] As will be clear to the skilled person, “modulating” can also involve effecting a change (which can either be an increase or a decrease) in affinity, avidity, specificity and/or selectivity of a target or antigen, for one or more of its targets compared to the same conditions but without the presence of a modulating agent. Again, this can be determined in any suitable manner and/or using any suitable assay known per se, depending on the target. In particular, an action as an inhibitor/antagonist or activator/agonist can be such that an intended biological or physiological activity is increased or decreased, respectively, by at least 5%, at least 10%, at least 25%, at least 50%, at least 60%, at least 70%, at least 80%, or 90% or more, compared to the biological or physiological activity in the same assay under the same conditions but without the presence of the inhibitor/antagonist agent or activator/agonist agent. Modulating can also involve activating the target or antigen or the mechanism or pathway in which it is involved.
[0381] In certain embodiments, an immunomodulant may be or may result in a genetic modification (e.g., mutation, editing, transgenesis, or combinations thereof) of an immune cell, for example, a genetic perturbation, such as a knock-out (i.e., resulting in a complete absence of expression and/or activity) of one or more endogenous genes/gene products, or a knock-down (i.e., resulting in a partial absence of expression and/or activity) of one or more endogenous genes/gene products, or another type of genetic modification modulating the expression and/or activity of one or more endogenous genes/gene products, or for example, introduction of one or more transgenes, such as one or more transgenes encoding one or more gene products. Such transgene may be suitably operably linked to suitable regulatory sequences, e.g., may be comprised in an expression cassette or an expression vector comprising suitable regulatory sequences, or may be configured to become operably linked to suitable regulatory sequences once inserted into the genetic material (e.g., genome) of the immune cell.
[0382] Any types of mutations achieving the intended effects are contemplated herein. For example, suitable mutations may include deletions, insertions, and/or substitutions. The term “deletion” refers to a mutation wherein one or more nucleotides, typically consecutive nucleotides, of a nucleic acid are removed, i.e., deleted, from the nucleic acid. The term “insertion” refers to a mutation wherein one or more nucleotides, typically consecutive nucleotides, are added, i.e., inserted, into a nucleic acid. The term “substitution” refers to a mutation wherein one or more nucleotides of a nucleic acid are each independently replaced, i.e., substituted, by another nucleotide.
[0383] In certain embodiments, a mutation may introduce a premature in-frame stop codon into the open reading frame (ORF) encoding a gene product. Such premature stop codon may lead to production of a C-terminally truncated form of said polypeptide (this may preferably affect, such as diminish or abolish, some or all biological function(s) of the polypeptide) or, especially when the stop codon is introduced close to (e.g., about 20 or less, or about 10 or less amino acids downstream of) the translation initiation codon of the ORF, the stop codon may effectively abolish the production of the polypeptide. Various ways of introducing a premature in-frame stop codon are apparent to a skilled person. For example but without limitation, a suitable insertion, deletion or substitution of one or more nucleotides in the ORF may introduce the premature in-frame stop codon.
[0384] In other embodiments, a mutation may introduce a frame shift (e.g., +1 or +2 frame shift) in the ORF encoding a gene product. Typically, such frame shift may lead to a previously out-of-frame stop codon downstream of the mutation becoming an in-frame stop codon. Hence, such frame shift may lead to production of a form of the polypeptide having an alternative C-terminal portion and/or a C-terminally truncated form of said polypeptide (this may preferably affect, such as diminish or abolish, some or all biological function(s) of the polypeptide) or, especially when the mutation is introduced close to (e.g., about 20 or less, or about 10 or less amino acids downstream of) the translation initiation codon of the ORF, the frame shift may effectively abolish the production of the polypeptide. Various ways of introducing a frame shift are apparent to a skilled person. For example but without limitation, a suitable insertion or deletion of one or more (not multiple of 3) nucleotides in the ORF may lead to a frame shift.
[0385] In further embodiments, a mutation may delete at least a portion of the ORF encoding a gene product. Such deletion may lead to production of an N-terminally truncated form, a C-terminally truncated form and/or an internally deleted form of said polypeptide (this may preferably affect, such as diminish or abolish, some or all biological function(s) of the polypeptide). Preferably, the deletion may remove about 20% or more, or about 50% or more of the ORF's nucleotides. Especially when the deletion removes a sizeable portion of the ORF (e.g., about 50% or more, preferably about 60% or more, more preferably about 70% or more, even more preferably about 80% or more, still more preferably about 90% or more of the ORF's nucleotides) or when the deletion removes the entire ORF, the deletion may effectively abolish the production of the polypeptide. The skilled person can readily introduce such deletions.
[0386] In further embodiments, a mutation may delete at least a portion of a gene promoter, leading to impaired transcription of the gene product.
[0387] In certain other embodiments, a mutation may be a substitution of one or more nucleotides in the ORF encoding a gene product resulting in substitution of one or more amino acids of the polypeptide. Such mutation may typically preserve the production of the polypeptide, and may preferably affect, such as diminish or abolish, some or all biological function(s) of the polypeptide. The skilled person can readily introduce such substitutions.
[0388] In certain preferred embodiments, a mutation may abolish native splicing of a pre-mRNA encoding a gene product. In the absence of native splicing, the pre-mRNA may be degraded, or the pre-mRNA may be alternatively spliced, or the pre-mRNA may be spliced improperly employing latent splice site(s) if available. Hence, such mutation may typically effectively abolish the production of the polypeptide's mRNA and thus the production of the polypeptide. Various ways of interfering with proper splicing are available to a skilled person, such as for example but without limitation, mutations which alter the sequence of one or more sequence elements required for splicing to render them inoperable, or mutations which comprise or consist of a deletion of one or more sequence elements required for splicing. The terms “splicing”, “splicing of a gene”, “splicing of a pre-mRNA” and similar as used herein are synonymous and have their art-established meaning. By means of additional explanation, splicing denotes the process and means of removing intervening sequences (introns) from pre-mRNA in the process of producing mature mRNA. The reference to splicing particularly aims at native splicing such as occurs under normal physiological conditions. The terms “pre-mRNA” and “transcript” are used herein to denote RNA species that precede mature mRNA, such as in particular a primary RNA transcript and any partially processed forms thereof. Sequence elements required for splicing refer particularly to cis elements in the sequence of pre-mRNA which direct the cellular splicing machinery (spliceosome) towards correct and precise removal of introns from the pre-mRNA. Sequence elements involved in splicing are generally known per se and can be further determined by known techniques including inter alia mutation or deletion analysis. By means of further explanation, “splice donor site” or “5′ splice site” generally refer to a conserved sequence immediately adjacent to an exon-intron boundary at the 5′ end of an intron. Commonly, a splice donor site may contain a dinucleotide GU, and may involve a consensus sequence of about 8 bases at about positions +2 to −6. “Splice acceptor site” or “3′ splice site” generally refers to a conserved sequence immediately adjacent to an intron-exon boundary at the 3′ end of an intron. Commonly, a splice acceptor site may contain a dinucleotide AG, and may involve a consensus sequence of about 16 bases at about positions −14 to +2.
Small Molecules
[0389] In certain embodiments, the one or more modulating agents may be a small molecule. The term “small molecule” refers to compounds, preferably organic compounds, with a size comparable to those organic molecules generally used in pharmaceuticals. The term excludes biological macromolecules (e.g., proteins, peptides, nucleic acids, etc.). Preferred small organic molecules range in size up to about 5000 Da, e.g., up to about 4000, preferably up to 3000 Da, more preferably up to 2000 Da, even more preferably up to about 1000 Da, e.g., up to about 900, 800, 700, 600 or up to about 500 Da. In certain embodiments, the small molecule may act as an antagonist or agonist (e.g., blocking an enzyme active site or activating a receptor by binding to a ligand binding site).
[0390] One type of small molecule applicable to the present invention is a degrader molecule. Proteolysis Targeting Chimera (PROTAC) technology is a rapidly emerging alternative therapeutic strategy with the potential to address many of the challenges currently faced in modern drug development programs. PROTAC technology employs small molecules that recruit target proteins for ubiquitination and removal by the proteasome (see, e.g., Bondeson and Crews, Targeted Protein Degradation by Small Molecules, Annu Rev Pharmacol Toxicol. 2017 Jan. 6; 57: 107-123; and Lai et al., Modular PROTAC Design for the Degradation of Oncogenic BCR-ABL Angew Chem Int Ed Engl. 2016 Jan. 11; 55(2): 807-810).
Genetic Modifying Agents
[0391] In certain embodiments, the one or more modulating agents may be a genetic modifying agent. The genetic modifying agent may comprise a CRISPR system, a zinc finger nuclease system, a TALE system, a meganuclease or RNAi system.
[0392] In general, a CRISPR-Cas or CRISPR system as used in herein and in documents, such as WO 2014/093622 (PCT/US2013/074667), refers collectively to transcripts and other elements involved in the expression of or directing the activity of CRISPR-associated (“Cas”) genes, including sequences encoding a Cas gene, a tracr (trans-activating CRISPR) sequence (e.g. tracrRNA or an active partial tracrRNA), a tracr-mate sequence (encompassing a “direct repeat” and a tracrRNA-processed partial direct repeat in the context of an endogenous CRISPR system), a guide sequence (also referred to as a “spacer” in the context of an endogenous CRISPR system), or “RNA(s)” as that term is herein used (e.g., RNA(s) to guide Cas, such as Cas9, e.g. CRISPR RNA and transactivating (tracr) RNA or a single guide RNA (sgRNA) (chimeric RNA)) or other sequences and transcripts from a CRISPR locus. In general, a CRISPR system is characterized by elements that promote the formation of a CRISPR complex at the site of a target sequence (also referred to as a protospacer in the context of an endogenous CRISPR system). See, e.g, Shmakov et al. (2015) “Discovery and Functional Characterization of Diverse Class 2 CRISPR-Cas Systems”, Molecular Cell, DOI: dx.doi.org/10.1016/j.molcel.2015.10.008.
[0393] In certain embodiments, a protospacer adjacent motif (PAM) or PAM-like motif directs binding of the effector protein complex as disclosed herein to the target locus of interest. In some embodiments, the PAM may be a 5′ PAM (i.e., located upstream of the 5′ end of the protospacer). In other embodiments, the PAM may be a 3′ PAM (i.e., located downstream of the 5′ end of the protospacer). The term “PAM” may be used interchangeably with the term “PFS” or “protospacer flanking site” or “protospacer flanking sequence”.
[0394] In a preferred embodiment, the CRISPR effector protein may recognize a 3′ PAM. In certain embodiments, the CRISPR effector protein may recognize a 3′ PAM which is 5′H, wherein His A, C or U.
[0395] In the context of formation of a CRISPR complex, “target sequence” refers to a sequence to which a guide sequence is designed to have complementarity, where hybridization between a target sequence and a guide sequence promotes the formation of a CRISPR complex. A target sequence may comprise RNA polynucleotides. The term “target RNA” refers to a RNA polynucleotide being or comprising the target sequence. In other words, the target RNA may be a RNA polynucleotide or a part of a RNA polynucleotide to which a part of the gRNA, i.e. the guide sequence, is designed to have complementarity and to which the effector function mediated by the complex comprising CRISPR effector protein and a gRNA is to be directed. In some embodiments, a target sequence is located in the nucleus or cytoplasm of a cell.
[0396] In certain example embodiments, the CRISPR effector protein may be delivered using a nucleic acid molecule encoding the CRISPR effector protein. The nucleic acid molecule encoding a CRISPR effector protein, may advantageously be a codon optimized CRISPR effector protein. An example of a codon optimized sequence, is in this instance a sequence optimized for expression in eukaryote, e.g., humans (i.e. being optimized for expression in humans), or for another eukaryote, animal or mammal as herein discussed; see, e.g., SaCas9 human codon optimized sequence in WO 2014/093622 (PCT/US2013/074667). Whilst this is preferred, it will be appreciated that other examples are possible and codon optimization for a host species other than human, or for codon optimization for specific organs is known. In some embodiments, an enzyme coding sequence encoding a CRISPR effector protein is a codon optimized for expression in particular cells, such as eukaryotic cells. The eukaryotic cells may be those of or derived from a particular organism, such as a plant or a mammal, including but not limited to human, or non-human eukaryote or animal or mammal as herein discussed, e.g., mouse, rat, rabbit, dog, livestock, or non-human mammal or primate. In some embodiments, processes for modifying the germ line genetic identity of human beings and/or processes for modifying the genetic identity of animals which are likely to cause them suffering without any substantial medical benefit to man or animal, and also animals resulting from such processes, may be excluded. In general, codon optimization refers to a process of modifying a nucleic acid sequence for enhanced expression in the host cells of interest by replacing at least one codon (e.g. about or more than about 1, 2, 3, 4, 5, 10, 15, 20, 25, 50, or more codons) of the native sequence with codons that are more frequently or most frequently used in the genes of that host cell while maintaining the native amino acid sequence. Various species exhibit particular bias for certain codons of a particular amino acid. Codon bias (differences in codon usage between organisms) often correlates with the efficiency of translation of messenger RNA (mRNA), which is in turn believed to be dependent on, among other things, the properties of the codons being translated and the availability of particular transfer RNA (tRNA) molecules. The predominance of selected tRNAs in a cell is generally a reflection of the codons used most frequently in peptide synthesis. Accordingly, genes can be tailored for optimal gene expression in a given organism based on codon optimization. Codon usage tables are readily available, for example, at the “Codon Usage Database” available at kazusa.orjp/codon/ and these tables can be adapted in a number of ways. See Nakamura, Y., et al. “Codon usage tabulated from the international DNA sequence databases: status for the year 2000” Nucl. Acids Res. 28:292 (2000). Computer algorithms for codon optimizing a particular sequence for expression in a particular host cell are also available, such as Gene Forge (Aptagen; Jacobus, Pa.), are also available. In some embodiments, one or more codons (e.g. 1, 2, 3, 4, 5, 10, 15, 20, 25, 50, or more, or all codons) in a sequence encoding a Cas correspond to the most frequently used codon for a particular amino acid.
[0397] In certain embodiments, the methods as described herein may comprise providing a Cas transgenic cell in which one or more nucleic acids encoding one or more guide RNAs are provided or introduced operably connected in the cell with a regulatory element comprising a promoter of one or more gene of interest. As used herein, the term “Cas transgenic cell” refers to a cell, such as a eukaryotic cell, in which a Cas gene has been genomically integrated. The nature, type, or origin of the cell are not particularly limiting according to the present invention. Also the way the Cas transgene is introduced in the cell may vary and can be any method as is known in the art. In certain embodiments, the Cas transgenic cell is obtained by introducing the Cas transgene in an isolated cell. In certain other embodiments, the Cas transgenic cell is obtained by isolating cells from a Cas transgenic organism. By means of example, and without limitation, the Cas transgenic cell as referred to herein may be derived from a Cas transgenic eukaryote, such as a Cas knock-in eukaryote. Reference is made to WO 2014/093622 (PCT/US13/74667), incorporated herein by reference. Methods of US Patent Publication Nos. 20120017290 and 20110265198 assigned to Sangamo BioSciences, Inc. directed to targeting the Rosa locus may be modified to utilize the CRISPR Cas system of the present invention. Methods of US Patent Publication No. 20130236946 assigned to Cellectis directed to targeting the Rosa locus may also be modified to utilize the CRISPR Cas system of the present invention. By means of further example reference is made to Platt et. al. (Cell; 159(2):440-455 (2014)), describing a Cas9 knock-in mouse, which is incorporated herein by reference. The Cas transgene can further comprise a Lox-Stop-polyA-Lox(LSL) cassette thereby rendering Cas expression inducible by Cre recombinase. Alternatively, the Cas transgenic cell may be obtained by introducing the Cas transgene in an isolated cell. Delivery systems for transgenes are well known in the art. By means of example, the Cas transgene may be delivered in for instance eukaryotic cell by means of vector (e.g., AAV, adenovirus, lentivirus) and/or particle and/or nanoparticle delivery, as also described herein elsewhere.
[0398] It will be understood by the skilled person that the cell, such as the Cas transgenic cell, as referred to herein may comprise further genomic alterations besides having an integrated Cas gene or the mutations arising from the sequence specific action of Cas when complexed with RNA capable of guiding Cas to a target locus, such as for instance one or more oncogenic mutations, as for instance and without limitation described in Platt et al. (2014), Chen et al., (2014) or Kumar et al. (2009).
[0399] In some embodiments, the Cas sequence is fused to one or more nuclear localization sequences (NLSs), such as about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs. In some embodiments, the Cas comprises about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs at or near the amino-terminus, about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs at or near the carboxy-terminus, or a combination of these (e.g. zero or at least one or more NLS at the amino-terminus and zero or at one or more NLS at the carboxy terminus). When more than one NLS is present, each may be selected independently of the others, such that a single NLS may be present in more than one copy and/or in combination with one or more other NLSs present in one or more copies. In a preferred embodiment of the invention, the Cas comprises at most 6 NLSs. In some embodiments, an NLS is considered near the N- or C-terminus when the nearest amino acid of the NLS is within about 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 40, 50, or more amino acids along the polypeptide chain from the N- or C-terminus. Non-limiting examples of NLSs include an NLS sequence derived from: the NLS of the SV40 virus large T-antigen, having the amino acid sequence PKKKRKV (SEQ ID NO: 5); the NLS from nucleoplasmin (e.g. the nucleoplasmin bipartite NLS with the sequence KRPAATKKAGQAKKKK) (SEQ ID NO: 6); the c-myc NLS having the amino acid sequence PAAKRVKLD (SEQ ID NO: 7) or RQRRNELKRSP (SEQ ID NO: 8); the hRNPA1 M9 NLS having the sequence NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY (SEQ ID NO: 9); the sequence RMRIZFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNV (SEQ ID NO: 10) of the IBB domain from importin-alpha; the sequences VSRKRPRP (SEQ ID NO: 11) and PPKKARED (SEQ ID NO: 12) of the myoma T protein; the sequence PQPKKKPL (SEQ ID NO: 13) of human p53; the sequence SALIKKKKKMAP (SEQ ID NO: 14) of mouse c-abl IV; the sequences DRLRR (SEQ ID NO: 15) and PKQKKRK (SEQ ID NO: 16) of the influenza virus NS1; the sequence RKLKKKIKKL (SEQ ID NO: 17) of the Hepatitis virus delta antigen; the sequence REKKKFLKRR (SEQ ID NO: 18) of the mouse Mx1 protein; the sequence KRKGDEVDGVDEVAKKKSKK (SEQ ID NO: 19) of the human poly(ADP-ribose) polymerase; and the sequence RKCLQAGMNLEARKTKK (SEQ ID NO: 20) of the steroid hormone receptors (human) glucocorticoid. In general, the one or more NLSs are of sufficient strength to drive accumulation of the Cas in a detectable amount in the nucleus of a eukaryotic cell. In general, strength of nuclear localization activity may derive from the number of NLSs in the Cas, the particular NLS(s) used, or a combination of these factors. Detection of accumulation in the nucleus may be performed by any suitable technique. For example, a detectable marker may be fused to the Cas, such that location within a cell may be visualized, such as in combination with a means for detecting the location of the nucleus (e.g. a stain specific for the nucleus such as DAPI). Cell nuclei may also be isolated from cells, the contents of which may then be analyzed by any suitable process for detecting protein, such as immunohistochemistry, Western blot, or enzyme activity assay. Accumulation in the nucleus may also be determined indirectly, such as by an assay for the effect of CRISPR complex formation (e.g. assay for DNA cleavage or mutation at the target sequence, or assay for altered gene expression activity affected by CRISPR complex formation and/or Cas enzyme activity), as compared to a control no exposed to the Cas or complex, or exposed to a Cas lacking the one or more NLSs.
[0400] In certain aspects, the invention involves vectors, e.g. for delivering or introducing in a cell Cas and/or RNA capable of guiding Cas to a target locus (i.e. guide RNA), but also for propagating these components (e.g. in prokaryotic cells). A used herein, a “vector” is a tool that allows or facilitates the transfer of an entity from one environment to another. It is a replicon, such as a plasmid, phage, or cosmid, into which another DNA segment may be inserted so as to bring about the replication of the inserted segment. Generally, a vector is capable of replication when associated with the proper control elements. In general, the term “vector” refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. Vectors include, but are not limited to, nucleic acid molecules that are single-stranded, double-stranded, or partially double-stranded; nucleic acid molecules that comprise one or more free ends, no free ends (e.g. circular); nucleic acid molecules that comprise DNA, RNA, or both; and other varieties of polynucleotides known in the art. One type of vector is a “plasmid,” which refers to a circular double stranded DNA loop into which additional DNA segments can be inserted, such as by standard molecular cloning techniques. Another type of vector is a viral vector, wherein virally-derived DNA or RNA sequences are present in the vector for packaging into a virus (e.g. retroviruses, replication defective retroviruses, adenoviruses, replication defective adenoviruses, and adeno-associated viruses (AAVs)). Viral vectors also include polynucleotides carried by a virus for transfection into a host cell. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g. bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) are integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome. Moreover, certain vectors are capable of directing the expression of genes to which they are operatively-linked. Such vectors are referred to herein as “expression vectors.” Common expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
[0401] Recombinant expression vectors can comprise a nucleic acid of the invention in a form suitable for expression of the nucleic acid in a host cell, which means that the recombinant expression vectors include one or more regulatory elements, which may be selected on the basis of the host cells to be used for expression, that is operatively-linked to the nucleic acid sequence to be expressed. Within a recombinant expression vector, “operably linked” is intended to mean that the nucleotide sequence of interest is linked to the regulatory element(s) in a manner that allows for expression of the nucleotide sequence (e.g. in an in vitro transcription/translation system or in a host cell when the vector is introduced into the host cell). With regards to recombination and cloning methods, mention is made of U.S. patent application Ser. No. 10/815,730, published Sep. 2, 2004 as US 2004-0171156 A1, the contents of which are herein incorporated by reference in their entirety. Thus, the embodiments disclosed herein may also comprise transgenic cells comprising the CRISPR effector system. In certain example embodiments, the transgenic cell may function as an individual discrete volume. In other words samples comprising a masking construct may be delivered to a cell, for example in a suitable delivery vesicle and if the target is present in the delivery vesicle the CRISPR effector is activated and a detectable signal generated.
[0402] The vector(s) can include the regulatory element(s), e.g., promoter(s). The vector(s) can comprise Cas encoding sequences, and/or a single, but possibly also can comprise at least 3 or 8 or 16 or 32 or 48 or 50 guide RNA(s) (e.g., sgRNAs) encoding sequences, such as 1-2, 1-3, 1-4 1-5, 3-6, 3-7, 3-8, 3-9, 3-10, 3-8, 3-16, 3-30, 3-32, 3-48, 3-50 RNA(s) (e.g., sgRNAs). In a single vector there can be a promoter for each RNA (e.g., sgRNA), advantageously when there are up to about 16 RNA(s); and, when a single vector provides for more than 16 RNA(s), one or more promoter(s) can drive expression of more than one of the RNA(s), e.g., when there are 32 RNA(s), each promoter can drive expression of two RNA(s), and when there are 48 RNA(s), each promoter can drive expression of three RNA(s). By simple arithmetic and well established cloning protocols and the teachings in this disclosure one skilled in the art can readily practice the invention as to the RNA(s) for a suitable exemplary vector such as AAV, and a suitable promoter such as the U6 promoter. For example, the packaging limit of AAV is ˜4.7 kb. The length of a single U6-gRNA (plus restriction sites for cloning) is 361 bp. Therefore, the skilled person can readily fit about 12-16, e.g., 13 U6-gRNA cassettes in a single vector. This can be assembled by any suitable means, such as a golden gate strategy used for TALE assembly (genome-engineering.org/taleffectors/). The skilled person can also use a tandem guide strategy to increase the number of U6-gRNAs by approximately 1.5 times, e.g., to increase from 12-16, e.g., 13 to approximately 18-24, e.g., about 19 U6-gRNAs. Therefore, one skilled in the art can readily reach approximately 18-24, e.g., about 19 promoter-RNAs, e.g., U6-gRNAs in a single vector, e.g., an AAV vector. A further means for increasing the number of promoters and RNAs in a vector is to use a single promoter (e.g., U6) to express an array of RNAs separated by cleavable sequences. And an even further means for increasing the number of promoter-RNAs in a vector, is to express an array of promoter-RNAs separated by cleavable sequences in the intron of a coding sequence or gene; and, in this instance it is advantageous to use a polymerase II promoter, which can have increased expression and enable the transcription of long RNA in a tissue specific manner. (see, e.g., nar.oxfordjournals.org/content/34/7/e53.short and nature.com/mt/journal/v16/n9/abs/mt2008144a.html). In an advantageous embodiment, AAV may package U6 tandem gRNA targeting up to about 50 genes. Accordingly, from the knowledge in the art and the teachings in this disclosure the skilled person can readily make and use vector(s), e.g., a single vector, expressing multiple RNAs or guides under the control or operatively or functionally linked to one or more promoters-especially as to the numbers of RNAs or guides discussed herein, without any undue experimentation.
[0403] The guide RNA(s) encoding sequences and/or Cas encoding sequences, can be functionally or operatively linked to regulatory element(s) and hence the regulatory element(s) drive expression. The promoter(s) can be constitutive promoter(s) and/or conditional promoter(s) and/or inducible promoter(s) and/or tissue specific promoter(s). The promoter can be selected from the group consisting of RNA polymerases, pol I, pol II, pol III, T7, U6, H1, retroviral Rous sarcoma virus (RSV) LTR promoter, the cytomegalovirus (CMV) promoter, the SV40 promoter, the dihydrofolate reductase promoter, the β-actin promoter, the phosphoglycerol kinase (PGK) promoter, and the EF1α promoter. An advantageous promoter is the promoter is U6.
[0404] Additional effectors for use according to the invention can be identified by their proximity to cas1 genes, for example, though not limited to, within the region 20 kb from the start of the cas1 gene and 20 kb from the end of the cas1 gene. In certain embodiments, the effector protein comprises at least one HEPN domain and at least 500 amino acids, and wherein the C2c2 effector protein is naturally present in a prokaryotic genome within 20 kb upstream or downstream of a Cas gene or a CRISPR array. Non-limiting examples of Cas proteins include Cas1, Cas1B, Cas2, Cas3, Cas4, Cas5, Cas6, Cas7, Cas8, Cas9 (also known as Csn1 and Csx12), Cas10, Csy1, Csy2, Csy3, Cse1, Cse2, Csc1, Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5, Csm6, Cmr1, Cmr3, Cmr4, Cmr5, Cmr6, Csb1, Csb2, Csb3, Csx17, Csx14, Csx10, Csx16, CsaX, Csx3, Csx1, Csx15, Csf1, Csf2, Csf3, Csf4, homologues thereof, or modified versions thereof. In certain example embodiments, the C2c2 effector protein is naturally present in a prokaryotic genome within 20kb upstream or downstream of a Cas 1 gene. The terms “orthologue” (also referred to as “ortholog” herein) and “homologue” (also referred to as “homolog” herein) are well known in the art. By means of further guidance, a “homologue” of a protein as used herein is a protein of the same species which performs the same or a similar function as the protein it is a homologue of. Homologous proteins may but need not be structurally related, or are only partially structurally related. An “orthologue” of a protein as used herein is a protein of a different species which performs the same or a similar function as the protein it is an orthologue of Orthologous proteins may but need not be structurally related, or are only partially structurally related.
Guide Molecules
[0405] The methods described herein may be used to screen inhibition of CRISPR systems employing different types of guide molecules. As used herein, the term “guide sequence” and “guide molecule” in the context of a CRISPR-Cas system, comprises any polynucleotide sequence having sufficient complementarity with a target nucleic acid sequence to hybridize with the target nucleic acid sequence and direct sequence-specific binding of a nucleic acid-targeting complex to the target nucleic acid sequence. The guide sequences made using the methods disclosed herein may be a full-length guide sequence, a truncated guide sequence, a full-length sgRNA sequence, a truncated sgRNA sequence, or an E+F sgRNA sequence. In some embodiments, the degree of complementarity of the guide sequence to a given target sequence, when optimally aligned using a suitable alignment algorithm, is about or more than about 50%, 60%, 75%, 80%, 85%, 90%, 95%, 97.5%, 99%, or more. In certain example embodiments, the guide molecule comprises a guide sequence that may be designed to have at least one mismatch with the target sequence, such that a RNA duplex formed between the guide sequence and the target sequence. Accordingly, the degree of complementarity is preferably less than 99%. For instance, where the guide sequence consists of 24 nucleotides, the degree of complementarity is more particularly about 96% or less. In particular embodiments, the guide sequence is designed to have a stretch of two or more adjacent mismatching nucleotides, such that the degree of complementarity over the entire guide sequence is further reduced. For instance, where the guide sequence consists of 24 nucleotides, the degree of complementarity is more particularly about 96% or less, more particularly, about 92% or less, more particularly about 88% or less, more particularly about 84% or less, more particularly about 80% or less, more particularly about 76% or less, more particularly about 72% or less, depending on whether the stretch of two or more mismatching nucleotides encompasses 2, 3, 4, 5, 6 or 7 nucleotides, etc. In some embodiments, aside from the stretch of one or more mismatching nucleotides, the degree of complementarity, when optimally aligned using a suitable alignment algorithm, is about or more than about 50%, 60%, 75%, 80%, 85%, 90%, 95%, 97.5%, 99%, or more. Optimal alignment may be determined with the use of any suitable algorithm for aligning sequences, non-limiting example of which include the Smith-Waterman algorithm, the Needleman-Wunsch algorithm, algorithms based on the Burrows-Wheeler Transform (e.g., the Burrows Wheeler Aligner), ClustalW, Clustal X, BLAT, Novoalign (Novocraft Technologies; available at www.novocraft.com), ELAND (Illumina, San Diego, Calif.), SOAP (available at soap.genomics.org.cn), and Maq (available at maq.sourceforge.net). The ability of a guide sequence (within a nucleic acid-targeting guide RNA) to direct sequence-specific binding of a nucleic acid-targeting complex to a target nucleic acid sequence may be assessed by any suitable assay. For example, the components of a nucleic acid-targeting CRISPR system sufficient to form a nucleic acid-targeting complex, including the guide sequence to be tested, may be provided to a host cell having the corresponding target nucleic acid sequence, such as by transfection with vectors encoding the components of the nucleic acid-targeting complex, followed by an assessment of preferential targeting (e.g., cleavage) within the target nucleic acid sequence, such as by Surveyor assay as described herein. Similarly, cleavage of a target nucleic acid sequence (or a sequence in the vicinity thereof) may be evaluated in a test tube by providing the target nucleic acid sequence, components of a nucleic acid-targeting complex, including the guide sequence to be tested and a control guide sequence different from the test guide sequence, and comparing binding or rate of cleavage at or in the vicinity of the target sequence between the test and control guide sequence reactions. Other assays are possible, and will occur to those skilled in the art. A guide sequence, and hence a nucleic acid-targeting guide RNA may be selected to target any target nucleic acid sequence.
[0406] In certain embodiments, the guide sequence or spacer length of the guide molecules is from 15 to 50 nt. In certain embodiments, the spacer length of the guide RNA is at least 15 nucleotides. In certain embodiments, the spacer length is from 15 to 17 nt, e.g., 15, 16, or 17 nt, from 17 to 20 nt, e.g., 17, 18, 19, or 20 nt, from 20 to 24 nt, e.g., 20, 21, 22, 23, or 24 nt, from 23 to 25 nt, e.g., 23, 24, or 25 nt, from 24 to 27 nt, e.g., 24, 25, 26, or 27 nt, from 27-30 nt, e.g., 27, 28, 29, or 30 nt, from 30-35 nt, e.g., 30, 31, 32, 33, 34, or 35 nt, or 35 nt or longer. In certain example embodiment, the guide sequence is 15, 16, 17,18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39 40, 41, 42, 43, 44, 45, 46, 47 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100 nt.
[0407] In some embodiments, the guide sequence is an RNA sequence of between 10 to 50 nt in length, but more particularly of about 20-30 nt advantageously about 20 nt, 23-25 nt or 24 nt. The guide sequence is selected so as to ensure that it hybridizes to the target sequence. This is described more in detail below. Selection can encompass further steps which increase efficacy and specificity.
[0408] In some embodiments, the guide sequence has a canonical length (e.g., about 15-30 nt) is used to hybridize with the target RNA or DNA. In some embodiments, a guide molecule is longer than the canonical length (e.g., >30 nt) is used to hybridize with the target RNA or DNA, such that a region of the guide sequence hybridizes with a region of the RNA or DNA strand outside of the Cas-guide target complex. This can be of interest where additional modifications, such deamination of nucleotides is of interest. In alternative embodiments, it is of interest to maintain the limitation of the canonical guide sequence length.
[0409] In some embodiments, the sequence of the guide molecule (direct repeat and/or spacer) is selected to reduce the degree secondary structure within the guide molecule. In some embodiments, about or less than about 75%, 50%, 40%, 30%, 25%, 20%, 15%, 10%, 5%, 1%, or fewer of the nucleotides of the nucleic acid-targeting guide RNA participate in self-complementary base pairing when optimally folded. Optimal folding may be determined by any suitable polynucleotide folding algorithm. Some programs are based on calculating the minimal Gibbs free energy. An example of one such algorithm is mFold, as described by Zuker and Stiegler (Nucleic Acids Res. 9 (1981), 133-148). Another example folding algorithm is the online webserver RNAfold, developed at Institute for Theoretical Chemistry at the University of Vienna, using the centroid structure prediction algorithm (see e.g., A. R. Gruber et al., 2008, Cell 106(1): 23-24; and P A Carr and G M Church, 2009, Nature Biotechnology 27(12): 1151-62).
[0410] In some embodiments, it is of interest to reduce the susceptibility of the guide molecule to RNA cleavage, such as to cleavage by Cas13. Accordingly, in particular embodiments, the guide molecule is adjusted to avoid cleavage by Cas13 or other RNA-cleaving enzymes.
[0411] In certain embodiments, the guide molecule comprises non-naturally occurring nucleic acids and/or non-naturally occurring nucleotides and/or nucleotide analogs, and/or chemically modifications. Preferably, these non-naturally occurring nucleic acids and non-naturally occurring nucleotides are located outside the guide sequence. Non-naturally occurring nucleic acids can include, for example, mixtures of naturally and non-naturally occurring nucleotides. Non-naturally occurring nucleotides and/or nucleotide analogs may be modified at the ribose, phosphate, and/or base moiety. In an embodiment of the invention, a guide nucleic acid comprises ribonucleotides and non-ribonucleotides. In one such embodiment, a guide comprises one or more ribonucleotides and one or more deoxyribonucleotides. In an embodiment of the invention, the guide comprises one or more non-naturally occurring nucleotide or nucleotide analog such as a nucleotide with phosphorothioate linkage, a locked nucleic acid (LNA) nucleotides comprising a methylene bridge between the 2d/or non-naturally occurring nucleotides and/or nucleotide analogs, and/or chemically modifications. Preferably, these non-naturally occurring nucleic acids and nouoro analogs. Further examples of modified bases include, but are not limited to, 2-aminopurine, 5-bromo-uridine, pseudouridine, inosine, 7-methylguanosine. Examples of guide RNA chemical modifications include, without limitation, incorporation of 2ccurrinhyl (M), 2′-O-methyl 3′phosphorothioate (MS), S-constrained ethyl(cEt), or 2ained ethyl(cEtxamples of guide RNA chemical modifications include, without limitation, incorporation of 2ccurrinhyl (M), 2(M), 2rinhyl (M), 2orothioate (MS), r chemically modifications. Preferably, these non-naturally occurring nucleic acids and no. (See, Hendel, 2015, Nat Biotechnol. 33(9):985-9, doi: 10.1038/nbt.3290, published online 29 Jun. 2015 Ragdarm et al., 0215, PNAS, E7110-E7111; Allerson et al., J. Med. Chem. 2005, 48:901-904; Bramsen et al., Front. Genet., 2012, 3:154; Deng et al., PNAS, 2015, 112:11870-11875; Sharma et al., MedChemComm., 2014, 5:1454-1471; Hendel et al., Nat. Biotechnol. (2015) 33(9): 985-989; Li et al., Nature Biomedical Engineering, 2017, 1, 0066 DOI:10.1038/s41551-017-0066). In some embodiments, the 5′ and/or 3′ end of a guide RNA is modified by a variety of functional moieties including fluorescent dyes, polyethylene glycol, cholesterol, proteins, or detection tags. (See Kelly et al., 2016, J. Biotech. 233:74-83). In certain embodiments, a guide comprises ribonucleotides in a region that binds to a target RNA and one or more deoxyribonucletides and/or nucleotide analogs in a region that binds to Cas13. In an embodiment of the invention, deoxyribonucleotides and/or nucleotide analogs are incorporated in engineered guide structures, such as, without limitation, stem-loop regions, and the seed region. For Cas13 guide, in certain embodiments, the modification is not in the 5′-handle of the stem-loop regions. Chemical modification in the 5′-handle of the stem-loop region of a guide may abolish its function (see Li, et al., Nature Biomedical Engineering, 2017, 1:0066). In certain embodiments, at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50, or 75 nucleotides of a guide is chemically modified. In some embodiments, 3-5 nucleotides at either the 3′ or the 5′ end of a guide is chemically modified. In some embodiments, only minor modifications are introduced in the seed region, such as 2′-F modifications. In some embodiments, 2′-F modification is introduced at the 3′ end of a guide. In certain embodiments, three to five nucleotides at the 5′ and/or the 3′ end of the guide are chemicially modified with 2′-O-methyl (M), 2′-O-methyl 3′ phosphorothioate (MS), S-constrained ethyl(cEt), or 2′-O-methyl 3′ thioPACE (MSP). Such modification can enhance genome editing efficiency (see Hendel et al., Nat. Biotechnol. (2015) 33(9): 985-989). In certain embodiments, all of the phosphodiester bonds of a guide are substituted with phosphorothioates (PS) for enhancing levels of gene disruption. In certain embodiments, more than five nucleotides at the 5′ and/or the 3′ end of the guide are chemicially modified with 2′-O-Me, 2′-F or S-constrained ethyl(cEt). Such chemically modified guide can mediate enhanced levels of gene disruption (see Ragdarm et al., 0215, PNAS, E7110-E7111). In an embodiment of the invention, a guide is modified to comprise a chemical moiety at its 3′ and/or 5′ end. Such moieties include, but are not limited to amine, azide, alkyne, thio, dibenzocyclooctyne (DBCO), or Rhodamine. In certain embodiment, the chemical moiety is conjugated to the guide by a linker, such as an alkyl chain. In certain embodiments, the chemical moiety of the modified guide can be used to attach the guide to another molecule, such as DNA, RNA, protein, or nanoparticles. Such chemically modified guide can be used to identify or enrich cells generically edited by a CRISPR system (see Lee et al., eLife, 2017, 6:e25312, DOI:10.7554).
[0412] In some embodiments, the modification to the guide is a chemical modification, an insertion, a deletion or a split. In some embodiments, the chemical modification includes, but is not limited to, incorporation of 2′-O-methyl (M) analogs, 2′-deoxy analogs, 2-thiouridine analogs, N6-methyladenosine analogs, 2′-fluoro analogs, 2-aminopurine, 5-bromo-uridine, pseudouridine (Ψ), N1-methylpseudouridine (me1Ψ), 5-methoxyuridine(5moU), inosine, 7-methylguanosine, 2′-O-methyl 3′phosphorothioate (MS), S-constrained ethyl(cEt), phosphorothioate (PS), or 2′-O-methyl 3′thioPACE (MSP). In some embodiments, the guide comprises one or more of phosphorothioate modifications. In certain embodiments, at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or 25 nucleotides of the guide are chemically modified. In certain embodiments, one or more nucleotides in the seed region are chemically modified. In certain embodiments, one or more nucleotides in the 3′-terminus are chemically modified. In certain embodiments, none of the nucleotides in the 5′-handle is chemically modified. In some embodiments, the chemical modification in the seed region is a minor modification, such as incorporation of a 2′-fluoro analog. In a specific embodiment, one nucleotide of the seed region is replaced with a 2′-fluoro analog. In some embodiments, 5 to 10 nucleotides in the 3′-terminus are chemically modified. Such chemical modifications at the 3′-terminus of the Cas13 CrRNA may improve Cas13 activity. In a specific embodiment, 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 nucleotides in the 3′-terminus are replaced with 2′-fluoro analogues. In a specific embodiment, 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 nucleotides in the 3′-terminus are replaced with 2′-O-methyl (M) analogs.
[0413] In some embodiments, the loop of the 5′-handle of the guide is modified. In some embodiments, the loop of the 5′-handle of the guide is modified to have a deletion, an insertion, a split, or chemical modifications. In certain embodiments, the modified loop comprises 3, 4, or 5 nucleotides. In certain embodiments, the loop comprises the sequence of UCUU, UUUU, UAUU, or UGUU.
[0414] In some embodiments, the guide molecule forms a stemloop with a separate non-covalently linked sequence, which can be DNA or RNA. In particular embodiments, the sequences forming the guide are first synthesized using the standard phosphoramidite synthetic protocol (Herdewijn, P., ed., Methods in Molecular Biology Col 288, Oligonucleotide Synthesis: Methods and Applications, Humana Press, New Jersey (2012)). In some embodiments, these sequences can be functionalized to contain an appropriate functional group for ligation using the standard protocol known in the art (Hermanson, G. T., Bioconjugate Techniques, Academic Press (2013)). Examples of functional groups include, but are not limited to, hydroxyl, amine, carboxylic acid, carboxylic acid halide, carboxylic acid active ester, aldehyde, carbonyl, chlorocarbonyl, imidazolylcarbonyl, hydrozide, semicarbazide, thio semicarbazide, thiol, maleimide, haloalkyl, sufonyl, ally, propargyl, diene, alkyne, and azide. Once this sequence is functionalized, a covalent chemical bond or linkage can be formed between this sequence and the direct repeat sequence. Examples of chemical bonds include, but are not limited to, those based on carbamates, ethers, esters, amides, imines, amidines, aminotrizines, hydrozone, disulfides, thioethers, thioesters, phosphorothioates, phosphorodithioates, sulfonamides, sulfonates, fulfones, sulfoxides, ureas, thioureas, hydrazide, oxime, triazole, photolabile linkages, C—C bond forming groups such as Diels-Alder cyclo-addition pairs or ring-closing metathesis pairs, and Michael reaction pairs.
[0415] In some embodiments, these stem-loop forming sequences can be chemically synthesized. In some embodiments, the chemical synthesis uses automated, solid-phase oligonucleotide synthesis machines with 2′-acetoxyethyl orthoester (2′-ACE) (Scaringe et al., J. Am. Chem. Soc. (1998) 120: 11820-11821; Scaringe, Methods Enzymol. (2000) 317: 3-18) or 2′-thionocarbamate (2′-TC) chemistry (Dellinger et al., J. Am. Chem. Soc. (2011) 133: 11540-11546; Hendel et al., Nat. Biotechnol. (2015) 33:985-989).
[0416] In certain embodiments, the guide molecule comprises (1) a guide sequence capable of hybridizing to a target locus and (2) a tracr mate or direct repeat sequence whereby the direct repeat sequence is located upstream (i.e., 5′) from the guide sequence. In a particular embodiment the seed sequence (i.e. the sequence essential critical for recognition and/or hybridization to the sequence at the target locus) of th guide sequence is approximately within the first 10 nucleotides of the guide sequence.
[0417] In a particular embodiment the guide molecule comprises a guide sequence linked to a direct repeat sequence, wherein the direct repeat sequence comprises one or more stem loops or optimized secondary structures. In particular embodiments, the direct repeat has a minimum length of 16 nts and a single stem loop. In further embodiments the direct repeat has a length longer than 16 nts, preferably more than 17 nts, and has more than one stem loops or optimized secondary structures. In particular embodiments the guide molecule comprises or consists of the guide sequence linked to all or part of the natural direct repeat sequence. A typical Type V or Type VI CRISPR-cas guide molecule comprises (in 3′ to 5′ direction or in 5′ to 3′ direction): a guide sequence a first complimentary stretch (the “repeat”), a loop (which is typically 4 or 5 nucleotides long), a second complimentary stretch (the “anti-repeat” being complimentary to the repeat), and a poly A (often poly U in RNA) tail (terminator). In certain embodiments, the direct repeat sequence retains its natural architecture and forms a single stem loop. In particular embodiments, certain aspects of the guide architecture can be modified, for example by addition, subtraction, or substitution of features, whereas certain other aspects of guide architecture are maintained. Preferred locations for engineered guide molecule modifications, including but not limited to insertions, deletions, and substitutions include guide termini and regions of the guide molecule that are exposed when complexed with the CRISPR-Cas protein and/or target, for example the stemloop of the direct repeat sequence.
[0418] In particular embodiments, the stem comprises at least about 4 bp comprising complementary X and Y sequences, although stems of more, e.g., 5, 6, 7, 8, 9, 10, 11 or 12 or fewer, e.g., 3, 2, base pairs are also contemplated. Thus, for example X2-10 and Y2-10 (wherein X and Y represent any complementary set of nucleotides) may be contemplated. In one aspect, the stem made of the X and Y nucleotides, together with the loop will form a complete hairpin in the overall secondary structure; and, this may be advantageous and the amount of base pairs can be any amount that forms a complete hairpin. In one aspect, any complementary X:Y basepairing sequence (e.g., as to length) is tolerated, so long as the secondary structure of the entire guide molecule is preserved. In one aspect, the loop that connects the stem made of X:Y basepairs can be any sequence of the same length (e.g., 4 or 5 nucleotides) or longer that does not interrupt the overall secondary structure of the guide molecule. In one aspect, the stemloop can further comprise, e.g. an MS2 aptamer. In one aspect, the stem comprises about 5-7 bp comprising complementary X and Y sequences, although stems of more or fewer basepairs are also contemplated. In one aspect, non-Watson Crick basepairing is contemplated, where such pairing otherwise generally preserves the architecture of the stemloop at that position.
[0419] In particular embodiments the natural hairpin or stemloop structure of the guide molecule is extended or replaced by an extended stemloop. It has been demonstrated that extension of the stem can enhance the assembly of the guide molecule with the CRISPR-Cas proten (Chen et al. Cell. (2013); 155(7): 1479-1491). In particular embodiments the stem of the stemloop is extended by at least 1, 2, 3, 4, 5 or more complementary basepairs (i.e. corresponding to the addition of 2,4, 6, 8, 10 or more nucleotides in the guide molecule). In particular embodiments these are located at the end of the stem, adjacent to the loop of the stemloop.
[0420] In particular embodiments, the susceptibility of the guide molecule to RNAses or to decreased expression can be reduced by slight modifications of the sequence of the guide molecule which do not affect its function. For instance, in particular embodiments, premature termination of transcription, such as premature transcription of U6 Pol-III, can be removed by modifying a putative Pol-III terminator (4 consecutive U's) in the guide molecules sequence. Where such sequence modification is required in the stemloop of the guide molecule, it is preferably ensured by a basepair flip.
[0421] In a particular embodiment, the direct repeat may be modified to comprise one or more protein-binding RNA aptamers. In a particular embodiment, one or more aptamers may be included such as part of optimized secondary structure. Such aptamers may be capable of binding a bacteriophage coat protein as detailed further herein.
[0422] In some embodiments, the guide molecule forms a duplex with a target RNA comprising at least one target cytosine residue to be edited. Upon hybridization of the guide RNA molecule to the target RNA, the cytidine deaminase binds to the single strand RNA in the duplex made accessible by the mismatch in the guide sequence and catalyzes deamination of one or more target cytosine residues comprised within the stretch of mismatching nucleotides.
[0423] A guide sequence, and hence a nucleic acid-targeting guide RNA may be selected to target any target nucleic acid sequence. The target sequence may be mRNA.
[0424] In certain embodiments, the target sequence should be associated with a PAM (protospacer adjacent motif) or PFS (protospacer flanking sequence or site); that is, a short sequence recognized by the CRISPR complex. Depending on the nature of the CRISPR-Cas protein, the target sequence should be selected such that its complementary sequence in the DNA duplex (also referred to herein as the non-target sequence) is upstream or downstream of the PAM. In the embodiments of the present invention where the CRISPR-Cas protein is a Cas13 protein, the complementary sequence of the target sequence is downstream or 3′ of the PAM or upstream or 5′ of the PAM. The precise sequence and length requirements for the PAM differ depending on the Cas13 protein used, but PAMs are typically 2-5 base pair sequences adjacent the protospacer (that is, the target sequence). Examples of the natural PAM sequences for different Cas13 orthologues are provided herein below and the skilled person will be able to identify further PAM sequences for use with a given Cas13 protein.
[0425] Further, engineering of the PAM Interacting (PI) domain may allow programing of PAM specificity, improve target site recognition fidelity, and increase the versatility of the CRISPR-Cas protein, for example as described for Cas9 in Kleinstiver B P et al. Engineered CRISPR-Cas9 nucleases with altered PAM specificities. Nature. 2015 Jul. 23; 523(7561):481-5. doi: 10.1038/nature14592. As further detailed herein, the skilled person will understand that Cas13 proteins may be modified analogously.
[0426] In particular embodiment, the guide is an escorted guide. By “escorted” is meant that the CRISPR-Cas system or complex or guide is delivered to a selected time or place within a cell, so that activity of the CRISPR-Cas system or complex or guide is spatially or temporally controlled. For example, the activity and destination of the 3 CRISPR-Cas system or complex or guide may be controlled by an escort RNA aptamer sequence that has binding affinity for an aptamer ligand, such as a cell surface protein or other localized cellular component. Alternatively, the escort aptamer may for example be responsive to an aptamer effector on or in the cell, such as a transient effector, such as an external energy source that is applied to the cell at a particular time.
[0427] The escorted CRISPR-Cas systems or complexes have a guide molecule with a functional structure designed to improve guide molecule structure, architecture, stability, genetic expression, or any combination thereof. Such a structure can include an aptamer.
[0428] Aptamers are biomolecules that can be designed or selected to bind tightly to other ligands, for example using a technique called systematic evolution of ligands by exponential enrichment (SELEX; Tuerk C, Gold L: “Systematic evolution of ligands by exponential enrichment: RNA ligands to bacteriophage T4 DNA polymerase.” Science 1990, 249:505-510). Nucleic acid aptamers can for example be selected from pools of random-sequence oligonucleotides, with high binding affinities and specificities for a wide range of biomedically relevant targets, suggesting a wide range of therapeutic utilities for aptamers (Keefe, Anthony D., Supriya Pai, and Andrew Ellington. “Aptamers as therapeutics.” Nature Reviews Drug Discovery 9.7 (2010): 537-550). These characteristics also suggest a wide range of uses for aptamers as drug delivery vehicles (Levy-Nissenbaum, Etgar, et al. “Nanotechnology and aptamers: applications in drug delivery.” Trends in biotechnology 26.8 (2008): 442-449; and, Hicke B J, Stephens A W. “Escort aptamers: a delivery service for diagnosis and therapy.” J Clin Invest 2000, 106:923-928.). Aptamers may also be constructed that function as molecular switches, responding to a que by changing properties, such as RNA aptamers that bind fluorophores to mimic the activity of green fluorescent protein (Paige, Jeremy S., Karen Y. Wu, and Samie R. Jaffrey. “RNA mimics of green fluorescent protein.” Science 333.6042 (2011): 642-646). It has also been suggested that aptamers may be used as components of targeted siRNA therapeutic delivery systems, for example targeting cell surface proteins (Zhou, Jiehua, and John J. Rossi. “Aptamer-targeted cell-specific RNA interference.” Silence 1.1 (2010): 4).
[0429] Accordingly, in particular embodiments, the guide molecule is modified, e.g., by one or more aptamer(s) designed to improve guide molecule delivery, including delivery across the cellular membrane, to intracellular compartments, or into the nucleus. Such a structure can include, either in addition to the one or more aptamer(s) or without such one or more aptamer(s), moiety(ies) so as to render the guide molecule deliverable, inducible or responsive to a selected effector. The invention accordingly comprehends an guide molecule that responds to normal or pathological physiological conditions, including without limitation pH, hypoxia, 02 concentration, temperature, protein concentration, enzymatic concentration, lipid structure, light exposure, mechanical disruption (e.g. ultrasound waves), magnetic fields, electric fields, or electromagnetic radiation.
[0430] Light responsiveness of an inducible system may be achieved via the activation and binding of cryptochrome-2 and CIB1. Blue light stimulation induces an activating conformational change in cryptochrome-2, resulting in recruitment of its binding partner CIB1. This binding is fast and reversible, achieving saturation in <15 sec following pulsed stimulation and returning to baseline <15 min after the end of stimulation. These rapid binding kinetics result in a system temporally bound only by the speed of transcription/translation and transcript/protein degradation, rather than uptake and clearance of inducing agents. Crytochrome-2 activation is also highly sensitive, allowing for the use of low light intensity stimulation and mitigating the risks of phototoxicity. Further, in a context such as the intact mammalian brain, variable light intensity may be used to control the size of a stimulated region, allowing for greater precision than vector delivery alone may offer.
[0431] The invention contemplates energy sources such as electromagnetic radiation, sound energy or thermal energy to induce the guide. Advantageously, the electromagnetic radiation is a component of visible light. In a preferred embodiment, the light is a blue light with a wavelength of about 450 to about 495 nm. In an especially preferred embodiment, the wavelength is about 488 nm. In another preferred embodiment, the light stimulation is via pulses. The light power may range from about 0-9 mW/cm.sup.2. In a preferred embodiment, a stimulation paradigm of as low as 0.25 sec every 15 sec should result in maximal activation.
[0432] The chemical or energy sensitive guide may undergo a conformational change upon induction by the binding of a chemical source or by the energy allowing it act as a guide and have the Cas13 CRISPR-Cas system or complex function. The invention can involve applying the chemical source or energy so as to have the guide function and the Cas13 CRISPR-Cas system or complex function; and optionally further determining that the expression of the genomic locus is altered.
[0433] There are several different designs of this chemical inducible system: 1. ABI-PYL based system inducible by Abscisic Acid (ABA) (see, e.g., stke.sciencemag.org/cgi/content/abstract/sigtrans; 4/164/rs2), 2. FKBP-FRB based system inducible by rapamycin (or related chemicals based on rapamycin) (see, e.g., www.nature.com/nmeth/journal/v2/n6/full/nmeth763.html), 3. GID1-GAI based system inducible by Gibberellin (GA) (see, e.g., www.nature.com/nchembio/journal/v8/n5/full/nchembio.922.html).
[0434] A chemical inducible system can be an estrogen receptor (ER) based system inducible by 4-hydroxytamoxifen (40HT) (see, e.g., www.pnas.org/content/104/3/1027.abstract). A mutated ligand-binding domain of the estrogen receptor called ERT2 translocates into the nucleus of cells upon binding of 4-hydroxytamoxifen. In further embodiments of the invention any naturally occurring or engineered derivative of any nuclear receptor, thyroid hormone receptor, retinoic acid receptor, estrogren receptor, estrogen-related receptor, glucocorticoid receptor, progesterone receptor, androgen receptor may be used in inducible systems analogous to the ER based inducible system.
[0435] Another inducible system is based on the design using Transient receptor potential (TRP) ion channel based system inducible by energy, heat or radio-wave (see, e.g., www.sciencemag.org/content/336/6081/604). These TRP family proteins respond to different stimuli, including light and heat. When this protein is activated by light or heat, the ion channel will open and allow the entering of ions such as calcium into the plasma membrane. This influx of ions will bind to intracellular ion interacting partners linked to a polypeptide including the guide and the other components of the Cas13 CRISPR-Cas complex or system, and the binding will induce the change of sub-cellular localization of the polypeptide, leading to the entire polypeptide entering the nucleus of cells. Once inside the nucleus, the guide protein and the other components of the Cas13 CRISPR-Cas complex will be active and modulating target gene expression in cells.
[0436] While light activation may be an advantageous embodiment, sometimes it may be disadvantageous especially for in vivo applications in which the light may not penetrate the skin or other organs. In this instance, other methods of energy activation are contemplated, in particular, electric field energy and/or ultrasound which have a similar effect.
[0437] Electric field energy is preferably administered substantially as described in the art, using one or more electric pulses of from about 1 Volt/cm to about 10 kVolts/cm under in vivo conditions. Instead of or in addition to the pulses, the electric field may be delivered in a continuous manner. The electric pulse may be applied for between 1 μs and 500 milliseconds, preferably between 1 μs and 100 milliseconds. The electric field may be applied continuously or in a pulsed manner for 5 about minutes.
[0438] As used herein, ‘electric field energy’ is the electrical energy to which a cell is exposed. Preferably the electric field has a strength of from about 1 Volt/cm to about 10 kVolts/cm or more under in vivo conditions (see WO97/49450).
[0439] As used herein, the term “electric field” includes one or more pulses at variable capacitance and voltage and including exponential and/or square wave and/or modulated wave and/or modulated square wave forms. References to electric fields and electricity should be taken to include reference the presence of an electric potential difference in the environment of a cell. Such an environment may be set up by way of static electricity, alternating current (AC), direct current (DC), etc, as known in the art. The electric field may be uniform, non-uniform or otherwise, and may vary in strength and/or direction in a time dependent manner.
[0440] Single or multiple applications of electric field, as well as single or multiple applications of ultrasound are also possible, in any order and in any combination. The ultrasound and/or the electric field may be delivered as single or multiple continuous applications, or as pulses (pulsatile delivery).
[0441] Electroporation has been used in both in vitro and in vivo procedures to introduce foreign material into living cells. With in vitro applications, a sample of live cells is first mixed with the agent of interest and placed between electrodes such as parallel plates. Then, the electrodes apply an electrical field to the cell/implant mixture. Examples of systems that perform in vitro electroporation include the Electro Cell Manipulator ECM600 product, and the Electro Square Porator T820, both made by the BTX Division of Genetronics, Inc (see U.S. Pat. No. 5,869,326).
[0442] The known electroporation techniques (both in vitro and in vivo) function by applying a brief high voltage pulse to electrodes positioned around the treatment region. The electric field generated between the electrodes causes the cell membranes to temporarily become porous, whereupon molecules of the agent of interest enter the cells. In known electroporation applications, this electric field comprises a single square wave pulse on the order of 1000 V/cm, of about 100 .mu.s duration. Such a pulse may be generated, for example, in known applications of the Electro Square Porator T820.
[0443] Preferably, the electric field has a strength of from about 1 V/cm to about 10 kV/cm under in vitro conditions. Thus, the electric field may have a strength of 1 V/cm, 2 V/cm, 3 V/cm, 4 V/cm, 5 V/cm, 6 V/cm, 7 V/cm, 8 V/cm, 9 V/cm, 10 V/cm, 20 V/cm, 50 V/cm, 100 V/cm, 200 V/cm, 300 V/cm, 400 V/cm, 500 V/cm, 600 V/cm, 700 V/cm, 800 V/cm, 900 V/cm, 1 kV/cm, 2 kV/cm, 5 kV/cm, 10 kV/cm, 20 kV/cm, 50 kV/cm or more. More preferably from about 0.5 kV/cm to about 4.0 kV/cm under in vitro conditions. Preferably the electric field has a strength of from about 1 V/cm to about 10 kV/cm under in vivo conditions. However, the electric field strengths may be lowered where the number of pulses delivered to the target site are increased. Thus, pulsatile delivery of electric fields at lower field strengths is envisaged.
[0444] Preferably the application of the electric field is in the form of multiple pulses such as double pulses of the same strength and capacitance or sequential pulses of varying strength and/or capacitance. As used herein, the term “pulse” includes one or more electric pulses at variable capacitance and voltage and including exponential and/or square wave and/or modulated wave/square wave forms.
[0445] Preferably the electric pulse is delivered as a waveform selected from an exponential wave form, a square wave form, a modulated wave form and a modulated square wave form.
[0446] A preferred embodiment employs direct current at low voltage. Thus, Applicants disclose the use of an electric field which is applied to the cell, tissue or tissue mass at a field strength of between 1V/cm and 20V/cm, for a period of 100 milliseconds or more, preferably 15 minutes or more.
[0447] Ultrasound is advantageously administered at a power level of from about 0.05 W/cm2 to about 100 W/cm2. Diagnostic or therapeutic ultrasound may be used, or combinations thereof.
[0448] As used herein, the term “ultrasound” refers to a form of energy which consists of mechanical vibrations the frequencies of which are so high they are above the range of human hearing. Lower frequency limit of the ultrasonic spectrum may generally be taken as about 20 kHz. Most diagnostic applications of ultrasound employ frequencies in the range 1 and 15 MHz′ (From Ultrasonics in Clinical Diagnosis, P. N. T. Wells, ed., 2nd. Edition, Publ. Churchill Livingstone [Edinburgh, London & NY, 1977]).
[0449] Ultrasound has been used in both diagnostic and therapeutic applications. When used as a diagnostic tool (“diagnostic ultrasound”), ultrasound is typically used in an energy density range of up to about 100 mW/cm2 (FDA recommendation), although energy densities of up to 750 mW/cm2 have been used. In physiotherapy, ultrasound is typically used as an energy source in a range up to about 3 to 4 W/cm2 (WHO recommendation). In other therapeutic applications, higher intensities of ultrasound may be employed, for example, HIFU at 100 W/cm up to 1 kW/cm2 (or even higher) for short periods of time. The term “ultrasound” as used in this specification is intended to encompass diagnostic, therapeutic and focused ultrasound.
[0450] Focused ultrasound (FUS) allows thermal energy to be delivered without an invasive probe (see Morocz et al 1998 Journal of Magnetic Resonance Imaging Vol. 8, No. 1, pp. 136-142. Another form of focused ultrasound is high intensity focused ultrasound (HIFU) which is reviewed by Moussatov et al in Ultrasonics (1998) Vol. 36, No. 8, pp. 893-900 and TranHuuHue et al in Acustica (1997) Vol. 83, No. 6, pp. 1103-1106.
[0451] Preferably, a combination of diagnostic ultrasound and a therapeutic ultrasound is employed. This combination is not intended to be limiting, however, and the skilled reader will appreciate that any variety of combinations of ultrasound may be used. Additionally, the energy density, frequency of ultrasound, and period of exposure may be varied.
[0452] Preferably the exposure to an ultrasound energy source is at a power density of from about 0.05 to about 100 Wcm-2. Even more preferably, the exposure to an ultrasound energy source is at a power density of from about 1 to about 15 Wcm-2.
[0453] Preferably the exposure to an ultrasound energy source is at a frequency of from about 0.015 to about 10.0 MHz. More preferably the exposure to an ultrasound energy source is at a frequency of from about 0.02 to about 5.0 MHz or about 6.0 MHz. Most preferably, the ultrasound is applied at a frequency of 3 MHz.
[0454] Preferably the exposure is for periods of from about 10 milliseconds to about 60 minutes. Preferably the exposure is for periods of from about 1 second to about 5 minutes. More preferably, the ultrasound is applied for about 2 minutes. Depending on the particular target cell to be disrupted, however, the exposure may be for a longer duration, for example, for 15 minutes.
[0455] Advantageously, the target tissue is exposed to an ultrasound energy source at an acoustic power density of from about 0.05 Wcm-2 to about 10 Wcm-2 with a frequency ranging from about 0.015 to about 10 MHz (see WO 98/52609). However, alternatives are also possible, for example, exposure to an ultrasound energy source at an acoustic power density of above 100 Wcm-2, but for reduced periods of time, for example, 1000 Wcm-2 for periods in the millisecond range or less.
[0456] Preferably the application of the ultrasound is in the form of multiple pulses; thus, both continuous wave and pulsed wave (pulsatile delivery of ultrasound) may be employed in any combination. For example, continuous wave ultrasound may be applied, followed by pulsed wave ultrasound, or vice versa. This may be repeated any number of times, in any order and combination. The pulsed wave ultrasound may be applied against a background of continuous wave ultrasound, and any number of pulses may be used in any number of groups.
[0457] Preferably, the ultrasound may comprise pulsed wave ultrasound. In a highly preferred embodiment, the ultrasound is applied at a power density of 0.7 Wcm-2 or 1.25 Wcm-2 as a continuous wave. Higher power densities may be employed if pulsed wave ultrasound is used.
[0458] Use of ultrasound is advantageous as, like light, it may be focused accurately on a target. Moreover, ultrasound is advantageous as it may be focused more deeply into tissues unlike light. It is therefore better suited to whole-tissue penetration (such as but not limited to a lobe of the liver) or whole organ (such as but not limited to the entire liver or an entire muscle, such as the heart) therapy. Another important advantage is that ultrasound is a non-invasive stimulus which is used in a wide variety of diagnostic and therapeutic applications. By way of example, ultrasound is well known in medical imaging techniques and, additionally, in orthopedic therapy. Furthermore, instruments suitable for the application of ultrasound to a subject vertebrate are widely available and their use is well known in the art.
[0459] In particular embodiments, the guide molecule is modified by a secondary structure to increase the specificity of the CRISPR-Cas system and the secondary structure can protect against exonuclease activity and allow for 5′ additions to the guide sequence also referred to herein as a protected guide molecule.
[0460] In one aspect, the invention provides for hybridizing a “protector RNA” to a sequence of the guide molecule, wherein the “protector RNA” is an RNA strand complementary to the 3′ end of the guide molecule to thereby generate a partially double-stranded guide RNA. In an embodiment of the invention, protecting mismatched bases (i.e. the bases of the guide molecule which do not form part of the guide sequence) with a perfectly complementary protector sequence decreases the likelihood of target RNA binding to the mismatched basepairs at the 3′ end. In particular embodiments of the invention, additional sequences comprising an extended length may also be present within the guide molecule such that the guide comprises a protector sequence within the guide molecule. This “protector sequence” ensures that the guide molecule comprises a “protected sequence” in addition to an “exposed sequence” (comprising the part of the guide sequence hybridizing to the target sequence). In particular embodiments, the guide molecule is modified by the presence of the protector guide to comprise a secondary structure such as a hairpin. Advantageously there are three or four to thirty or more, e.g., about 10 or more, contiguous base pairs having complementarity to the protected sequence, the guide sequence or both. It is advantageous that the protected portion does not impede thermodynamics of the CRISPR-Cas system interacting with its target. By providing such an extension including a partially double stranded guide molecule, the guide molecule is considered protected and results in improved specific binding of the CRISPR-Cas complex, while maintaining specific activity.
[0461] In particular embodiments, use is made of a truncated guide (tru-guide), i.e. a guide molecule which comprises a guide sequence which is truncated in length with respect to the canonical guide sequence length. As described by Nowak et al. (Nucleic Acids Res (2016) 44 (20): 9555-9564), such guides may allow catalytically active CRISPR-Cas enzyme to bind its target without cleaving the target RNA. In particular embodiments, a truncated guide is used which allows the binding of the target but retains only nickase activity of the CRISPR-Cas enzyme.
CRISPR RNA-Targeting Effector Proteins
[0462] In one example embodiment, the CRISPR system effector protein is an RNA-targeting effector protein. In certain embodiments, the CRISPR system effector protein is a Type VI CRISPR system targeting RNA (e.g., Cas13a, Cas13b, Cas13c or Cas13d). Example RNA-targeting effector proteins include Cas13b and C2c2 (now known as Cas13a). It will be understood that the term “C2c2” herein is used interchangeably with “Cas13a”. “C2c2” is now referred to as “Cas13a”, and the terms are used interchangeably herein unless indicated otherwise. As used herein, the term “Cas13” refers to any Type VI CRISPR system targeting RNA (e.g., Cas13a, Cas13b, Cas13c or Cas13d). When the CRISPR protein is a C2c2 protein, a tracrRNA is not required. C2c2 has been described in Abudayyeh et al. (2016) “C2c2 is a single-component programmable RNA-guided RNA-targeting CRISPR effector”; Science; DOI: 10.1126/science.aaf5573; and Shmakov et al. (2015) “Discovery and Functional Characterization of Diverse Class 2 CRISPR-Cas Systems”, Molecular Cell, DOI: dx.doi.org/10.1016/j.molcel.2015.10.008; which are incorporated herein in their entirety by reference. Cas13b has been described in Smargon et al. (2017) “Cas13b Is a Type VI-B CRISPR-Associated RNA-Guided RNases Differentially Regulated by Accessory Proteins Csx27 and Csx28,” Molecular Cell. 65, 1-13; dx.doi.org/10.1016/j.molcel.2016.12.023., which is incorporated herein in its entirety by reference.
[0463] In some embodiments, one or more elements of a nucleic acid-targeting system is derived from a particular organism comprising an endogenous CRISPR RNA-targeting system. In certain example embodiments, the effector protein CRISPR RNA-targeting system comprises at least one HEPN domain, including but not limited to the HEPN domains described herein, HEPN domains known in the art, and domains recognized to be HEPN domains by comparison to consensus sequence motifs. Several such domains are provided herein. In one non-limiting example, a consensus sequence can be derived from the sequences of C2c2 or Cas13b orthologs provided herein. In certain example embodiments, the effector protein comprises a single HEPN domain. In certain other example embodiments, the effector protein comprises two HEPN domains.
[0464] In one example embodiment, the effector protein comprise one or more HEPN domains comprising a RxxxxH motif sequence. The RxxxxH motif sequence can be, without limitation, from a HEPN domain described herein or a HEPN domain known in the art. RxxxxH motif sequences further include motif sequences created by combining portions of two or more HEPN domains. As noted, consensus sequences can be derived from the sequences of the orthologs disclosed in U.S. Provisional Patent Application 62/432,240 entitled “Novel CRISPR Enzymes and Systems,” U.S. Provisional Patent Application 62/471,710 entitled “Novel Type VI CRISPR Orthologs and Systems” filed on Mar. 15, 2017, and U.S. Provisional Patent Application entitled “Novel Type VI CRISPR Orthologs and Systems,” labeled as attorney docket number 47627-05-2133 and filed on Apr. 12, 2017.
[0465] In certain other example embodiments, the CRISPR system effector protein is a C2c2 nuclease. The activity of C2c2 may depend on the presence of two HEPN domains. These have been shown to be RNase domains, i.e. nuclease (in particular an endonuclease) cutting RNA. C2c2 HEPN may also target DNA, or potentially DNA and/or RNA. On the basis that the HEPN domains of C2c2 are at least capable of binding to and, in their wild-type form, cutting RNA, then it is preferred that the C2c2 effector protein has RNase function. Regarding C2c2 CRISPR systems, reference is made to U.S. Provisional 62/351,662 filed on Jun. 17, 2016 and U.S. Provisional 62/376,377 filed on Aug. 17, 2016. Reference is also made to U.S. Provisional 62/351,803 filed on Jun. 17, 2016. Reference is also made to U.S. Provisional entitled “Novel Crispr Enzymes and Systems” filed Dec. 8, 2016 bearing Broad Institute No. 10035.PA4 and Attorney Docket No. 47627.03.2133. Reference is further made to East-Seletsky et al. “Two distinct RNase activities of CRISPR-C2c2 enable guide-RNA processing and RNA detection” Nature doi:10/1038/nature19802 and Abudayyeh etal. “C2c2 is a single-component programmable RNA-guided RNA targeting CRISPR effector” bioRxiv doi:10.1101/054742.
[0466] In certain embodiments, the C2c2 effector protein is from an organism of a genus selected from the group consisting of: Leptotrichia, Listeria, Corynebacter, Sutterella, Legionella, Treponema, Filifactor, Eubacterium, Streptococcus, Lactobacillus, Mycoplasma, Bacteroides, Flaviivola, Flavobacterium, Sphaerochaeta, Azospirillum, Gluconacetobacter, Neisseria, Roseburia, Parvibaculum, Staphylococcus, Nitratifractor, Mycoplasma, Campylobacter, and Lachnospira, or the C2c2 effector protein is an organism selected from the group consisting of: Leptotrichia shahii, Leptotrichia. wadei, Listeria seeligeri, Clostridium aminophilum, Carnobacterium gallinarum, Paludibacter propionicigenes, Listeria weihenstephanensis, or the C2c2 effector protein is a L. wadei F0279 or L. wadei F0279 (Lw2) C2C2 effector protein. In another embodiment, the one or more guide RNAs are designed to detect a single nucleotide polymorphism, splice variant of a transcript, or a frameshift mutation in a target RNA or DNA.
[0467] In certain example embodiments, the RNA-targeting effector protein is a Type VI-B effector protein, such as Cas13b and Group 29 or Group 30 proteins. In certain example embodiments, the RNA-targeting effector protein comprises one or more HEPN domains. In certain example embodiments, the RNA-targeting effector protein comprises a C-terminal HEPN domain, a N-terminal HEPN domain, or both. Regarding example Type VI-B effector proteins that may be used in the context of this invention, reference is made to U.S. application Ser. No. 15/331,792 entitled “Novel CRISPR Enzymes and Systems” and filed Oct. 21, 2016, International Patent Application No. PCT/US2016/058302 entitled “Novel CRISPR Enzymes and Systems”, and filed Oct. 21, 2016, and Smargon et al. “Cas13b is a Type VI-B CRISPR-associated RNA-Guided RNase differentially regulated by accessory proteins Csx27 and Csx28” Molecular Cell, 65, 1-13 (2017); dx.doi.org/10.1016/j.molcel.2016.12.023, and U.S. Provisional Application No. to be assigned, entitled “Novel Cas13b Orthologues CRISPR Enzymes and System” filed Mar. 15, 2017. In particular embodiments, the Cas13b enzyme is derived from Bergeyella zoohelcum.
[0468] In certain example embodiments, the RNA-targeting effector protein is a Cas13c effector protein as disclosed in U.S. Provisional Patent Application No. 62/525,165 filed Jun. 26, 2017, and PCT Application No. US 2017/047193 filed Aug. 16, 2017.
[0469] In some embodiments, one or more elements of a nucleic acid-targeting system is derived from a particular organism comprising an endogenous CRISPR RNA-targeting system. In certain embodiments, the CRISPR RNA-targeting system is found in Eubacterium and Ruminococcus. In certain embodiments, the effector protein comprises targeted and collateral ssRNA cleavage activity. In certain embodiments, the effector protein comprises dual HEPN domains. In certain embodiments, the effector protein lacks a counterpart to the Helical-1 domain of Cas13a. In certain embodiments, the effector protein is smaller than previously characterized class 2 CRISPR effectors, with a median size of 928 aa. This median size is 190 aa (17%) less than that of Cas13c, more than 200 aa (18%) less than that of Cas13b, and more than 300 aa (26%) less than that of Cas13a. In certain embodiments, the effector protein has no requirement for a flanking sequence (e.g., PFS, PAM).
[0470] In certain embodiments, the effector protein locus structures include a WYL domain containing accessory protein (so denoted after three amino acids that were conserved in the originally identified group of these domains; see, e.g., WYL domain IPR026881). In certain embodiments, the WYL domain accessory protein comprises at least one helix-turn-helix (HTH) or ribbon-helix-helix (RHH) DNA-binding domain. In certain embodiments, the WYL domain containing accessory protein increases both the targeted and the collateral ssRNA cleavage activity of the RNA-targeting effector protein. In certain embodiments, the WYL domain containing accessory protein comprises an N-terminal RHH domain, as well as a pattern of primarily hydrophobic conserved residues, including an invariant tyrosine-leucine doublet corresponding to the original WYL motif. In certain embodiments, the WYL domain containing accessory protein is WYLL. WYL1 is a single WYL-domain protein associated primarily with Ruminococcus.
[0471] In other example embodiments, the Type VI RNA-targeting Cas enzyme is Cas13d. In certain embodiments, Cas13d is Eubacterium siraeum DSM 15702 (EsCas13d) or Ruminococcus sp. N15.MGS-57 (RspCas13d) (see, e.g., Yan et al., Cas13d Is a Compact RNA-Targeting Type VI CRISPR Effector Positively Modulated by a WYL-Domain-Containing Accessory Protein, Molecular Cell (2018), doi.org/10.1016/j.molcel.2018.02.028). RspCas13d and EsCas13d have no flanking sequence requirements (e.g., PFS, PAM).
Cas13 RNA Editing
[0472] In one aspect, the invention provides a method of modifying or editing a target transcript in a eukaryotic cell. In some embodiments, the method comprises allowing a CRISPR-Cas effector module complex to bind to the target polynucleotide to effect RNA base editing, wherein the CRISPR-Cas effector module complex comprises a Cas effector module complexed with a guide sequence hybridized to a target sequence within said target polynucleotide, wherein said guide sequence is linked to a direct repeat sequence. In some embodiments, the Cas effector module comprises a catalytically inactive CRISPR-Cas protein. In some embodiments, the guide sequence is designed to introduce one or more mismatches to the RNA/RNA duplex formed between the target sequence and the guide sequence. In particular embodiments, the mismatch is an A-C mismatch. In some embodiments, the Cas effector may associate with one or more functional domains (e.g. via fusion protein or suitable linkers). In some embodiments, the effector domain comprises one or more cytindine or adenosine deaminases that mediate endogenous editing of via hydrolytic deamination. In particular embodiments, the effector domain comprises the adenosine deaminase acting on RNA (ADAR) family of enzymes. In particular embodiments, the adenosine deaminase protein or catalytic domain thereof capable of deaminating adenosine or cytidine in RNA or is an RNA specific adenosine deaminase and/or is a bacterial, human, cephalopod, or Drosophila adenosine deaminase protein or catalytic domain thereof, preferably TadA, more preferably ADAR, optionally huADAR, optionally (hu)ADAR1 or (hu)ADAR2, preferably huADAR2 or catalytic domain thereof.
[0473] The present application relates to modifying a target RNA sequence of interest (see, e.g, Cox et al., Science. 2017 Nov. 24; 358(6366):1019-1027). Using RNA-targeting rather than DNA targeting offers several advantages relevant for therapeutic development. First, there are substantial safety benefits to targeting RNA: there will be fewer off-target events because the available sequence space in the transcriptome is significantly smaller than the genome, and if an off-target event does occur, it will be transient and less likely to induce negative side effects. Second, RNA-targeting therapeutics will be more efficient because they are cell-type independent and not have to enter the nucleus, making them easier to deliver.
[0474] A further aspect of the invention relates to the method and composition as envisaged herein for use in prophylactic or therapeutic treatment, preferably wherein said target locus of interest is within a human or animal and to methods of modifying an Adenine or Cytidine in a target RNA sequence of interest, comprising delivering to said target RNA, the composition as described herein. In particular embodiments, the CRISPR system and the adenonsine deaminase, or catalytic domain thereof, are delivered as one or more polynucleotide molecules, as a ribonucleoprotein complex, optionally via particles, vesicles, or one or more viral vectors. In particular embodiments, the invention thus comprises compositions for use in therapy. This implies that the methods can be performed in vivo, ex vivo or in vitro. In particular embodiments, when the target is a human or animal target, the method is carried out ex vivo or in vitro.
[0475] A further aspect of the invention relates to the method as envisaged herein for use in prophylactic or therapeutic treatment, preferably wherein said target of interest is within a human or animal and to methods of modifying an Adenine or Cytidine in a target RNA sequence of interest, comprising delivering to said target RNA, the composition as described herein. In particular embodiments, the CRISPR system and the adenonsine deaminase, or catalytic domain thereof, are delivered as one or more polynucleotide molecules, as a ribonucleoprotein complex, optionally via particles, vesicles, or one or more viral vectors.
[0476] In one aspect, the invention provides a method of generating a eukaryotic cell comprising a modified or edited gene. In some embodiments, the method comprises (a) introducing one or more vectors into a eukaryotic cell, wherein the one or more vectors drive expression of one or more of: Cas effector module, and a guide sequence linked to a direct repeat sequence, wherein the Cas effector module associate one or more effector domains that mediate base editing, and (b) allowing a CRISPR-Cas effector module complex to bind to a target polynucleotide to effect base editing of the target polynucleotide within said disease gene, wherein the CRISPR-Cas effector module complex comprises a Cas effector module complexed with the guide sequence that is hybridized to the target sequence within the target polynucleotide, wherein the guide sequence may be designed to introduce one or more mismatches between the RNA/RNA duplex formed between the guide sequence and the target sequence. In particular embodiments, the mismatch is an A-C mismatch. In some embodiments, the Cas effector may associate with one or more functional domains (e.g. via fusion protein or suitable linkers). In some embodiments, the effector domain comprises one or more cytidine or adenosine deaminases that mediate endogenous editing of via hydrolytic deamination. In particular embodiments, the effector domain comprises the adenosine deaminase acting on RNA (ADAR) family of enzymes. In particular embodiments, the adenosine deaminase protein or catalytic domain thereof capable of deaminating adenosine or cytidine in RNA or is an RNA specific adenosine deaminase and/or is a bacterial, human, cephalopod, or Drosophila adenosine deaminase protein or catalytic domain thereof, preferably TadA, more preferably ADAR, optionally huADAR, optionally (hu)ADAR1 or (hu)ADAR2, preferably huADAR2 or catalytic domain thereof.
[0477] The present invention may also use a Cas12 CRISPR enzyme. Cas12 enzymes include Cas12a (Cpf1), Cas12b (C2c1), and Cas12c (C2c3), described further herein.
[0478] A further aspect relates to an isolated cell obtained or obtainable from the methods described herein comprising the composition described herein or progeny of said modified cell, preferably wherein said cell comprises a hypoxanthine or a guanine in replace of said Adenine in said target RNA of interest compared to a corresponding cell not subjected to the method. In particular embodiments, the cell is a eukaryotic cell, preferably a human or non-human animal cell, optionally a therapeutic T cell or an antibody-producing B-cell.
[0479] In some embodiments, the modified cell is a therapeutic T cell, such as a T cell suitable for adoptive cell transfer therapies (e.g., CAR-T therapies). The modification may result in one or more desirable traits in the therapeutic T cell, as described further herein.
[0480] The invention further relates to a method for cell therapy, comprising administering to a patient in need thereof the modified cell described herein, wherein the presence of the modified cell remedies a disease in the patient.
[0481] The present invention may be further illustrated and extended based on aspects of CRISPR-Cas development and use as set forth in the following articles and particularly as relates to delivery of a CRISPR protein complex and uses of an RNA guided endonuclease in cells and organisms: [0482] Multiplex genome engineering using CRISPR-Cas systems. Cong, L., Ran, F. A., Cox, D., Lin, S., Barretto, R., Habib, N., Hsu, P. D., Wu, X., Jiang, W., Marraffini, L. A., & Zhang, F. Science February 15; 339(6121):819-23 (2013); [0483] RNA-guided editing of bacterial genomes using CRISPR-Cas systems. Jiang W., Bikard D., Cox D., Zhang F, Marraffini L A. Nat Biotechnol March; 31(3):233-9 (2013); [0484] One-Step Generation of Mice Carrying Mutations in Multiple Genes by CRISPR-Cas-Mediated Genome Engineering. Wang H., Yang H., Shivalila C S., Dawlaty M M., Cheng A W., Zhang F., Jaenisch R. Cell May 9; 153(4):910-8 (2013); [0485] Optical control of mammalian endogenous transcription and epigenetic states. Konermann S, Brigham M D, Trevino A E, Hsu P D, Heidenreich M, Cong L, Platt R J, Scott D A, Church G M, Zhang F. Nature. August 22; 500(7463):472-6. doi: 10.1038/Nature12466. Epub 2013 August 23 (2013); [0486] Double Nicking by RNA-Guided CRISPR Cas9 for Enhanced Genome Editing Specificity. Ran, FA., Hsu, P D., Lin, C Y., Gootenberg, J S., Konermann, S., Trevino, A E., Scott, D A., Inoue, A., Matoba, S., Zhang, Y., & Zhang, F. Cell August 28. pii: S0092-8674(13)01015-5 (2013-A); [0487] DNA targeting specificity of RNA-guided Cas9 nucleases. Hsu, P., Scott, D., Weinstein, J., Ran, F A., Konermann, S., Agarwala, V., Li, Y., Fine, E., Wu, X., Shalem, O., Cradick, T J., Marraffini, L A., Bao, G., & Zhang, F. Nat Biotechnol doi:10.1038/nbt.2647 (2013); [0488] Genome engineering using the CRISPR-Cas9 system. Ran, F A., Hsu, P D., Wright, J., Agarwala, V., Scott, DA., Zhang, F. Nature Protocols November; 8(11):2281-308 (2013-B); [0489] Genome-Scale CRISPR-Cas9 Knockout Screening in Human Cells. Shalem, O., Sanjana, N E., Hartenian, E., Shi, X., Scott, D A., Mikkelson, T., Heckl, D., Ebert, BL., Root, D E., Doench, J G., Zhang, F. Science December 12. (2013); [0490] Crystal structure of cas9 in complex with guide RNA and target DNA. Nishimasu, H., Ran, FA., Hsu, PD., Konermann, S., Shehata, S I., Dohmae, N., Ishitani, R., Zhang, F., Nureki, O. Cell February 27, 156(5):935-49 (2014); [0491] Genome-wide binding of the CRISPR endonuclease Cas9 in mammalian cells. Wu X., Scott D A., Kriz A J., Chiu A C., Hsu P D., Dadon D B., Cheng A W., Trevino A E., Konermann S., Chen S., Jaenisch R., Zhang F., Sharp P A. Nat Biotechnol. April 20. doi: 10.1038/nbt.2889 (2014); [0492] CRISPR-Cas9 Knockin Mice for Genome Editing and Cancer Modeling. Platt R J, Chen S, Zhou Y, Yim M J, Swiech L, Kempton H R, Dahlman J E, Parnas O, Eisenhaure T M, Jovanovic M, Graham D B, Jhunjhunwala S, Heidenreich M, Xavier R J, Langer R, Anderson D G, Hacohen N, Regev A, Feng G, Sharp P A, Zhang F. Cell 159(2): 440-455 DOI: 10.1016/j.cell.2014.09.014(2014); [0493] Development and Applications of CRISPR-Cas9 for Genome Engineering, Hsu P D, Lander E S, Zhang F., Cell. June 5; 157(6):1262-78 (2014). [0494] Genetic screens in human cells using the CRISPR-Cas9 system, Wang T, Wei J J, Sabatini D M, Lander E S., Science. January 3; 343(6166): 80-84. doi:10.1126/science.1246981 (2014); [0495] Rational design of highly active sgRNAs for CRISPR-Cas9-mediated gene inactivation, Doench J G, Hartenian E, Graham D B, Tothova Z, Hegde M, Smith I, Sullender M, Ebert B L, Xavier R J, Root D E., (published online 3 Sep. 2014) Nat Biotechnol. December; 32(12):1262-7 (2014); [0496] In vivo interrogation of gene function in the mammalian brain using CRISPR-Cas9, Swiech L, Heidenreich M, Banerjee A, Habib N, Li Y, Trombetta J, Sur M, Zhang F., (published online 19 Oct. 2014) Nat Biotechnol. January; 33(1):102-6 (2015); [0497] Genome-scale transcriptional activation by an engineered CRISPR-Cas9 complex, Konermann S, Brigham M D, Trevino A E, Joung J, Abudayyeh O O, Barcena C, Hsu P D, Habib N, Gootenberg J S, Nishimasu H, Nureki O, Zhang F., Nature. January 29; 517(7536):583-8 (2015). [0498] A split-Cas9 architecture for inducible genome editing and transcription modulation, Zetsche B, Volz S E, Zhang F., (published online 2 Feb. 2015) Nat Biotechnol. February; 33(2):139-42 (2015); [0499] Genome-wide CRISPR Screen in a Mouse Model of Tumor Growth and Metastasis, Chen S, Sanjana N E, Zheng K, Shalem O, Lee K, Shi X, Scott D A, Song J, Pan J Q, Weissleder R, Lee H, Zhang F, Sharp P A. Cell 160, 1246-1260, Mar. 12, 2015 (multiplex screen in mouse), and [0500] In vivo genome editing using Staphylococcus aureus Cas9, Ran F A, Cong L, Yan W X, Scott D A, Gootenberg J S, Kriz A J, Zetsche B, Shalem O, Wu X, Makarova K S, Koonin E V, Sharp P A, Zhang F., (published online 1 Apr. 2015), Nature. April 9; 520(7546):186-91(2015). [0501] Shalem et al., “High-throughput functional genomics using CRISPR-Cas9,” Nature Reviews Genetics 16, 299-311 (May 2015). [0502] Xu et al., “Sequence determinants of improved CRISPR sgRNA design,” Genome Research 25, 1147-1157 (August 2015). [0503] Parnas et al., “A Genome-wide CRISPR Screen in Primary Immune Cells to Dissect Regulatory Networks,” Cell 162, 675-686 (Jul. 30, 2015). [0504] Ramanan et al., CRISPR-Cas9 cleavage of viral DNA efficiently suppresses hepatitis B virus,” Scientific Reports 5:10833. doi: 10.1038/srep10833 (Jun. 2, 2015) [0505] Nishimasu et al., Crystal Structure of Staphylococcus aureus Cas9,” Cell 162, 1113-1126 (Aug. 27, 2015) [0506] BCL11A enhancer dissection by Cas9-mediated in situ saturating mutagenesis, Canver et al., Nature 527(7577):192-7 (Nov. 12, 2015) doi: 10.1038/nature15521. Epub 2015 September 16. [0507] Cpf1 Is a Single RNA-Guided Endonuclease of a Class 2 CRISPR-Cas System, Zetsche et al., Cell 163, 759-71 (Sep. 25, 2015). [0508] Discovery and Functional Characterization of Diverse Class 2 CRISPR-Cas Systems, Shmakov et al., Molecular Cell, 60(3), 385-397 doi: 10.1016/j.molcel.2015.10.008 Epub Oct. 22, 2015. [0509] Rationally engineered Cas9 nucleases with improved specificity, Slaymaker et al., Science 2016 Jan. 1 351(6268): 84-88 doi: 10.1126/science.aad5227. Epub 2015 Dec. 1. [0510] Gao et al, “Engineered Cpf1 Enzymes with Altered PAM Specificities,” bioRxiv 091611; doi: http://dx.doi.org/10.1101/091611 (Dec. 4, 2016). [0511] Cox et al., “RNA editing with CRISPR-Cas13,” Science. 2017 Nov. 24; 358(6366):1019-1027. doi: 10.1126/science.aaq0180. Epub 2017 Oct. 25. [0512] Gaudelli et al. “Programmable base editing of A-T to G-C in genomic DNA without DNA cleavage” Nature 464(551); 464-471 (2017).
each of which is incorporated herein by reference, may be considered in the practice of the instant invention, and discussed briefly below: [0513] Cong et al. engineered type II CRISPR-Cas systems for use in eukaryotic cells based on both Streptococcus thermophilus Cas9 and also Streptococcus pyogenes Cas9 and demonstrated that Cas9 nucleases can be directed by short RNAs to induce precise cleavage of DNA in human and mouse cells. Their study further showed that Cas9 as converted into a nicking enzyme can be used to facilitate homology-directed repair in eukaryotic cells with minimal mutagenic activity. Additionally, their study demonstrated that multiple guide sequences can be encoded into a single CRISPR array to enable simultaneous editing of several at endogenous genomic loci sites within the mammalian genome, demonstrating easy programmability and wide applicability of the RNA-guided nuclease technology. This ability to use RNA to program sequence specific DNA cleavage in cells defined a new class of genome engineering tools. These studies further showed that other CRISPR loci are likely to be transplantable into mammalian cells and can also mediate mammalian genome cleavage. Importantly, it can be envisaged that several aspects of the CRISPR-Cas system can be further improved to increase its efficiency and versatility. [0514] Jiang et al. used the clustered, regularly interspaced, short palindromic repeats (CRISPR)-associated Cas9 endonuclease complexed with dual-RNAs to introduce precise mutations in the genomes of Streptococcus pneumoniae and Escherichia coli. The approach relied on dual-RNA:Cas9-directed cleavage at the targeted genomic site to kill unmutated cells and circumvents the need for selectable markers or counter-selection systems. The study reported reprogramming dual-RNA:Cas9 specificity by changing the sequence of short CRISPR RNA (crRNA) to make single- and multinucleotide changes carried on editing templates. The study showed that simultaneous use of two crRNAs enabled multiplex mutagenesis. Furthermore, when the approach was used in combination with recombineering, in S. pneumoniae, nearly 100% of cells that were recovered using the described approach contained the desired mutation, and in E. coli, 65% that were recovered contained the mutation. [0515] Wang et al. (2013) used the CRISPR-Cas system for the one-step generation of mice carrying mutations in multiple genes which were traditionally generated in multiple steps by sequential recombination in embryonic stem cells and/or time-consuming intercrossing of mice with a single mutation. The CRISPR-Cas system will greatly accelerate the in vivo study of functionally redundant genes and of epistatic gene interactions. [0516] Konermann et al. (2013) addressed the need in the art for versatile and robust technologies that enable optical and chemical modulation of DNA-binding domains based CRISPR Cas9 enzyme and also Transcriptional Activator Like Effectors [0517] Ran et al. (2013-A) described an approach that combined a Cas9 nickase mutant with paired guide RNAs to introduce targeted double-strand breaks. This addresses the issue of the Cas9 nuclease from the microbial CRISPR-Cas system being targeted to specific genomic loci by a guide sequence, which can tolerate certain mismatches to the DNA target and thereby promote undesired off-target mutagenesis. Because individual nicks in the genome are repaired with high fidelity, simultaneous nicking via appropriately offset guide RNAs is required for double-stranded breaks and extends the number of specifically recognized bases for target cleavage. The authors demonstrated that using paired nicking can reduce off-target activity by 50- to 1,500-fold in cell lines and to facilitate gene knockout in mouse zygotes without sacrificing on-target cleavage efficiency. This versatile strategy enables a wide variety of genome editing applications that require high specificity. [0518] Hsu et al. (2013) characterized SpCas9 targeting specificity in human cells to inform the selection of target sites and avoid off-target effects. The study evaluated >700 guide RNA variants and SpCas9-induced indel mutation levels at >100 predicted genomic off-target loci in 293T and 293FT cells. The authors that SpCas9 tolerates mismatches between guide RNA and target DNA at different positions in a sequence-dependent manner, sensitive to the number, position and distribution of mismatches. The authors further showed that SpCas9-mediated cleavage is unaffected by DNA methylation and that the dosage of SpCas9 and guide RNA can be titrated to minimize off-target modification. Additionally, to facilitate mammalian genome engineering applications, the authors reported providing a web-based software tool to guide the selection and validation of target sequences as well as off-target analyses. [0519] Ran et al. (2013-B) described a set of tools for Cas9-mediated genome editing via non-homologous end joining (NHEJ) or homology-directed repair (HDR) in mammalian cells, as well as generation of modified cell lines for downstream functional studies. To minimize off-target cleavage, the authors further described a double-nicking strategy using the Cas9 nickase mutant with paired guide RNAs. The protocol provided by the authors experimentally derived guidelines for the selection of target sites, evaluation of cleavage efficiency and analysis of off-target activity. The studies showed that beginning with target design, gene modifications can be achieved within as little as 1-2 weeks, and modified clonal cell lines can be derived within 2-3 weeks. [0520] Shalem et al. described a new way to interrogate gene function on a genome-wide scale. Their studies showed that delivery of a genome-scale CRISPR-Cas9 knockout (GeCKO) library targeted 18,080 genes with 64,751 unique guide sequences enabled both negative and positive selection screening in human cells. First, the authors showed use of the GeCKO library to identify genes essential for cell viability in cancer and pluripotent stem cells. Next, in a melanoma model, the authors screened for genes whose loss is involved in resistance to vemurafenib, a therapeutic that inhibits mutant protein kinase BRAF. Their studies showed that the highest-ranking candidates included previously validated genes NF1 and MED12 as well as novel hits NF2, CUL3, TADA2B, and TADA1. The authors observed a high level of consistency between independent guide RNAs targeting the same gene and a high rate of hit confirmation, and thus demonstrated the promise of genome-scale screening with Cas9. [0521] Nishimasu et al. reported the crystal structure of Streptococcuspyogenes Cas9 in complex with sgRNA and its target DNA at 2.5 Aº resolution. The structure revealed a bilobed architecture composed of target recognition and nuclease lobes, accommodating the sgRNA:DNA heteroduplex in a positively charged groove at their interface. Whereas the recognition lobe is essential for binding sgRNA and DNA, the nuclease lobe contains the HNH and RuvC nuclease domains, which are properly positioned for cleavage of the complementary and non-complementary strands of the target DNA, respectively. The nuclease lobe also contains a carboxyl-terminal domain responsible for the interaction with the protospacer adjacent motif (PAM). This high-resolution structure and accompanying functional analyses have revealed the molecular mechanism of RNA-guided DNA targeting by Cas9, thus paving the way for the rational design of new, versatile genome-editing technologies. [0522] Wu et al. mapped genome-wide binding sites of a catalytically inactive Cas9 (dCas9) from Streptococcus pyogenes loaded with single guide RNAs (sgRNAs) in mouse embryonic stem cells (mESCs). The authors showed that each of the four sgRNAs tested targets dCas9 to between tens and thousands of genomic sites, frequently characterized by a 5-nucleotide seed region in the sgRNA and an NGG protospacer adjacent motif (PAM). Chromatin inaccessibility decreases dCas9 binding to other sites with matching seed sequences; thus 70% of off-target sites are associated with genes. The authors showed that targeted sequencing of 295 dCas9 binding sites in mESCs transfected with catalytically active Cas9 identified only one site mutated above background levels. The authors proposed a two-state model for Cas9 binding and cleavage, in which a seed match triggers binding but extensive pairing with target DNA is required for cleavage. [0523] Platt et al. established a Cre-dependent Cas9 knockin mouse. The authors demonstrated in vivo as well as ex vivo genome editing using adeno-associated virus (AAV)-, lentivirus-, or particle-mediated delivery of guide RNA in neurons, immune cells, and endothelial cells. [0524] Hsu et al. (2014) is a review article that discusses generally CRISPR-Cas9 history from yogurt to genome editing, including genetic screening of cells. [0525] Wang et al. (2014) relates to a pooled, loss-of-function genetic screening approach suitable for both positive and negative selection that uses a genome-scale lentiviral single guide RNA (sgRNA) library. [0526] Doench et al. created a pool of sgRNAs, tiling across all possible target sites of a panel of six endogenous mouse and three endogenous human genes and quantitatively assessed their ability to produce null alleles of their target gene by antibody staining and flow cytometry. The authors showed that optimization of the PAM improved activity and also provided an on-line tool for designing sgRNAs. [0527] Swiech et al. demonstrate that AAV-mediated SpCas9 genome editing can enable reverse genetic studies of gene function in the brain. [0528] Konermann et al. (2015) discusses the ability to attach multiple effector domains, e.g., transcriptional activator, functional and epigenomic regulators at appropriate positions on the guide such as stem or tetraloop with and without linkers. [0529] Zetsche et al. demonstrates that the Cas9 enzyme can be split into two and hence the assembly of Cas9 for activation can be controlled. [0530] Chen et al. relates to multiplex screening by demonstrating that a genome-wide in vivo CRISPR-Cas9 screen in mice reveals genes regulating lung metastasis. [0531] Ran et al. (2015) relates to SaCas9 and its ability to edit genomes and demonstrates that one cannot extrapolate from biochemical assays. [0532] Shalem et al. (2015) described ways in which catalytically inactive Cas9 (dCas9) fusions are used to synthetically repress (CRISPRi) or activate (CRISPRa) expression, showing. advances using Cas9 for genome-scale screens, including arrayed and pooled screens, knockout approaches that inactivate genomic loci and strategies that modulate transcriptional activity. [0533] Xu et al. (2015) assessed the DNA sequence features that contribute to single guide RNA (sgRNA) efficiency in CRISPR-based screens. The authors explored efficiency of CRISPR-Cas9 knockout and nucleotide preference at the cleavage site. The authors also found that the sequence preference for CRISPRi/a is substantially different from that for CRISPR-Cas9 knockout. [0534] Parnas et al. (2015) introduced genome-wide pooled CRISPR-Cas9 libraries into dendritic cells (DCs) to identify genes that control the induction of tumor necrosis factor (Tnf) by bacterial lipopolysaccharide (LPS). Known regulators of Tlr4 signaling and previously unknown candidates were identified and classified into three functional modules with distinct effects on the canonical responses to LPS. [0535] Ramanan et al(2015) demonstrated cleavage of viral episomal DNA (cccDNA) in infected cells. The HBV genome exists in the nuclei of infected hepatocytes as a 3.2kb double-stranded episomal DNA species called covalently closed circular DNA (cccDNA), which is a key component in the HBV life cycle whose replication is not inhibited by current therapies. The authors showed that sgRNAs specifically targeting highly conserved regions of HBV robustly suppresses viral replication and depleted cccDNA. [0536] Nishimasu et al. (2015) reported the crystal structures of SaCas9 in complex with a single guide RNA (sgRNA) and its double-stranded DNA targets, containing the 5′-TTGAAT-3′ PAM and the 5′-TTGGGT-3′ PAM. A structural comparison of SaCas9 with SpCas9 highlighted both structural conservation and divergence, explaining their distinct PAM specificities and orthologous sgRNA recognition. [0537] Canver et al. (2015) demonstrated a CRISPR-Cas9-based functional investigation of non-coding genomic elements. The authors we developed pooled CRISPR-Cas9 guide RNA libraries to perform in situ saturating mutagenesis of the human and mouse BCL11A enhancers which revealed critical features of the enhancers. [0538] Zetsche et al. (2015) reported characterization of Cpf1, a class 2 CRISPR nuclease from Francisella novicida U112 having features distinct from Cas9. Cpf1 is a single RNA-guided endonuclease lacking tracrRNA, utilizes a T-rich protospacer-adjacent motif, and cleaves DNA via a staggered DNA double-stranded break. [0539] Shmakov et al. (2015) reported three distinct Class 2 CRISPR-Cas systems. Two system CRISPR enzymes (C2c1 and C2c3) contain RuvC-like endonuclease domains distantly related to Cpf1. Unlike Cpf1, C2c1 depends on both crRNA and tracrRNA for DNA cleavage. The third enzyme (C2c2) contains two predicted HEPN RNase domains and is tracrRNA independent. [0540] Slaymaker et al (2016) reported the use of structure-guided protein engineering to improve the specificity of Streptococcus pyogenes Cas9 (SpCas9). The authors developed “enhanced specificity” SpCas9 (eSpCas9) variants which maintained robust on-target cleavage with reduced off-target effects. [0541] Cox et al., (2017) reported the use of catalytically inactive Cas13 (dCas13) to direct adenosine-to-inosine deaminase activity by ADAR2 (adenosine deaminase acting on RNA type 2) to transcripts in mammalian cells. The system, referred to as RNA Editing for Programmable A to I Replacement (REPAIR), has no strict sequence constraints and can be used to edit full-length transcripts. The authors further engineered the system to create a high-specificity variant and minimized the system to facilitate viral delivery.
[0542] The methods and tools provided herein are may be designed for use with or Cas13, a type II nuclease that does not make use of tracrRNA. Orthologs of Cas13 have been identified in different bacterial species as described herein. Further type II nucleases with similar properties can be identified using methods described in the art (Shmakov et al. 2015, 60:385-397; Abudayeh et al. 2016, Science, 5; 353(6299)). In particular embodiments, such methods for identifying novel CRISPR effector proteins may comprise the steps of selecting sequences from the database encoding a seed which identifies the presence of a CRISPR Cas locus, identifying loci located within 10 kb of the seed comprising Open Reading Frames (ORFs) in the selected sequences, selecting therefrom loci comprising ORFs of which only a single ORF encodes a novel CRISPR effector having greater than 700 amino acids and no more than 90% homology to a known CRISPR effector. In particular embodiments, the seed is a protein that is common to the CRISPR-Cas system, such as Cas1. In further embodiments, the CRISPR array is used as a seed to identify new effector proteins.
[0543] Also, “Dimeric CRISPR RNA-guided FokI nucleases for highly specific genome editing”, Shengdar Q. Tsai, Nicolas Wyvekens, Cyd Khayter, Jennifer A. Foden, Vishal Thapar, Deepak Reyon, Mathew J. Goodwin, Martin J. Aryee, J. Keith Joung Nature Biotechnology 32(6): 569-77 (2014), relates to dimeric RNA-guided FokI Nucleases that recognize extended sequences and can edit endogenous genes with high efficiencies in human cells.
[0544] Also, Harrington et al. “Programmed DNA destruction by miniature CRISPR-Cas14 enzymes” Science 2018 doi:10/1126/science.aav4293, relates to Cas14.
[0545] With respect to general information on CRISPR/Cas Systems, components thereof, and delivery of such components, including methods, materials, delivery vehicles, vectors, particles, and making and using thereof, including as to amounts and formulations, as well as CRISPR-Cas-expressing eukaryotic cells, CRISPR-Cas expressing eukaryotes, such as a mouse, reference is made to: U.S. Pat. Nos. 8,999,641, 8,993,233, 8,697,359, 8,771,945, 8,795,965, 8,865,406, 8,871,445, 8,889,356, 8,889,418, 8,895,308, 8,906,616, 8,932,814, and 8,945,839; US Patent Publications US 2014-0310830 (U.S. application Ser. No. 14/105,031), US 2014-0287938 A1 (U.S. application Ser. No. 14/213,991), US 2014-0273234 A1 (U.S. application Ser. No. 14/293,674), US2014-0273232 A1 (U.S. application Ser. No. 14/290,575), US 2014-0273231 (U.S. application Ser. No. 14/259,420), US 2014-0256046 A1 (U.S. application Ser. No. 14/226,274), US 2014-0248702 A1 (U.S. application Ser. No. 14/258,458), US 2014-0242700 A1 (U.S. application Ser. No. 14/222,930), US 2014-0242699 A1 (U.S. application Ser. No. 14/183,512), US 2014-0242664 A1 (U.S. application Ser. No. 14/104,990), US 2014-0234972 A1 (U.S. application Ser. No. 14/183,471), US 2014-0227787 A1 (U.S. application Ser. No. 14/256,912), US 2014-0189896 A1 (U.S. application Ser. No. 14/105,035), US 2014-0186958 (U.S. application Ser. No. 14/105,017), US 2014-0186919 A1 (U.S. application Ser. No. 14/104,977), US 2014-0186843 A1 (U.S. application Ser. No. 14/104,900), US 2014-0179770 A1 (U.S. application Ser. No. 14/104,837) and US 2014-0179006 A1 (U.S. application Ser. No. 14/183,486), US 2014-0170753 (U.S. application Ser. No. 14/183,429); US 2015-0184139 (U.S. application Ser. No. 14/324,960); 14/054,414 European Patent Applications EP 2 771 468 (EP13818570.7), EP 2 764 103 (EP13824232.6), and EP 2 784 162 (EP14170383.5); and PCT Patent Publications WO2014/093661 (PCT/US2013/074743), WO2014/093694 (PCT/US2013/074790), WO2014/093595 (PCT/US2013/074611), WO2014/093718 (PCT/US2013/074825), WO2014/093709 (PCT/US2013/074812), WO2014/093622 (PCT/US2013/074667), WO2014/093635 (PCT/US2013/074691), WO2014/093655 (PCT/US2013/074736), WO2014/093712 (PCT/US2013/074819), WO2014/093701 (PCT/US2013/074800), WO2014/018423 (PCT/US2013/051418), WO2014/204723 (PCT/US2014/041790), WO2014/204724 (PCT/US2014/041800), WO2014/204725 (PCT/US2014/041803), WO2014/204726 (PCT/US2014/041804), WO2014/204727 (PCT/US2014/041806), WO2014/204728 (PCT/US2014/041808), WO2014/204729 (PCT/US2014/041809), WO2015/089351 (PCT/US2014/069897), WO2015/089354 (PCT/US2014/069902), WO2015/089364 (PCT/US2014/069925), WO2015/089427 (PCT/US2014/070068), WO2015/089462 (PCT/US2014/070127), WO2015/089419 (PCT/US2014/070057), WO2015/089465 (PCT/US2014/070135), WO2015/089486 (PCT/US2014/070175), WO2015/058052 (PCT/US2014/061077), WO2015/070083 (PCT/US2014/064663), WO2015/089354 (PCT/US2014/069902), WO2015/089351 (PCT/US2014/069897), WO2015/089364 (PCT/US2014/069925), WO2015/089427 (PCT/US2014/070068), WO2015/089473 (PCT/US2014/070152), WO2015/089486 (PCT/US2014/070175), WO2016/049258 (PCT/US2015/051830), WO2016/094867 (PCT/US2015/065385), WO2016/094872 (PCT/US2015/065393), WO2016/094874 (PCT/US2015/065396), WO2016/106244 (PCT/US2015/067177).
[0546] Mention is also made of U.S. application 62/180,709, 17 Jun. 15, PROTECTED GUIDE RNAS (PGRNAS); U.S. application 62/091,455, filed, 12 Dec. 14, PROTECTED GUIDE RNAS (PGRNAS); U.S. application 62/096,708, 24 Dec. 14, PROTECTED GUIDE RNAS (PGRNAS); U.S. applications 62/091,462, 12 Dec. 14, 62/096,324, 23 Dec. 14, 62/180,681, 17 Jun. 2015, and 62/237,496, 5 Oct. 2015, DEAD GUIDES FOR CRISPR TRANSCRIPTION FACTORS; U.S. application 62/091,456, 12 Dec. 14 and 62/180,692, 17 Jun. 2015, ESCORTED AND FUNCTIONALIZED GUIDES FOR CRISPR-CAS SYSTEMS; U.S. application 62/091,461, 12 Dec. 14, DELIVERY, USE AND THERAPEUTIC APPLICATIONS OF THE CRISPR-CAS SYSTEMS AND COMPOSITIONS FOR GENOME EDITING AS TO HEMATOPOETIC STEM CELLS (HSCs); U.S. application 62/094,903, 19 Dec. 14, UNBIASED IDENTIFICATION OF DOUBLE-STRAND BREAKS AND GENOMIC REARRANGEMENT BY GENOME-WISE INSERT CAPTURE SEQUENCING; U.S. application 62/096,761, 24 Dec. 14, ENGINEERING OF SYSTEMS, METHODS AND OPTIMIZED ENZYME AND GUIDE SCAFFOLDS FOR SEQUENCE MANIPULATION; U.S. application 62/098,059, 30 Dec. 14, 62/181,641, 18 Jun. 2015, and 62/181,667, 18 Jun. 2015, RNA-TARGETING SYSTEM; U.S. application 62/096,656, 24 Dec. 14 and 62/181,151, 17 Jun. 2015, CRISPR HAVING OR ASSOCIATED WITH DESTABILIZATION DOMAINS; U.S. application 62/096,697, 24 Dec. 14, CRISPR HAVING OR ASSOCIATED WITH AAV; U.S. application 62/098,158, 30 Dec. 14, ENGINEERED CRISPR COMPLEX INSERTIONAL TARGETING SYSTEMS; U.S. application 62/151,052, 22 Apr. 15, CELLULAR TARGETING FOR EXTRACELLULAR EXOSOMAL REPORTING; U.S. application 62/054,490, 24 Sep. 14, DELIVERY, USE AND THERAPEUTIC APPLICATIONS OF THE CRISPR-CAS SYSTEMS AND COMPOSITIONS FOR TARGETING DISORDERS AND DISEASES USING PARTICLE DELIVERY COMPONENTS; U.S. application 61/939,154, 12-F EB-14, SYSTEMS, METHODS AND COMPOSITIONS FOR SEQUENCE MANIPULATION WITH OPTIMIZED FUNCTIONAL CRISPR-CAS SYSTEMS; U.S. application 62/055,484, 25 Sep. 14, SYSTEMS, METHODS AND COMPOSITIONS FOR SEQUENCE MANIPULATION WITH OPTIMIZED FUNCTIONAL CRISPR-CAS SYSTEMS; U.S. application 62/087,537, 4 Dec. 14, SYSTEMS, METHODS AND COMPOSITIONS FOR SEQUENCE MANIPULATION WITH OPTIMIZED FUNCTIONAL CRISPR-CAS SYSTEMS; U.S. application 62/054,651, 24 Sep. 14, DELIVERY, USE AND THERAPEUTIC APPLICATIONS OF THE CRISPR-CAS SYSTEMS AND COMPOSITIONS FOR MODELING COMPETITION OF MULTIPLE CANCER MUTATIONS IN VIVO; U.S. application 62/067,886, 23 Oct. 14, DELIVERY, USE AND THERAPEUTIC APPLICATIONS OF THE CRISPR-CAS SYSTEMS AND COMPOSITIONS FOR MODELING COMPETITION OF MULTIPLE CANCER MUTATIONS IN VIVO; U.S. applications 62/054,675, 24 Sep. 14 and 62/181,002, 17 Jun. 2015, DELIVERY, USE AND THERAPEUTIC APPLICATIONS OF THE CRISPR-CAS SYSTEMS AND COMPOSITIONS IN NEURONAL CELLS/TISSUES; U.S. application 62/054,528, 24 Sep. 14, DELIVERY, USE AND THERAPEUTIC APPLICATIONS OF THE CRISPR-CAS SYSTEMS AND COMPOSITIONS IN IMMUNE DISEASES OR DISORDERS; U.S. application 62/055,454, 25 Sep. 14, DELIVERY, USE AND THERAPEUTIC APPLICATIONS OF THE CRISPR-CAS SYSTEMS AND COMPOSITIONS FOR TARGETING DISORDERS AND DISEASES USING CELL PENETRATION PEPTIDES (CPP); U.S. application 62/055,460, 25 Sep. 14, MULTIFUNCTIONAL-CRISPR COMPLEXES AND/OR OPTIMIZED ENZYME LINKED FUNCTIONAL-CRISPR COMPLEXES; U.S. application 62/087,475, 4 Dec. 14 and 62/181,690, 18 Jun. 2015, FUNCTIONAL SCREENING WITH OPTIMIZED FUNCTIONAL CRISPR-CAS SYSTEMS; U.S. application 62/055,487, 25-Sep-14, FUNCTIONAL SCREENING WITH OPTIMIZED FUNCTIONAL CRISPR-CAS SYSTEMS; U.S. application 62/087,546, 4 Dec. 14 and 62/181,687, 18 Jun. 2015, MULTIFUNCTIONAL CRISPR COMPLEXES AND/OR OPTIMIZED ENZYME LINKED FUNCTIONAL-CRISPR COMPLEXES; and U.S. application 62/098,285, 30 Dec. 14, CRISPR MEDIATED IN VIVO MODELING AND GENETIC SCREENING OF TUMOR GROWTH AND METASTASIS.
[0547] Mention is made of U.S. applications 62/181,659, 18 Jun. 2015 and 62/207,318, 19 Aug. 2015, ENGINEERING AND OPTIMIZATION OF SYSTEMS, METHODS, ENZYME AND GUIDE SCAFFOLDS OF CAS9 ORTHOLOGS AND VARIANTS FOR SEQUENCE MANIPULATION. Mention is made of U.S. applications 62/181,663, 18 Jun. 2015 and 62/245,264, 22 Oct. 2015, NOVEL CRISPR ENZYMES AND SYSTEMS, U.S. applications 62/181,675, 18 Jun. 2015, 62/285,349, 22 Oct. 2015, 62/296,522, 17 Feb. 2016, and 62/320,231, 8 Apr. 2016, NOVEL CRISPR ENZYMES AND SYSTEMS, U.S. application 62/232,067, 24 Sep. 2015, U.S. application Ser. No. 14/975,085, 18 Dec. 2015, European application No. 16150428.7, U.S. application 62/205,733, 16 Aug. 2015, U.S. application 62/201,542, 5 Aug. 2015, U.S. application 62/193,507, 16 Jul. 2015, and U.S. application 62/181,739, 18 Jun. 2015, each entitled NOVEL CRISPR ENZYMES AND SYSTEMS and of U.S. application 62/245,270, 22 Oct. 2015, NOVEL CRISPR ENZYMES AND SYSTEMS. Mention is also made of U.S. application 61/939,256, 12Feb. 2014, and WO 2015/089473 (PCT/US2014/070152), 12 Dec. 2014, each entitled ENGINEERING OF SYSTEMS, METHODS AND OPTIMIZED GUIDE COMPOSITIONS WITH NEW ARCHITECTURES FOR SEQUENCE MANIPULATION. Mention is also made of PCT/US2015/045504, 15 Aug. 2015, U.S. application 62/180,699, 17 Jun. 2015, and U.S. application 62/038,358, 17 Aug. 2014, each entitled GENOME EDITING USING CAS9 NICKASES.
[0548] Each of these patents, patent publications, and applications, and all documents cited therein or during their prosecution (“appln cited documents”) and all documents cited or referenced in the appln cited documents, together with any instructions, descriptions, product specifications, and product sheets for any products mentioned therein or in any document therein and incorporated by reference herein, are hereby incorporated herein by reference, and may be employed in the practice of the invention. All documents (e.g., these patents, patent publications and applications and the appln cited documents) are incorporated herein by reference to the same extent as if each individual document was specifically and individually indicated to be incorporated by reference.
[0549] In particular embodiments, pre-complexed guide RNA and CRISPR effector protein, (optionally, adenosine deaminase fused to a CRISPR protein or an adaptor) are delivered as a ribonucleoprotein (RNP). RNPs have the advantage that they lead to rapid editing effects even more so than the RNA method because this process avoids the need for transcription. An important advantage is that both RNP delivery is transient, reducing off-target effects and toxicity issues. Efficient genome editing in different cell types has been observed by Kim et al. (2014, Genome Res. 24(6):1012-9), Paix et al. (2015, Genetics 204(1):47-54), Chu et al. (2016, BMC Biotechnol. 16:4), and Wang et al. (2013, Cell. 9; 153(4):910-8).
[0550] In particular embodiments, the ribonucleoprotein is delivered by way of a polypeptide-based shuttle agent as described in WO2016161516. WO2016161516 describes efficient transduction of polypeptide cargos using synthetic peptides comprising an endosome leakage domain (ELD) operably linked to a cell penetrating domain (CPD), to a histidine-rich domain and a CPD. Similarly these polypeptides can be used for the delivery of CRISPR-effector based RNPs in eukaryotic cells.
Tale Systems
[0551] As disclosed herein editing can be made by way of the transcription activator-like effector nucleases (TALENs) system. Transcription activator-like effectors (TALEs) can be engineered to bind practically any desired DNA sequence. Exemplary methods of genome editing using the TALEN system can be found for example in Cermak T. Doyle E L. Christian M. Wang L. Zhang Y. Schmidt C, et al. Efficient design and assembly of custom TALEN and other TAL effector-based constructs for DNA targeting. Nucleic Acids Res. 2011; 39:e82; Zhang F. Cong L. Lodato S. Kosuri S. Church G M. Arlotta P Efficient construction of sequence-specific TAL effectors for modulating mammalian transcription. Nat Biotechnol. 2011; 29:149-153 and U.S. Pat. Nos. 8,450,471, 8,440,431 and 8,440,432, all of which are specifically incorporated by reference.
[0552] In advantageous embodiments of the invention, the methods provided herein use isolated, non-naturally occurring, recombinant or engineered DNA binding proteins that comprise TALE monomers as a part of their organizational structure that enable the targeting of nucleic acid sequences with improved efficiency and expanded specificity.
[0553] Naturally occurring TALEs or “wild type TALEs” are nucleic acid binding proteins secreted by numerous species of proteobacteria. TALE polypeptides contain a nucleic acid binding domain composed of tandem repeats of highly conserved monomer polypeptides that are predominantly 33, 34 or 35 amino acids in length and that differ from each other mainly in amino acid positions 12 and 13. In advantageous embodiments the nucleic acid is DNA. As used herein, the term “polypeptide monomers”, or “TALE monomers” will be used to refer to the highly conserved repetitive polypeptide sequences within the TALE nucleic acid binding domain and the term “repeat variable di-residues” or “RVD” will be used to refer to the highly variable amino acids at positions 12 and 13 of the polypeptide monomers. As provided throughout the disclosure, the amino acid residues of the RVD are depicted using the IUPAC single letter code for amino acids. A general representation of a TALE monomer which is comprised within the DNA binding domain is X1-11-(X12X13)-X14-33 or 34 or 35, where the subscript indicates the amino acid position and X represents any amino acid. X12X13 indicate the RVDs. In some polypeptide monomers, the variable amino acid at position 13 is missing or absent and in such polypeptide monomers, the RVD consists of a single amino acid. In such cases the RVD may be alternatively represented as X*, where X represents X12 and (*) indicates that X13 is absent. The DNA binding domain comprises several repeats of TALE monomers and this may be represented as (X1-11-(X12X13)-X14-33 or 34 or 35)z, where in an advantageous embodiment, z is at least 5 to 40. In a further advantageous embodiment, z is at least 10 to 26.
[0554] The TALE monomers have a nucleotide binding affinity that is determined by the identity of the amino acids in its RVD. For example, polypeptide monomers with an RVD of NI preferentially bind to adenine (A), polypeptide monomers with an RVD of NG preferentially bind to thymine (T), polypeptide monomers with an RVD of HD preferentially bind to cytosine (C) and polypeptide monomers with an RVD of NN preferentially bind to both adenine (A) and guanine (G). In yet another embodiment of the invention, polypeptide monomers with an RVD of IG preferentially bind to T. Thus, the number and order of the polypeptide monomer repeats in the nucleic acid binding domain of a TALE determines its nucleic acid target specificity. In still further embodiments of the invention, polypeptide monomers with an RVD of NS recognize all four base pairs and may bind to A, T, G or C. The structure and function of TALEs is further described in, for example, Moscou et al., Science 326:1501 (2009); Boch et al., Science 326:1509-1512 (2009); and Zhang et al., Nature Biotechnology 29:149-153 (2011), each of which is incorporated by reference in its entirety.
[0555] The TALE polypeptides used in methods of the invention are isolated, non-naturally occurring, recombinant or engineered nucleic acid-binding proteins that have nucleic acid or DNA binding regions containing polypeptide monomer repeats that are designed to target specific nucleic acid sequences.
[0556] As described herein, polypeptide monomers having an RVD of HN or NH preferentially bind to guanine and thereby allow the generation of TALE polypeptides with high binding specificity for guanine containing target nucleic acid sequences. In a preferred embodiment of the invention, polypeptide monomers having RVDs RN, NN, NK, SN, NH, KN, HN, NQ, HH, RG, KH, RH and SS preferentially bind to guanine. In a much more advantageous embodiment of the invention, polypeptide monomers having RVDs RN, NK, NQ, HH, KH, RH, SS and SN preferentially bind to guanine and thereby allow the generation of TALE polypeptides with high binding specificity for guanine containing target nucleic acid sequences. In an even more advantageous embodiment of the invention, polypeptide monomers having RVDs HH, KH, NH, NK, NQ, RH, RN and SS preferentially bind to guanine and thereby allow the generation of TALE polypeptides with high binding specificity for guanine containing target nucleic acid sequences. In a further advantageous embodiment, the RVDs that have high binding specificity for guanine are RN, NH RH and KH. Furthermore, polypeptide monomers having an RVD of NV preferentially bind to adenine and guanine. In more preferred embodiments of the invention, polypeptide monomers having RVDs of H*, HA, KA, N*, NA, NC, NS, RA, and S* bind to adenine, guanine, cytosine and thymine with comparable affinity.
[0557] The predetermined N-terminal to C-terminal order of the one or more polypeptide monomers of the nucleic acid or DNA binding domain determines the corresponding predetermined target nucleic acid sequence to which the TALE polypeptides will bind. As used herein the polypeptide monomers and at least one or more half polypeptide monomers are “specifically ordered to target” the genomic locus or gene of interest. In plant genomes, the natural TALE-binding sites always begin with a thymine (T), which may be specified by a cryptic signal within the non-repetitive N-terminus of the TALE polypeptide; in some cases this region may be referred to as repeat 0. In animal genomes, TALE binding sites do not necessarily have to begin with a thymine (T) and TALE polypeptides may target DNA sequences that begin with T, A, G or C. The tandem repeat of TALE monomers always ends with a half-length repeat or a stretch of sequence that may share identity with only the first 20 amino acids of a repetitive full length TALE monomer and this half repeat may be referred to as a half-monomer (
[0558] As described in Zhang et al., Nature Biotechnology 29:149-153 (2011), TALE polypeptide binding efficiency may be increased by including amino acid sequences from the “capping regions” that are directly N-terminal or C-terminal of the DNA binding region of naturally occurring TALEs into the engineered TALEs at positions N-terminal or C-terminal of the engineered TALE DNA binding region. Thus, in certain embodiments, the TALE polypeptides described herein further comprise an N-terminal capping region and/or a C-terminal capping region.
[0559] An exemplary amino acid sequence of a N-terminal capping region is:
TABLE-US-00001 (SEQ ID NO: 3) M D P I R S R T P S P A R E L L S G P Q P D G V Q P T A D R G V S P P A G G P L D G L P A R R T M S R T R L P S P P A P S P A F S A D S F S D L L R Q F D P S L F N T S L F D S L P P F G A H H T E A A T G E W D E V Q S G L R A A D A P P P T M R V A V T A A R P P R A K P A P R R R A A Q P S D A S P A A Q V D L R T L G Y S Q Q Q Q E K I K P K V R S T V A Q H H E A L V G H G F T H A H I V A L S Q H P A A L G T V A V K Y Q D M I A A L P E A T H E A I V G V G K Q W S G A R A L E A L L T V A G E L R G P P L Q L D T G Q L L K I A K R G G V T A V E A V H A W R N A L T G A P L N
[0560] An exemplary amino acid sequence of a C-terminal capping region is:
TABLE-US-00002 (SEQ ID NO: 4) R P A L E S I V A Q L S R P D P A L A A L T N D H L V A L A C L G G R P A L D A V K K G L P H A P A L I K R T N R R I P E R T S H R V A D H A Q V V R V L G F F Q C H S H P A Q A F D D A M T Q F G M S R H G L L Q L F R R V G V T E L E A R S G T L P P A S Q R W D R I L Q A S G M K R A K P S P T S T Q T P D Q A S L H A F A D S L E R D L D A P S P M H E G D Q T R A S
[0561] As used herein the predetermined “N-terminus” to “C terminus” orientation of the N-terminal capping region, the DNA binding domain comprising the repeat TALE monomers and the C-terminal capping region provide structural basis for the organization of different domains in the d-TALEs or polypeptides of the invention.
[0562] The entire N-terminal and/or C-terminal capping regions are not necessary to enhance the binding activity of the DNA binding region. Therefore, in certain embodiments, fragments of the N-terminal and/or C-terminal capping regions are included in the TALE polypeptides described herein.
[0563] In certain embodiments, the TALE polypeptides described herein contain a N-terminal capping region fragment that included at least 10, 20, 30, 40, 50, 54, 60, 70, 80, 87, 90, 94, 100, 102, 110, 117, 120, 130, 140, 147, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260 or 270 amino acids of an N-terminal capping region. In certain embodiments, the N-terminal capping region fragment amino acids are of the C-terminus (the DNA-binding region proximal end) of an N-terminal capping region. As described in Zhang et al., Nature Biotechnology 29:149-153 (2011), N-terminal capping region fragments that include the C-terminal 240 amino acids enhance binding activity equal to the full length capping region, while fragments that include the C-terminal 147 amino acids retain greater than 80% of the efficacy of the full length capping region, and fragments that include the C-terminal 117 amino acids retain greater than 50% of the activity of the full-length capping region.
[0564] In some embodiments, the TALE polypeptides described herein contain a C-terminal capping region fragment that included at least 6, 10, 20, 30, 37, 40, 50, 60, 68, 70, 80, 90, 100, 110, 120, 127, 130, 140, 150, 155, 160, 170, 180 amino acids of a C-terminal capping region. In certain embodiments, the C-terminal capping region fragment amino acids are of the N-terminus (the DNA-binding region proximal end) of a C-terminal capping region. As described in Zhang et al., Nature Biotechnology 29:149-153 (2011), C-terminal capping region fragments that include the C-terminal 68 amino acids enhance binding activity equal to the full length capping region, while fragments that include the C-terminal 20 amino acids retain greater than 50% of the efficacy of the full length capping region.
[0565] In certain embodiments, the capping regions of the TALE polypeptides described herein do not need to have identical sequences to the capping region sequences provided herein. Thus, in some embodiments, the capping region of the TALE polypeptides described herein have sequences that are at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical or share identity to the capping region amino acid sequences provided herein. Sequence identity is related to sequence homology. Homology comparisons may be conducted by eye, or more usually, with the aid of readily available sequence comparison programs. These commercially available computer programs may calculate percent (%) homology between two or more sequences and may also calculate the sequence identity shared by two or more amino acid or nucleic acid sequences. In some preferred embodiments, the capping region of the TALE polypeptides described herein have sequences that are at least 95% identical or share identity to the capping region amino acid sequences provided herein.
[0566] Sequence homologies may be generated by any of a number of computer programs known in the art, which include but are not limited to BLAST or FASTA. Suitable computer program for carrying out alignments like the GCG Wisconsin Bestfit package may also be used. Once the software has produced an optimal alignment, it is possible to calculate % homology, preferably % sequence identity. The software typically does this as part of the sequence comparison and generates a numerical result.
[0567] In advantageous embodiments described herein, the TALE polypeptides of the invention include a nucleic acid binding domain linked to the one or more effector domains. The terms “effector domain” or “regulatory and functional domain” refer to a polypeptide sequence that has an activity other than binding to the nucleic acid sequence recognized by the nucleic acid binding domain. By combining a nucleic acid binding domain with one or more effector domains, the polypeptides of the invention may be used to target the one or more functions or activities mediated by the effector domain to a particular target DNA sequence to which the nucleic acid binding domain specifically binds.
[0568] In some embodiments of the TALE polypeptides described herein, the activity mediated by the effector domain is a biological activity. For example, in some embodiments the effector domain is a transcriptional inhibitor (i.e., a repressor domain), such as an mSin interaction domain (SID). SID4X domain or a Krüppel-associated box (KRAB) or fragments of the KRAB domain. In some embodiments the effector domain is an enhancer of transcription (i.e. an activation domain), such as the VP16, VP64 or p65 activation domain. In some embodiments, the nucleic acid binding is linked, for example, with an effector domain that includes but is not limited to a transposase, integrase, recombinase, resolvase, invertase, protease, DNA methyltransferase, DNA demethylase, histone acetylase, histone deacetylase, nuclease, transcriptional repressor, transcriptional activator, transcription factor recruiting, protein nuclear-localization signal or cellular uptake signal.
[0569] In some embodiments, the effector domain is a protein domain which exhibits activities which include but are not limited to transposase activity, integrase activity, recombinase activity, resolvase activity, invertase activity, protease activity, DNA methyltransferase activity, DNA demethylase activity, histone acetylase activity, histone deacetylase activity, nuclease activity, nuclear-localization signaling activity, transcriptional repressor activity, transcriptional activator activity, transcription factor recruiting activity, or cellular uptake signaling activity. Other preferred embodiments of the invention may include any combination the activities described herein.
ZN-Finger Nucleases
[0570] Other preferred tools for genome editing for use in the context of this invention include zinc finger systems. One type of programmable DNA-binding domain is provided by artificial zinc-finger (ZF) technology, which involves arrays of ZF modules to target new DNA-binding sites in the genome. Each finger module in a ZF array targets three DNA bases. A customized array of individual zinc finger domains is assembled into a ZF protein (ZFP).
[0571] ZFPs can comprise a functional domain. The first synthetic zinc finger nucleases (ZFNs) were developed by fusing a ZF protein to the catalytic domain of the Type IIS restriction enzyme FokI. (Kim, Y. G. et al., 1994, Chimeric restriction endonuclease, Proc. Natl. Acad. Sci. U.S.A. 91, 883-887; Kim, Y. G. et al., 1996, Hybrid restriction enzymes: zinc finger fusions to Fok I cleavage domain. Proc. Natl. Acad. Sci. U.S.A. 93, 1156-1160). Increased cleavage specificity can be attained with decreased off target activity by use of paired ZFN heterodimers, each targeting different nucleotide sequences separated by a short spacer. (Doyon, Y. et al., 2011, Enhancing zinc-finger-nuclease activity with improved obligate heterodimeric architectures. Nat. Methods 8, 74-79). ZFPs can also be designed as transcription activators and repressors and have been used to target many genes in a wide variety of organisms. Exemplary methods of genome editing using ZFNs can be found for example in U.S. Pat. Nos. 6,534,261, 6,607,882, 6,746,838, 6,794,136, 6,824,978, 6,866,997, 6,933,113, 6,979,539, 7,013,219, 7,030,215, 7,220,719, 7,241,573, 7,241,574, 7,585,849, 7,595,376, 6,903,185, and 6,479,626, all of which are specifically incorporated by reference.
Meganucleases
[0572] As disclosed herein editing can be made by way of meganucleases, which are endodeoxyribonucleases characterized by a large recognition site (double-stranded DNA sequences of 12 to 40 base pairs). Exemplary method for using meganucleases can be found in U.S. Pat. Nos. 8,163,514; 8,133,697; 8,021,867; 8,119,361; 8,119,381; 8,124,369; and 8,129,134, which are specifically incorporated by reference.
RNAi
[0573] In certain embodiments, the genetic modifying agent is RNAi (e.g., shRNA). As used herein, “gene silencing” or “gene silenced” in reference to an activity of an RNAi molecule, for example a siRNA or miRNA refers to a decrease in the mRNA level in a cell for a target gene by at least about 5%, about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 95%, about 99%, about 100% of the mRNA level found in the cell without the presence of the miRNA or RNA interference molecule. In one preferred embodiment, the mRNA levels are decreased by at least about 70%, about 80%, about 90%, about 95%, about 99%, about 100%.
[0574] As used herein, the term “RNAi” refers to any type of interfering RNA, including but not limited to, siRNAi, shRNAi, endogenous microRNA and artificial microRNA. For instance, it includes sequences previously identified as siRNA, regardless of the mechanism of down-stream processing of the RNA (i.e. although siRNAs are believed to have a specific method of in vivo processing resulting in the cleavage of mRNA, such sequences can be incorporated into the vectors in the context of the flanking sequences described herein). The term “RNAi” can include both gene silencing RNAi molecules, and also RNAi effector molecules which activate the expression of a gene.
[0575] As used herein, a “siRNA” refers to a nucleic acid that forms a double stranded RNA, which double stranded RNA has the ability to reduce or inhibit expression of a gene or target gene when the siRNA is present or expressed in the same cell as the target gene. The double stranded RNA siRNA can be formed by the complementary strands. In one embodiment, a siRNA refers to a nucleic acid that can form a double stranded siRNA. The sequence of the siRNA can correspond to the full-length target gene, or a subsequence thereof. Typically, the siRNA is at least about 15-50 nucleotides in length (e.g., each complementary sequence of the double stranded siRNA is about 15-50 nucleotides in length, and the double stranded siRNA is about 15-50 base pairs in length, preferably about 19-30 base nucleotides, preferably about 20-25 nucleotides in length, e.g., 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 nucleotides in length).
[0576] As used herein “shRNA” or “small hairpin RNA” (also called stem loop) is a type of siRNA. In one embodiment, these shRNAs are composed of a short, e.g. about 19 to about 25 nucleotide, antisense strand, followed by a nucleotide loop of about 5 to about 9 nucleotides, and the analogous sense strand. Alternatively, the sense strand can precede the nucleotide loop structure and the antisense strand can follow.
[0577] The terms “microRNA” or “miRNA” are used interchangeably herein are endogenous RNAs, some of which are known to regulate the expression of protein-coding genes at the posttranscriptional level. Endogenous microRNAs are small RNAs naturally present in the genome that are capable of modulating the productive utilization of mRNA. The term artificial microRNA includes any type of RNA sequence, other than endogenous microRNA, which is capable of modulating the productive utilization of mRNA. MicroRNA sequences have been described in publications such as Lim, et al., Genes & Development, 17, p. 991-1008 (2003), Lim et al Science 299, 1540 (2003), Lee and Ambros Science, 294, 862 (2001), Lau et al., Science 294, 858-861 (2001), Lagos-Quintana et al, Current Biology, 12, 735-739 (2002), Lagos Quintana et al, Science 294, 853-857 (2001), and Lagos-Quintana et al, RNA, 9, 175-179 (2003), which are incorporated by reference. Multiple microRNAs can also be incorporated into a precursor molecule. Furthermore, miRNA-like stem-loops can be expressed in cells as a vehicle to deliver artificial miRNAs and short interfering RNAs (siRNAs) for the purpose of modulating the expression of endogenous genes through the miRNA and or RNAi pathways.
[0578] As used herein, “double stranded RNA” or “dsRNA” refers to RNA molecules that are comprised of two strands. Double-stranded molecules include those comprised of a single RNA molecule that doubles back on itself to form a two-stranded structure. For example, the stem loop structure of the progenitor molecules from which the single-stranded miRNA is derived, called the pre-miRNA (Bartel et al. 2004. Cell 1 16:281-297), comprises a dsRNA molecule.
Transcriptional Activation/Repression
[0579] In certain embodiments, an immunomodulant may comprise (i) a DNA-binding portion configured to specifically bind to the endogenous gene and (ii) an effector domain mediating a biological activity.
[0580] In certain embodiments, the DNA-binding portion may comprise a zinc finger protein or DNA-binding domain thereof, a transcription activator-like effector (TALE) protein or DNA-binding domain thereof, or an RNA-guided protein or DNA-binding domain thereof.
[0581] In certain embodiments, the DNA-binding portion may comprise (i) Cas9 or Cpf1 or any Cas protein described herein modified to eliminate its nuclease activity, or (ii) DNA-binding domain of Cas9 or Cpf1 or any Cas protein described herein.
[0582] In some embodiments, the effector domain may be a transcriptional inhibitor (i.e., a repressor domain), such as an mSin interaction domain (SID). SID4X domain or a Kruppel-associated box (KRAB) or fragments of the KRAB domain. In some embodiments, the effector domain may be an enhancer of transcription (i.e. an activation domain), such as the VP16, VP64 or p65 activation domain. In some embodiments, the nucleic acid binding portion may be linked, for example, with an effector domain that includes but is not limited to a transposase, integrase, recombinase, resolvase, invertase, protease, DNA methyltransferase, DNA demethylase, histone acetylase, histone deacetylase, nuclease, transcriptional repressor, transcriptional activator, transcription factor recruiting, protein nuclear-localization signal or cellular uptake signal. In some embodiments, the effector domain may be a protein domain which exhibits activities which include but are not limited to transposase activity, integrase activity, recombinase activity, resolvase activity, invertase activity, protease activity, DNA methyltransferase activity, DNA demethylase activity, histone acetylase activity, histone deacetylase activity, nuclease activity, nuclear-localization signaling activity, transcriptional repressor activity, transcriptional activator activity, transcription factor recruiting activity, or cellular uptake signaling activity. Other preferred embodiments of the invention may include any combination the activities described herein.
Antibody Drug Conjugate
[0583] In certain embodiments, the agent capable of specifically binding to a gene product expressed on the cell surface of the immune cell is an antibody.
[0584] By means of an example, an agent, such as an antibody, capable of specifically binding to a gene product expressed on the cell surface of the immune cells may be conjugated with a therapeutic or effector agent for targeted delivery of the therapeutic or effector agent to the immune cells.
[0585] Examples of such therapeutic or effector agents include immunomodulatory classes as discussed herein, such as without limitation a toxin, drug, radionuclide, cytokine, lymphokine, chemokine, growth factor, tumor necrosis factor, hormone, hormone antagonist, enzyme, oligonucleotide, siRNA, RNAi, photoactive therapeutic agent, anti-angiogenic agent and pro-apoptotic agent.
[0586] Example toxins include ricin, abrin, alpha toxin, saporin, ribonuclease (RNase), DNase I, Staphylococcal enterotoxin-A, pokeweed antiviral protein, gelonin, diphtheria toxin, Pseudomonas exotoxin, or Pseudomonas endotoxin.
[0587] Example radionuclides include .sup.103mRh, .sup.103Ru, .sup.105Rh, .sup.105Ru, .sup.107Hg, .sup.109Pd, .sup.109Pt, .sup.111Ag, .sup.111In, .sup.113mIn .sup.119Sb, .sup.11C, .sup.121mTe, .sup.122mTe .sup.125I, .sup.125mTe .sup.126I, .sup.131I, .sup.133I, .sup.13N, .sup.142Pr, .sup.143Pr, .sup.149Pm, .sup.152Dy, .sup.153Sm, .sup.15O, .sup.161Ho, .sup.161Tb, .sup.165Tm, .sup.166Dy, .sup.166Ho, .sup.167Tm, .sup.168Tm, .sup.169Er, .sup.169Yb, .sup.177Lu, .sup.186Re, .sup.188Re, .sup.189mOS, .sup.189Re, .sup.192Ir, .sup.194Ir, .sup.197Pt, .sup.198Au, .sup.199Au, .sup.201T1, .sup.203Hg, .sup.211At, .sup.211Bi, .sup.211Pb, .sup.212Bi, .sup.212Pb, .sup.213Bi, .sup.215Po, .sup.217At, .sup.219Rn, .sup.221Fr, .sup.223Ra, .sup.224Ac .sup.225Ac, .sup.225Fm, .sup.32P, .sup.33P, .sup.47Sc, .sup.51Cr, .sup.57Co, .sup.58Co, .sup.59Fe, .sup.62Cu, .sup.67Cu, .sup.67Ga, .sup.75Br, .sup.75Se, .sup.76Br, .sup.77As, .sup.77Br, .sup.80mBr, .sup.89Sr, .sup.90Y, .sup.95Ru, .sup.97Ru, .sup.99Mo or .sup.99mTc. Preferably, the radionuclide may be an alpha-particle-emitting radionuclide.
[0588] Example enzymes include malate dehydrogenase, staphylococcal nuclease, delta-V-steroid isomerase, yeast alcohol dehydrogenase, alpha-glycerophosphate dehydrogenase, triose phosphate isomerase, horseradish peroxidase, alkaline phosphatase, asparaginase, glucose oxidase, beta-galactosidase, ribonuclease, urease, catalase, glucose-6-phosphate dehydrogenase, glucoamylase or acetylcholinesterase. Such enzymes may be used, for example, in combination with prodrugs that are administered in relatively non-toxic form and converted at the target site by the enzyme into a cytotoxic agent. In other alternatives, a drug may be converted into less toxic form by endogenous enzymes in the subject but may be reconverted into a cytotoxic form by the therapeutic enzyme.
[0589] By means of an example, an agent, such as a bi-specific antibody, capable of specifically binding to a gene product expressed on the cell surface of suppressive or activated immune cells and another cell may be used for targeting suppressive or activated immune cells away from or towards TILs and/or a tumor.
Targeting T Cell Subtypes
[0590] In another aspect, detecting or quantifying CD8.sup.+ T cells may be used to select a treatment for a subject in need thereof. In certain embodiments, subjects comprising suppressive T cells as described herein are treated with an immunotherapy (e.g., checkpoint blockade therapy). In certain embodiments, the suppressive T cells express coinhibitory receptors (e.g., checkpoint proteins) that can be specifically targeted. The checkpoint blockade therapy may be an inhibitor of any check point protein described herein. The checkpoint blockade therapy may comprise anti-TIM3, anti-CTLA4, anti-PD-L1, anti-PD1, anti-TIGIT, anti-LAG3, or combinations thereof. Specific check point inhibitors include, but are not limited to anti-CTLA4 antibodies (e.g., Ipilimumab), anti-PD-1 antibodies (e.g., Nivolumab, Pembrolizumab), and anti-PD-L1 antibodies (e.g., Atezolizumab).
[0591] The treatment may involve transferring CAR T cells to a patient. The CAR T cells may be modified such that they are resistant to suppression by the CD8.sup.+ T cells of the present invention.
[0592] Bhlhe40 is also known as BHLHB2, Clast5, DEC1, HLHB2, SHARP-2, SHARP2, STRA13 and Stra14. As used herein Bhlhe40 refers to the human gene, mouse gene and all other orthologues. Bhlhe40 may refer to the gene identified by accession number NM_003670.2. DEC1 is a basic helix-loop-helix transcription factor that is known to be highly induced in a CD28-dependent manner upon T cell activation (Martínez-Llordella et al. “CD28-inducible transcription factor DEC1 is required for efficient autoreactive CD4+ T cell response.” J Exp Med. 2013 Jul. 29; 210(8):1603-19. doi: 10.1084/jem.20122387. Epub 2013 Jul. 22). DEC1 is required for the development of experimental autoimmune encephalomyelitis and plays a critical role in the production of the proinflammatory cytokines GM-CSF, IFNγ, and IL-2 (Martinez-Llordella, 2013). Applicants previously demonstrated that DEC1 has a role in promoting pathogenic Th17 differentiation (see, WO2015130968A2). Applicants have discovered that Bhlhe40 is upregulated in suppressive T cells and may therefore be targeted for downregulation in order to enhance an immune response.
[0593] IKZF2 is also known as ANF1A2, HELIOS, ZNF1A2, ZNFNIA2. As used herein Helios refers to the human gene, mouse gene and all other orthologues. Helios may refer to the gene identified by accession numbers NM_016260.2, NM_001079526.1 and NM_011770.4. Helios is a T cell-specific zinc finger transcription factor that is encoded by the Ikzf2 gene. It belongs to the Ikaros family of zinc finger proteins, which also includes Ikaros (Ikzf1), Aiolos (Ikzf3), Eos (Ikzf4), and Pegasus (Ikzf5). Helios, along with other Ikaros proteins, regulate lymphocyte development and differentiation. Helios has been shown to have specific roles in Tregs (Nakagawa et al., Instability of Helios-deficient Tregs is associated with conversion to a T-effector phenotype and enhanced antitumor immunity, Proc Natl Acad Sci USA. 2016 May 31,113(22):6248-53; and Kim et al., Stable inhibitory activity of regulatory T cells requires the transcription factor Helios, Science. 2015 Oct. 16; 350(62.58).334-9). Applicants have shown a role for Helios in a specific suppressive T cell population (i.e., cluster 7). Not being bound by a theory, targeting Helios in specific T cells can enhance treatment and avoid unwanted side effects caused by targeting all Helios expressing T cells.
Diagnosis and Treatment Selection
[0594] In a further embodiment, the present invention provides for a method for determining the CD8.sup.+ T cell status of a subject, or for diagnosing, prognosing or monitoring a disease comprising an immune component in a subject by detecting or quantifying CD8.sup.+ T cells as defined in any embodiment herein in a biological sample of the subject. The CD8.sup.+ T cell status of the subject may be determined before and after therapy, whereby the efficacy of the therapy is determined or monitored. The therapy may be an immunotherapy (e.g., checkpoint blockade therapy). Not being bound by a theory, an immunotherapy is effective if after treatment the suppressive CD8.sup.+ T cells decrease or activated T cells increase. Not being bound by a theory, a subject suffering from cancer having less suppressive CD8.sup.+ T cells has a better prognosis than a subject having more suppressive-CD8.sup.+ T cells.
[0595] The terms “diagnosis” and “monitoring” are commonplace and well-understood in medical practice. By means of further explanation and without limitation the term “diagnosis” generally refers to the process or act of recognizing, deciding on or concluding on a disease or condition in a subject on the basis of symptoms and signs and/or from results of various diagnostic procedures (such as, for example, from knowing the presence, absence and/or quantity of one or more biomarkers characteristic of the diagnosed disease or condition).
[0596] The term “monitoring” generally refers to the follow-up of a disease or a condition in a subject for any changes which may occur over time.
[0597] The terms “prognosing” or “prognosis” generally refer to an anticipation on the progression of a disease or condition and the prospect (e.g., the probability, duration, and/or extent) of recovery. A good prognosis of the diseases or conditions taught herein may generally encompass anticipation of a satisfactory partial or complete recovery from the diseases or conditions, preferably within an acceptable time period. A good prognosis of such may more commonly encompass anticipation of not further worsening or aggravating of such, preferably within a given time period. A poor prognosis of the diseases or conditions as taught herein may generally encompass anticipation of a substandard recovery and/or unsatisfactorily slow recovery, or to substantially no recovery or even further worsening of such.
[0598] The terms also encompass prediction of a disease. The terms “predicting” or “prediction” generally refer to an advance declaration, indication or foretelling of a disease or condition in a subject not (yet) having said disease or condition. For example, a prediction of a disease or condition in a subject may indicate a probability, chance or risk that the subject will develop said disease or condition, for example within a certain time period or by a certain age. Said probability, chance or risk may be indicated inter alia as an absolute value, range or statistics, or may be indicated relative to a suitable control subject or subject population (such as, e.g., relative to a general, normal or healthy subject or subject population). Hence, the probability, chance or risk that a subject will develop a disease or condition may be advantageously indicated as increased or decreased, or as fold-increased or fold-decreased relative to a suitable control subject or subject population. As used herein, the term “prediction” of the conditions or diseases as taught herein in a subject may also particularly mean that the subject has a ‘positive’ prediction of such, i.e., that the subject is at risk of having such (e.g., the risk is significantly increased vis-à-vis a control subject or subject population). The term “prediction of no” diseases or conditions as taught herein as described herein in a subject may particularly mean that the subject has a ‘negative’ prediction of such, i.e., that the subject's risk of having such is not significantly increased vis-à-vis a control subject or subject population.
Kits
[0599] In another aspect, the invention is directed to kit and kit of parts. The terms “kit of parts” and “kit” as used throughout this specification refer to a product containing components necessary for carrying out the specified methods (e.g., methods for detecting, quantifying or isolating immune cells as taught herein), packed so as to allow their transport and storage. Materials suitable for packing the components comprised in a kit include crystal, plastic (e.g., polyethylene, polypropylene, polycarbonate), bottles, flasks, vials, ampules, paper, envelopes, or other types of containers, carriers or supports. Where a kit comprises a plurality of components, at least a subset of the components (e.g., two or more of the plurality of components) or all of the components may be physically separated, e.g., comprised in or on separate containers, carriers or supports. The components comprised in a kit may be sufficient or may not be sufficient for carrying out the specified methods, such that external reagents or substances may not be necessary or may be necessary for performing the methods, respectively. Typically, kits are employed in conjunction with standard laboratory equipment, such as liquid handling equipment, environment (e.g., temperature) controlling equipment, analytical instruments, etc. In addition to the recited binding agents(s) as taught herein, such as for example, antibodies, hybridization probes, amplification and/or sequencing primers, optionally provided on arrays or microarrays, the present kits may also include some or all of solvents, buffers (such as for example but without limitation histidine-buffers, citrate-buffers, succinate-buffers, acetate-buffers, phosphate-buffers, formate buffers, benzoate buffers, TRIS (Tris(hydroxymethyl)-aminomethan) buffers or maleate buffers, or mixtures thereof), enzymes (such as for example but without limitation thermostable DNA polymerase), detectable labels, detection reagents, and control formulations (positive and/or negative), useful in the specified methods. Typically, the kits may also include instructions for use thereof, such as on a printed insert or on a computer readable medium. The terms may be used interchangeably with the term “article of manufacture”, which broadly encompasses any man-made tangible structural product, when used in the present context.
[0600] The invention is further described in the following examples, which do not limit the scope of the invention described in the claims.
EXAMPLES
Example 1—Identification of Novel Tumor Infiltrating CD8.SUP.+ T Cells Populations
[0601] Applicants identified novel CD8 and CD4 populations using the B16 melanoma mouse model. For single-cell RNA-Seq experiments, TTLs from B16 melanomas were collected in 96-well plates. Applicants performed SMART-seq2 following the published protocol (Picelli et al., 2013 Nat Methods 10, 1096-1098) with minor modifications. Standard Illumina sequencing was performed. Cells in tumors tend to be high for inhibitory receptors (e.g., PD1, Tim3, TIGIT, LAG3). Therapies that block these receptors work in tumor therapy. Therefore, Applicants studied populations of TILs to elucidate the complexity of subpopulations that express these co-inhibitory receptors. Further, Applicants studied how these cell types interact with other cell types in the tumor.
[0602]
[0603]
[0604]
[0605]
[0606]
[0607]
[0608]
[0609]
[0610] Applicants hypothesize that cluster 7 is sensitive to steroid signaling. Specifically, cluster 7 may be sensitive to glucocorticoid signaling (see, e.g., Oakley and Cidlowsk J Allergy Clin Immunol. 2013 November; 132(5): 1033-1044). Glucocorticoid signaling turns on expression of MT's and correlates to TJM3/PD1 expression. NR3C1 is the glucocorticoid receptor and is differentially expressed on cluster 7 cells (see, e.g., Tables 1-5). Targeting glucocorticoid sensing may be a target for inhibiting the suppressive function of cluster 7 cells. Glucocorticoid inhibiting drugs have previously been described (see, e.g., Clark, Curr Top Med Chem. 2008; 8(9):813-38) and may be used in combination with checkpoint blockade therapy as described herein.
[0611] Cluster 7 can be further characterized by expression of genes markers. Tables 1 to 5 lists ranked genes differentially expressed in cluster 7. Table 1 lists the top 500 ranked genes. Tables 2 and 3 list transcription factors and cell surface/cytokines. Table 4 lists genes differentially expressed in cluster 7 as compared to all 15 CD8 clusters. Table 5 lists a cluster 7 signature. Cluster 8, 9 and 10 signature genes are listed in ranked order in Tables 6-17. Tables 18-20 list ranked signatures for clusters 7, 8 and 9/10 determined using modified statistical analysis. In certain embodiments, Tables 18-20 were determined using a more statistically accurate analysis of the CD8 clusters. In certain embodiments, Tables 18-20 represent gene signatures based on analyzing more single cells.
TABLE-US-00003 TABLE 1 Ranked top 500 genes differentially expressed in cluster 7 Gene TP TN thresh_mg hyper_pval hyper_qval GLDC 0.719457014 0.847995546 0.705 1.75E−67 3.63E−64 TNFRSF9 0.873303167 0.744988864 8.537 2.48E−73 1.03E−69 PRF1 0.936651584 0.628619154 7.253 8.69E−64 1.20E−60 IRF8 0.886877828 0.663697105 1.501 4.18E−58 3.46E−55 CCRL2 0.7239819 0.791759465 1.05 1.60E−52 9.50E−50 PCYT1A 0.656108597 0.83518931 0.575 4.90E−51 2.54E−48 HAVCR2 0.873303167 0.683184855 2.154 5.96E−59 6.17E−56 LAT2 0.647058824 0.83518931 0.903 2.19E−49 6.50E−47 2900026A02RIK 0.687782805 0.807906459 0.926 9.38E−50 3.24E−47 CSF1 0.556561086 0.885300668 0.911 1.02E−47 2.63E−45 ADAM8 0.787330317 0.726057906 0.864 7.94E−50 2.99E−47 ITGAV 0.85520362 0.657572383 0.084 7.25E−50 2.99E−47 TMPRSS6 0.466063348 0.91481069 0.546 1.18E−41 1.87E−39 ADAMTS14 0.619909502 0.834632517 0.506 1.83E−44 4.00E−42 C1QTNF6 0.538461538 0.877505568 0.379 3.24E−42 5.59E−40 RGS16 0.977375566 0.510022272 2.506 1.88E−54 1.30E−51 SERPINE2 0.542986425 0.873051225 3.895 1.05E−41 1.73E−39 LITAF 0.936651584 0.551224944 5.893 1.35E−49 4.31E−47 RBPJ 0.873303167 0.632516704 2.763 4.56E−49 1.26E−46 TNFRSF4 0.773755656 0.723830735 3.144 8.39E−47 2.05E−44 GPR56 0.647058824 0.806792873 0.696 2.30E−42 4.15E−40 PGLYRP1 0.923076923 0.53674833 4.954 5.99E−44 1.18E−41 HILPDA 0.764705882 0.711024499 5.185 1.14E−42 2.16E−40 ANXA2 0.923076923 0.520601336 10.29 1.88E−41 2.78E−39 PLEK 0.914027149 0.566815145 1.395 1.02E−46 2.36E−44 LAG3 0.963800905 0.513919822 4.793 7.81E−51 3.60E−48 RGS8 0.538461538 0.865812918 0.275 5.40E−39 5.60E−37 NABP1 0.828054299 0.63363029 2.705 2.53E−40 3.09E−38 GPD2 0.714932127 0.732182628 1.007 3.13E−38 3.09E−36 SLC37A2 0.502262443 0.878062361 0.546 1.80E−36 1.43E−34 IKZF2 0.719457014 0.737193764 0.084 6.49E−40 7.47E−38 AA467197 0.466063348 0.896993318 2.233 5.25E−36 3.96E−34 UBASH3B 0.660633484 0.787861915 5.56 1.95E−40 2.58E−38 EPAS1 0.529411765 0.863585746 0.986 5.63E−37 4.77E−35 SERPINB9 0.850678733 0.593541203 3.333 4.94E−38 4.65E−36 GAPDH 0.895927602 0.54844098 12.436 7.42E−40 8.31E−38 CCNG1 0.873303167 0.587973274 2.284 1.79E−41 2.75E−39 ACOT7 0.895927602 0.555122494 3.285 6.97E−41 9.63E−39 BHLHE40 0.977375566 0.422048998 6.796 6.69E−41 9.57E−39 TPI1 0.954751131 0.462138085 5.874 2.28E−40 2.86E−38 RGS2 0.900452489 0.541202673 1.411 1.09E−39 1.19E−37 CDK6 0.696832579 0.73830735 1.978 1.79E−36 1.43E−34 CXCR6 0.986425339 0.423719376 5.506 4.32E−44 8.96E−42 MNDA 0.470588235 0.889755011 4.02 1.12E−34 7.15E−33 GEM 0.719457014 0.716592428 5.361 3.84E−36 2.95E−34 GM5177 0.909502262 0.517817372 3.82 4.31E−38 4.16E−36 CST7 0.963800905 0.445991091 7.082 1.99E−40 2.58E−38 SLC2A3 0.656108597 0.768374165 5.663 8.80E−36 6.40E−34 KIT 0.466063348 0.88752784 0.516 2.23E−33 1.27E−31 GZMB 0.850678733 0.579064588 2.384 7.84E−36 5.80E−34 S100A11 0.968325792 0.418708241 8.456 8.11E−38 7.31E−36 IL1R2 0.407239819 0.915924276 3.396 2.28E−32 1.20E−30 DSCAM 0.479638009 0.876948775 0.189 1.06E−32 5.69E−31 CCL3 0.642533937 0.773942094 3.904 8.83E−35 5.72E−33 FAM3C 0.832579186 0.605790646 0.287 1.12E−36 9.25E−35 CASP3 0.895927602 0.549554566 3.644 5.01E−40 5.94E−38 NR4A2 0.914027149 0.498886414 0.595 2.62E−36 2.05E−34 CD244 0.466063348 0.883073497 3.545 3.23E−32 1.67E−30 SLC16A11 0.429864253 0.901447661 1.029 1.21E−31 6.02E−30 DUSP4 0.755656109 0.677616927 0.444 2.87E−35 2.02E−33 CAPG 0.864253394 0.558463252 4.057 3.05E−35 2.11E−33 SAMSN1 0.941176471 0.473830735 1.029 1.01E−38 1.02E−36 FAM110A 0.683257919 0.7344098 0.731 1.08E−33 6.37E−32 CIAPIN1 0.859728507 0.581291759 1.669 8.11E−38 7.31E−36 NRGN 0.484162896 0.865812918 0.604 1.10E−30 5.06E−29 PLAC8 0.43438914 0.896436526 10.661 5.77E−31 2.75E−29 IMPA2 0.714932127 0.707683742 0.832 6.52E−34 3.92E−32 SRGAP3 0.529411765 0.840757238 0.39 1.24E−31 6.14E−30 FOXRED2 0.425339367 0.900890869 1.731 8.24E−31 3.88E−29 NRP1 0.751131222 0.670935412 0.163 1.76E−33 1.03E−31 ARL14EP 0.7239819 0.703786192 2.084 1.20E−34 7.55E−33 EHD1 0.832579186 0.594654788 3.266 5.47E−35 3.60E−33 LGALS1 0.923076923 0.508351893 10.112 1.29E−39 1.37E−37 MT1 0.556561086 0.814587973 2.173 3.92E−30 1.78E−28 ERGIC1 0.71040724 0.699888641 0.333 5.94E−32 3.00E−30 OSBPL3 0.800904977 0.615256125 0.176 8.51E−33 4.64E−31 SMIM3 0.497737557 0.857461024 6.263 9.72E−31 4.53E−29 SERPINA3G 0.877828054 0.540089087 4.066 4.39E−35 2.94E−33 TOX 0.904977376 0.520044543 3.455 1.76E−37 1.55E−35 PKM 0.805429864 0.583518931 9.882 5.15E−29 2.09E−27 CX3CR1 0.511312217 0.843541203 1.646 1.21E−29 5.27E−28 ID2 0.972850679 0.341314031 4.705 6.02E−29 2.42E−27 PEX16 0.624434389 0.759465479 2.725 1.51E−29 6.38E−28 GPR65 0.760180995 0.652561247 2.585 5.08E−32 2.60E−30 SEPT11 0.837104072 0.582405345 0.88 5.90E−34 3.60E−32 NFKB2 0.846153846 0.561804009 2.359 1.52E−32 8.07E−31 FDX1 0.574660633 0.79454343 1.77 7.17E−29 2.80E−27 ENTPD1 0.701357466 0.692093541 0.202 2.00E−29 8.39E−28 BCL2A1D 0.959276018 0.403674833 2.198 1.91E−33 1.10E−31 DNMT3A 0.660633484 0.729398664 2.63 1.40E−29 6.04E−28 ZMIZ1 0.751131222 0.655345212 0.214 4.47E−31 2.16E−29 NRN1 0.538461538 0.815144766 3.643 9.38E−28 3.14E−26 STAT3 0.909502262 0.43596882 6.143 3.70E−27 1.13E−25 CLIC4 0.619909502 0.758351893 1.202 9.73E−29 3.74E−27 GDPD5 0.438914027 0.878062361 2.606 4.27E−27 1.28E−25 CCR8 0.443438914 0.874164811 5.401 7.64E−27 2.23E−25 NEDD9 0.665158371 0.714922049 5.851 6.40E−28 2.17E−26 GSTO1 0.624434389 0.751670379 5.507 3.04E−28 1.08E−26 PGK1 0.936651584 0.402561247 7.541 2.92E−28 1.04E−26 PDCD1 0.968325792 0.415367483 5.101 2.34E−37 2.02E−35 UHRF2 0.542986425 0.809576837 0.971 2.48E−27 7.85E−26 PLSCR1 0.696832579 0.688752784 2.785 2.73E−28 1.00E−26 TIGIT 0.981900452 0.354120267 4.895 4.50E−33 2.49E−31 ALDOA 0.954751131 0.360801782 9.477 5.16E−27 1.53E−25 LILRB4 0.597285068 0.767817372 5.621 2.81E−27 8.68E−26 KLRC1 0.841628959 0.546213808 4.198 1.16E−29 5.11E−28 TFF1 0.384615385 0.904788419 5.97 6.36E−26 1.60E−24 HNRNPA1 0.78280543 0.589643653 9.38 1.65E−26 4.52E−25 PTPRS 0.606334842 0.763919822 1.989 7.79E−28 2.62E−26 1700017B05RIK 0.71040724 0.675946548 1.618 2.83E−28 1.03E−26 PTPLAD1 0.805429864 0.580734967 0.748 1.22E−28 4.65E−27 VAMP8 0.923076923 0.462138085 2.807 4.06E−33 2.27E−31 ESD 0.886877828 0.528396437 4.135 4.08E−35 2.77E−33 GM14295 0.755656109 0.631959911 3.009 2.37E−28 8.78E−27 NUCB1 0.895927602 0.478841871 0.444 4.44E−30 2.00E−28 TUBB6 0.429864253 0.879175947 4.374 4.18E−26 1.06E−24 SH2D2A 0.837104072 0.541759465 8.666 2.34E−28 8.76E−27 RCN1 0.574660633 0.778953229 0.949 3.65E−26 9.34E−25 TRPS1 0.511312217 0.829064588 0.986 9.50E−27 2.75E−25 RPS27L 0.742081448 0.646993318 4.99 1.54E−28 5.82E−27 SH3BGRL 0.828054299 0.559020045 0.546 3.27E−29 1.34E−27 FKBP1A 0.972850679 0.393652561 4.911 1.17E−35 8.36E−34 AFG3L2 0.674208145 0.697104677 0.411 1.82E−26 4.89E−25 KDELR2 0.805429864 0.573496659 2.934 1.12E−27 3.68E−26 IL2RB 0.561085973 0.782293987 9.964 5.64E−25 1.26E−23 SLC25A4 0.950226244 0.405902004 7.096 1.34E−31 6.55E−30 LYRM4 0.574660633 0.773942094 0.39 2.42E−25 5.71E−24 BCL2L11 0.660633484 0.708240535 1.748 2.60E−26 6.81E−25 DUT 0.814479638 0.609131403 2.151 4.25E−34 2.63E−32 SERPINB6A 0.656108597 0.712694878 3.637 2.23E−26 5.93E−25 RFK 0.714932127 0.660356347 0.595 1.16E−26 3.28E−25 EEA1 0.547511312 0.795100223 0.189 2.24E−25 5.36E−24 GALK1 0.56561086 0.787861915 3.819 1.74E−26 4.71E−25 KLRC2 0.778280543 0.597995546 1.766 5.80E−27 1.71E−25 TMBIM4 0.597285068 0.757238307 1.876 1.44E−25 3.55E−24 PKP4 0.633484163 0.723273942 0.31 5.06E−25 1.15E−23 RPS26 0.950226244 0.370824053 11.127 3.10E−27 9.52E−26 LRRK1 0.50678733 0.819042316 0.322 2.49E−24 5.09E−23 GLIPR1 0.755656109 0.613585746 5.081 7.31E−26 1.83E−24 STK39 0.502262443 0.820155902 0.263 5.90E−24 1.15E−22 SERPINA3H 0.714932127 0.646993318 0.251 7.63E−25 1.65E−23 SLC52A3 0.325791855 0.927616927 3.605 1.15E−23 2.12E−22 GM5069 0.728506787 0.623608018 2.694 1.45E−23 2.63E−22 CCDC50 0.65158371 0.708240535 0.367 3.85E−25 8.92E−24 ACTG1 0.945701357 0.349665924 11.98 7.96E−24 1.51E−22 SLA2 0.823529412 0.550668151 0.39 2.03E−27 6.46E−26 IL10RA 0.837104072 0.538975501 0.214 5.38E−28 1.86E−26 CENPA 0.773755656 0.61247216 2.791 2.92E−28 1.04E−26 RUNX2 0.78280543 0.582962138 1.546 1.20E−25 2.97E−24 NEK6 0.339366516 0.918708241 1.144 3.51E−23 6.06E−22 TXN1 0.959276018 0.367483296 3.623 7.60E−29 2.95E−27 RPN1 0.891402715 0.457126949 0.356 1.45E−26 4.07E−25 STARD3NL 0.647058824 0.720489978 2.227 2.34E−26 6.17E−25 KDM2B 0.678733032 0.677616927 0.88 2.60E−24 5.29E−23 MPHOSPH6 0.601809955 0.745545657 2.59 2.42E−24 4.96E−23 IL18RAP 0.733031674 0.626948775 0.66 1.40E−24 2.93E−23 CLTC 0.828054299 0.525612472 0.176 5.84E−25 1.30E−23 DEGS1 0.769230769 0.605790646 5.83 1.03E−26 2.96E−25 0610007P14RIK 0.63800905 0.718262806 3.406 7.29E−25 1.58E−23 TNFRSF18 0.895927602 0.459910913 4.331 1.10E−27 3.65E−26 TIPRL 0.773755656 0.600222717 3.18 1.29E−26 3.64E−25 ATXN10 0.778280543 0.595768374 1.131 1.14E−26 3.26E−25 SERPINB6B 0.787330317 0.561247216 3.908 1.41E−23 2.57E−22 ISY1 0.886877828 0.482182628 1.975 6.73E−29 2.66E−27 CMTM7 0.864253394 0.512249443 1.761 6.60E−29 2.63E−27 SLC16A3 0.479638009 0.827394209 0.496 2.07E−22 3.16E−21 ARSB 0.79638009 0.585746102 0.251 5.85E−28 2.00E−26 DDIT4 0.601809955 0.735523385 0.356 7.08E−23 1.16E−21 PRELID1 0.977375566 0.298997773 7.483 4.65E−25 1.07E−23 RBL2 0.832579186 0.511135857 0.239 6.99E−24 1.35E−22 HSP90B1 0.823529412 0.521714922 7.442 7.64E−24 1.46E−22 HMGCR 0.65158371 0.694877506 2.791 2.84E−23 4.97E−22 CETN2 0.705882353 0.658129176 0.669 3.71E−25 8.65E−24 TWSG1 0.466063348 0.835746102 0.367 3.34E−22 4.90E−21 COPS4 0.764705882 0.609131403 3.651 1.59E−26 4.40E−25 TMEM123 0.891402715 0.464922049 4.878 1.61E−27 5.23E−26 PREP 0.56561086 0.767817372 2.782 2.97E−23 5.18E−22 VPS52 0.642533937 0.700445434 0.782 6.35E−23 1.05E−21 NCOR2 0.656108597 0.688752784 0.239 5.32E−23 8.90E−22 S100A4 0.769230769 0.596325167 6.264 1.76E−25 4.32E−24 CALR 0.923076923 0.384187082 2.844 1.64E−23 2.98E−22 RABGAP1L 0.787330317 0.551781737 2.223 1.87E−22 2.90E−21 UAP1 0.461538462 0.83908686 2.275 3.08E−22 4.54E−21 PGAM1 0.918552036 0.421492205 5.865 4.67E−27 1.39E−25 SERPINA3I 0.687782805 0.659242762 0.918 5.24E−23 8.84E−22 PTGER2 0.479638009 0.824053452 0.227 7.64E−22 1.03E−20 COX17 0.868778281 0.493875278 5.638 2.54E−27 7.99E−26 BCL2A1B 0.954751131 0.369153675 1.937 5.07E−28 1.77E−26 NAP1L1 0.968325792 0.359131403 4.392 5.38E−30 2.40E−28 PIGS 0.78280543 0.587416481 4.183 3.21E−26 8.25E−25 SIK1 0.864253394 0.478285078 1.257 1.04E−24 2.21E−23 FLNB 0.515837104 0.79844098 0.163 5.22E−22 7.35E−21 SEMA6D 0.380090498 0.888084633 0.367 1.74E−21 2.16E−20 MRPS21 0.701357466 0.658129176 3.124 1.43E−24 2.97E−23 MAP2K3 0.742081448 0.623608018 4.48 2.42E−25 5.71E−24 ENO3 0.470588235 0.829064588 3.527 1.34E−21 1.69E−20 SMARCB1 0.65158371 0.698218263 4.752 9.93E−24 1.84E−22 ATXN1 0.841628959 0.489420935 0.138 1.17E−22 1.85E−21 CDV3 0.787330317 0.580178174 0.585 6.30E−26 1.59E−24 SMPDL3B 0.470588235 0.828507795 0.832 1.66E−21 2.07E−20 AI662270 0.809954751 0.550111359 1.195 2.36E−25 5.63E−24 SERPINA3F 0.42081448 0.86247216 1.384 1.67E−21 2.08E−20 PNKD 0.606334842 0.727728285 0.623 2.55E−22 3.83E−21 CISD1 0.592760181 0.744432071 3.873 4.57E−23 7.80E−22 NCF4 0.805429864 0.546213808 1.791 3.08E−24 6.21E−23 PTPN7 0.764705882 0.599109131 3.651 3.21E−25 7.52E−24 IL12RB2 0.447963801 0.841870824 0.66 4.40E−21 5.09E−20 PADI2 0.647058824 0.702672606 2.709 8.75E−24 1.64E−22 ETFB 0.828054299 0.542873051 3.503 4.17E−27 1.26E−25 MED11 0.597285068 0.737750557 2.676 1.19E−22 1.87E−21 RAB27A 0.769230769 0.602449889 2.16 2.83E−26 7.33E−25 TYK2 0.683257919 0.66091314 0.604 1.15E−22 1.82E−21 GABARAPL1 0.597285068 0.733853007 0.595 4.23E−22 6.05E−21 CTSC 0.764705882 0.587416481 2.689 9.44E−24 1.75E−22 AW112010 0.923076923 0.382516704 10.134 2.54E−23 4.48E−22 ARL1 0.737556561 0.616926503 3.406 6.93E−24 1.34E−22 PRDX2 0.864253394 0.480512249 4.836 5.65E−25 1.26E−23 GNPNAT1 0.552036199 0.767260579 1.651 1.50E−21 1.89E−20 SLC39A1 0.819004525 0.509465479 0.546 8.38E−22 1.12E−20 GM14440 0.665158371 0.673719376 0.401 4.02E−22 5.79E−21 CYB5B 0.674208145 0.669821826 2.29 1.03E−22 1.65E−21 ERO1L 0.497737557 0.806792873 1.373 3.47E−21 4.11E−20 NDFIP2 0.610859729 0.721046771 0.84 6.18E−22 8.42E−21 PGLS 0.846153846 0.528396437 4.531 4.70E−28 1.65E−26 ACSL4 0.755656109 0.577394209 1.541 2.15E−21 2.62E−20 FUCA2 0.50678733 0.800111359 1.803 3.35E−21 3.98E−20 CD200 0.34841629 0.901447661 1.614 2.61E−20 2.71E−19 XPNPEP1 0.647058824 0.689309577 0.345 5.53E−22 7.72E−21 PLP2 0.832579186 0.54064588 1.064 1.64E−27 5.28E−26 MT2 0.325791855 0.913140312 1.646 5.06E−20 4.93E−19 LPIN2 0.393665158 0.873051225 1.245 3.48E−20 3.53E−19 3830406C13RIK 0.520361991 0.787861915 2.733 6.52E−21 7.28E−20 SSR2 0.859728507 0.498886414 3.64 1.72E−26 4.70E−25 NDUFS2 0.819004525 0.557349666 4.721 1.34E−27 4.37E−26 2700060E02RIK 0.923076923 0.432628062 5.072 2.72E−29 1.13E−27 MTHFD1L 0.597285068 0.729955457 0.918 1.47E−21 1.85E−20 HIP1 0.647058824 0.682628062 0.163 4.02E−21 4.67E−20 DYNLT3 0.429864253 0.849665924 0.774 2.78E−20 2.87E−19 EFHD2 0.79638009 0.548997773 0.263 2.49E−23 4.43E−22 TNFSF4 0.384615385 0.878619154 3.874 3.78E−20 3.79E−19 FARS2 0.556561086 0.755011136 0.604 2.51E−20 2.61E−19 CST3 0.791855204 0.551781737 1.7 4.71E−23 8.01E−22 NOL7 0.809954751 0.532293987 0.832 3.34E−23 5.80E−22 OXSR1 0.524886878 0.779510022 0.595 3.35E−20 3.41E−19 DUSP6 0.57918552 0.740534521 1.475 6.50E−21 7.28E−20 SEPT2 0.954751131 0.329064588 0.536 2.54E−23 4.48E−22 UTF1 0.330316742 0.909242762 4.976 1.01E−19 9.36E−19 ENO1 0.895927602 0.393652561 9.733 4.25E−20 4.22E−19 MTMR1 0.56561086 0.756681514 0.202 1.32E−21 1.68E−20 DCTN5 0.714932127 0.631959911 2.932 6.66E−23 1.10E−21 PDCL3 0.647058824 0.687639198 3.007 9.13E−22 1.20E−20 DDB1 0.764705882 0.58908686 4.051 5.87E−24 1.15E−22 HDAC1 0.837104072 0.505011136 2.214 8.21E−24 1.55E−22 SREBF2 0.733031674 0.597438753 0.138 5.92E−21 6.69E−20 COMMD3 0.733031674 0.60467706 3.134 8.29E−22 1.11E−20 GM9855 0.619909502 0.703786192 0.202 1.07E−20 1.15E−19 CTSB 0.959276018 0.346325167 2.31 2.72E−26 7.09E−25 SIVA1 0.57918552 0.739977728 2.032 7.74E−21 8.61E−20 COX7B 0.877828054 0.466035635 3.203 2.15E−25 5.18E−24 BEND4 0.705882353 0.630846325 0.356 1.18E−21 1.52E−20 CBLB 0.981900452 0.267260579 1.609 1.33E−22 2.08E−21 ANKRD39 0.466063348 0.821269488 2.245 8.50E−20 7.96E−19 KARS 0.873303167 0.465478842 0.299 1.31E−24 2.74E−23 LXN 0.50678733 0.791202673 1.373 7.43E−20 7.05E−19 D16ERTD472E 0.841628959 0.496659243 0.926 1.73E−23 3.11E−22 SPCS3 0.714932127 0.61636971 3.074 5.30E−21 6.05E−20 TPM4 0.941176471 0.361358575 4.167 2.84E−24 5.75E−23 CHST12 0.619909502 0.703229399 1.599 1.26E−20 1.35E−19 ACOT9 0.692307692 0.64532294 1.305 8.52E−22 1.13E−20 METAP2 0.832579186 0.508908686 2.057 1.28E−23 2.34E−22 LAP3 0.429864253 0.845211581 0.88 1.60E−19 1.43E−18 FUBP1 0.733031674 0.605233853 0.31 7.11E−22 9.61E−21 TANK 0.647058824 0.674276169 1.35 4.42E−20 4.38E−19 MNF1 0.610859729 0.707683742 2.362 3.61E−20 3.64E−19 GM12669 0.769230769 0.569599109 2.278 3.39E−22 4.96E−21 ST14 0.438914027 0.837416481 0.556 2.83E−19 2.40E−18 IPO7 0.547511312 0.755567929 1.131 2.17E−19 1.88E−18 TARS 0.63800905 0.691536748 0.465 3.30E−21 3.93E−20 SLC25A17 0.597285068 0.722717149 3.434 1.38E−20 1.47E−19 PFKL 0.615384615 0.71325167 2.284 2.05E−21 2.50E−20 TMBIM1 0.330316742 0.90701559 2.462 3.10E−19 2.61E−18 CCT3 0.891402715 0.46325167 0.848 2.59E−27 8.08E−26 OS9 0.823529412 0.514476615 0.411 5.39E−23 8.97E−22 CALM3 0.85520362 0.491648107 1.163 6.53E−25 1.43E−23 DAPK2 0.43438914 0.841314031 2.31 2.15E−19 1.87E−18 SIL1 0.407239819 0.856904232 0.807 6.91E−19 5.45E−18 GTF2E2 0.533936652 0.768930958 1.546 1.02E−19 9.46E−19 CANX 0.950226244 0.325167038 0.401 5.66E−22 7.87E−21 NDUFA11 0.733031674 0.60857461 0.422 2.82E−22 4.21E−21 UBE2N 0.850678733 0.472160356 0.31 5.39E−22 7.56E−21 BAX 0.846153846 0.489420935 4.082 2.63E−23 4.63E−22 IFRD1 0.764705882 0.565701559 0.669 3.58E−21 4.21E−20 SDCBP2 0.352941176 0.890311804 0.971 1.38E−18 1.03E−17 BIRC2 0.57918552 0.730512249 0.444 1.42E−19 1.29E−18 MARC2 0.696832579 0.654231626 3.455 1.75E−23 3.15E−22 RABGGTB 0.615384615 0.703786192 1.111 3.50E−20 3.54E−19 QDPR 0.606334842 0.717706013 2.618 5.86E−21 6.64E−20 LAMTOR4 0.656108597 0.675389755 2.776 2.91E−21 3.50E−20 USMG5 0.868778281 0.466592428 2.884 4.90E−24 9.76E−23 CUEDC2 0.57918552 0.732739421 4.581 7.26E−20 6.91E−19 TSSC1 0.588235294 0.725501114 0.848 6.27E−20 6.03E−19 GNB1 0.963800905 0.29844098 1.521 8.26E−22 1.11E−20 TMEM254B 0.719457014 0.621380846 0.807 3.74E−22 5.45E−21 CTLA4 0.936651584 0.413140312 2.685 1.42E−29 6.07E−28 RILPL2 0.760180995 0.576837416 2.284 6.77E−22 9.20E−21 WDR61 0.592760181 0.718819599 0.816 1.43E−19 1.30E−18 SPRY2 0.533936652 0.762806236 0.872 7.08E−19 5.56E−18 XPOT 0.466063348 0.815701559 0.411 6.17E−19 4.92E−18 INF2 0.443438914 0.830734967 0.189 1.01E−18 7.72E−18 GLUD1 0.814479638 0.511135857 0.379 2.19E−21 2.65E−20 HCCS 0.461538462 0.819599109 1.753 5.04E−19 4.08E−18 ACTR10 0.719457014 0.635300668 2.895 6.71E−24 1.31E−22 ITGB1BP1 0.606334842 0.714922049 0.526 1.36E−20 1.46E−19 BSG 0.932126697 0.357461024 0.575 3.86E−22 5.57E−21 LIMSI 0.751131222 0.589643653 0.401 2.86E−22 4.25E−21 BCAP29 0.615384615 0.69766147 3.131 2.06E−19 1.80E−18 FARP1 0.488687783 0.798997773 0.299 5.70E−19 4.55E−18 DGAT1 0.755656109 0.565144766 0.345 5.29E−20 5.13E−19 MMD 0.687782805 0.635300668 0.485 4.70E−20 4.62E−19 SSR3 0.764705882 0.556792873 4.001 3.62E−20 3.64E−19 RHOF 0.705882353 0.630846325 2.272 1.18E−21 1.52E−20 ZBTB32 0.43438914 0.83518931 1.084 2.09E−18 1.52E−17 VDAC3 0.733031674 0.605790646 1.774 6.10E−22 8.42E−21 SMS 0.733031674 0.595768374 1.333 9.26E−21 1.01E−19 AKR1A1 0.918552036 0.384187082 7.662 1.02E−22 1.63E−21 ACTN1 0.574660633 0.731069042 0.506 3.79E−19 3.16E−18 ATP6V0B 0.628959276 0.693207127 3.939 2.22E−20 2.32E−19 PTK2B 0.809954751 0.505567929 1.438 3.48E−20 3.53E−19 REEP5 0.904977376 0.436525612 1.753 2.03E−26 5.42E−25 CREM 0.678733032 0.658129176 2.531 9.14E−22 1.20E−20 HK1 0.687782805 0.628062361 0.322 3.24E−19 2.72E−18 EIF1AX 0.674208145 0.654788419 2.68 8.11E−21 8.92E−20 RAP1A 0.769230769 0.56013363 1.864 4.22E−21 4.89E−20 SEC61G 0.850678733 0.482182628 2.353 3.95E−23 6.77E−22 SAR1B 0.674208145 0.64922049 1.705 3.81E−20 3.81E−19 RNH1 0.751131222 0.58518931 1.077 9.65E−22 1.27E−20 BMYC 0.43438914 0.834632517 1.098 2.55E−18 1.82E−17 TMEM256 0.601809955 0.70935412 2.104 2.27E−19 1.95E−18 NHP2 0.692307692 0.644766147 6.673 9.98E−22 1.30E−20 TMEM135 0.57918552 0.723830735 0.251 1.02E−18 7.74E−18 OTUB1 0.823529412 0.506124722 3.671 4.88E−22 6.90E−21 MEA1 0.683257919 0.651447661 5.398 1.80E−21 2.22E−20 SSBP1 0.755656109 0.570155902 1.281 1.45E−20 1.54E−19 CYP51 0.538461538 0.758351893 0.687 9.01E−19 6.93E−18 DCTN2 0.79638009 0.528953229 0.687 5.10E−21 5.84E−20 TXNDC17 0.714932127 0.624164811 1.669 6.13E−22 8.42E−21 PHB 0.787330317 0.542873051 2.43 1.99E−21 2.44E−20 CISD3 0.538461538 0.760022272 2.973 5.38E−19 4.33E−18 SDF4 0.923076923 0.371937639 4.852 3.85E−22 5.57E−21 ETOHI1 0.78280543 0.520044543 0.202 2.19E−18 1.59E−17 LDHA 0.63800905 0.662026726 11.313 1.19E−17 7.69E−17 UQCR11 0.656108597 0.664253898 2.007 6.89E−20 6.60E−19 MVP 0.452488688 0.824053452 1.993 1.07E−18 8.11E−18 DENND4A 0.886877828 0.396436526 0.124 4.72E−19 3.85E−18 DNAJC1 0.592760181 0.716592428 0.766 2.76E−19 2.35E−18 RAB8B 0.819004525 0.501113586 1.05 7.14E−21 7.96E−20 ABHD4 0.343891403 0.894766147 5.112 2.25E−18 1.62E−17 PLK2 0.380090498 0.870267261 3.374 4.47E−18 3.09E−17 MIF 0.941176471 0.315701559 6.412 2.87E−19 2.43E−18 FBXW11 0.615384615 0.691536748 0.151 1.15E−18 8.63E−18 SLC25A3 0.764705882 0.546213808 10.008 5.17E−19 4.17E−18 XDH 0.533936652 0.759465479 0.411 1.98E−18 1.45E−17 MLF2 0.719457014 0.610244989 3.862 8.04E−21 8.87E−20 MRPL40 0.65158371 0.682628062 3.936 1.18E−21 1.52E−20 PDIA4 0.63800905 0.678173719 2.128 1.54E−19 1.38E−18 CD200R1 0.384615385 0.865812918 1.454 8.03E−18 5.31E−17 GUK1 0.583710407 0.724387528 2.563 2.78E−19 2.36E−18 OSTF1 0.755656109 0.547884187 9.286 3.86E−18 2.69E−17 9530068E07RIK 0.737556561 0.594654788 0.496 3.54E−21 4.18E−20 RAC1 0.918552036 0.378619154 0.872 4.21E−22 6.05E−21 PLEKHB2 0.719457014 0.628062361 4.253 5.57E−23 9.24E−22 DNAJB4 0.330316742 0.899777283 2.183 9.69E−18 6.30E−17 IL21R 0.841628959 0.457126949 0.993 3.88E−19 3.22E−18 SSR4 0.859728507 0.499443207 5.195 1.47E−26 4.09E−25 SMYD5 0.352941176 0.884743875 1.157 1.54E−17 9.81E−17 IQSEC1 0.764705882 0.542316258 0.422 1.34E−18 1.01E−17 STX11 0.515837104 0.770044543 0.556 6.80E−18 4.55E−17 GGH 0.443438914 0.827951002 2.856 2.74E−18 1.95E−17 ATPIF1 0.678733032 0.652561247 4.168 4.49E−21 5.17E−20 IDI1 0.475113122 0.79844098 0.367 2.03E−17 1.27E−16 CNIH 0.660633484 0.653674833 3.426 3.86E−19 3.20E−18 NAPSA 0.389140271 0.861358575 0.949 1.40E−17 8.99E−17 BCL2A1C 0.642533937 0.669265033 1.036 5.67E−19 4.54E−18 COMT 0.529411765 0.79064588 3.849 2.09E−22 3.18E−21 APRT 0.787330317 0.547327394 1.189 6.16E−22 8.42E−21 ATP10A 0.502262443 0.780066815 0.322 8.62E−18 5.68E−17 ECH1 0.886877828 0.436525612 2.348 2.12E−23 3.79E−22 SEPHS2 0.610859729 0.694877506 2.293 1.41E−18 1.05E−17 GLRX3 0.755656109 0.571826281 4.684 9.36E−21 1.02E−19 FDPS 0.570135747 0.731625835 3.992 1.00E−18 7.64E−18 RNPEP 0.606334842 0.703786192 0.816 3.57E−19 2.98E−18 TFG 0.601809955 0.706570156 0.74 5.04E−19 4.08E−18 TNFRSF1B 0.877828054 0.453786192 4.715 5.90E−24 1.15E−22 YWHAE 0.968325792 0.285634744 1.07 2.19E−21 2.65E−20 GNG2 0.719457014 0.597438753 0.287 2.35E−19 2.02E−18 TRPV2 0.701357466 0.615256125 4.401 2.71E−19 2.31E−18 HSP90AB1 0.936651584 0.31013363 9.834 6.45E−18 4.33E−17 XBP1 0.619909502 0.691536748 0.401 3.69E−19 3.08E−18 MRPS36 0.619909502 0.690979955 1.454 4.31E−19 3.54E−18 STRAP 0.79638009 0.526726058 1.674 9.02E−21 9.87E−20 EIF4E 0.696832579 0.624721604 4.205 7.35E−20 6.99E−19 MXI1 0.371040724 0.871937639 0.669 2.46E−17 1.50E−16 ECE1 0.429864253 0.832962138 2.101 1.46E−17 9.30E−17 GM17745 0.42081448 0.837416481 1.305 2.95E−17 1.77E−16 CHCHD10 0.556561086 0.739977728 4.486 2.50E−18 1.79E−17 BIN1 0.78280543 0.552895323 3.067 5.40E−22 7.56E−21 TDG 0.411764706 0.845768374 3.288 1.45E−17 9.30E−17 TMEM30A 0.701357466 0.60467706 0.356 4.04E−18 2.81E−17 ACP1 0.633484163 0.680400891 4.013 2.64E−19 2.25E−18 PFDN1 0.619909502 0.694877506 3.848 1.43E−19 1.30E−18 SEPT9 0.85520362 0.458797327 4.236 3.69E−21 4.31E−20 PSMB4 0.868778281 0.474944321 6.441 5.11E−25 1.15E−23 PA2G4 0.787330317 0.526726058 2.995 1.22E−19 1.12E−18 P4HB 0.936651584 0.365256125 0.526 7.55E−24 1.45E−22 CCDC6 0.642533937 0.665367483 0.124 1.62E−18 1.20E−17 BC004004 0.660633484 0.658685969 0.888 9.88E−20 9.19E−19 COPS6 0.850678733 0.475501114 1.47 2.27E−22 3.44E−21 SLC25A11 0.7239819 0.60857461 4.59 3.62E−21 4.26E−20 IGBP1 0.742081448 0.594654788 4.527 9.84E−22 1.29E−20 SSR1 0.895927602 0.404231626 1.007 3.13E−21 3.75E−20 TRAF4 0.429864253 0.832962138 2.223 1.46E−17 9.30E−17 HSD17B12 0.552036199 0.739420935 0.444 8.88E−18 5.84E−17 COX6C 0.936651584 0.374164811 6.362 7.14E−25 1.56E−23 RIOK1 0.619909502 0.685412027 1.17 2.01E−18 1.46E−17 RNASEK 0.805429864 0.530066815 1.379 2.49E−22 3.75E−21 SYTL2 0.502262443 0.776726058 0.345 2.41E−17 1.48E−16 ORMDL1 0.606334842 0.69766147 0.444 2.00E−18 1.46E−17 FXR1 0.56561086 0.729955457 2.401 4.96E−18 3.40E−17 UGP2 0.497737557 0.781737194 1.642 1.55E−17 9.85E−17 PTMS 0.524886878 0.763919822 1.208 4.77E−18 3.28E−17 LAMP2 0.547511312 0.744432071 1.982 6.23E−18 4.19E−17 HSPD1 0.846153846 0.458797327 1.585 6.50E−20 6.23E−19 HSBP1 0.746606335 0.582962138 0.856 6.34E−21 7.12E−20 PDIA3 0.945701357 0.331291759 6.479 9.01E−22 1.19E−20 ITFG1 0.556561086 0.736636971 1.807 6.60E−18 4.42E−17 PERP 0.371040724 0.869153675 1.195 7.32E−17 4.13E−16 EXT2 0.542986425 0.751113586 1.844 2.62E−18 1.87E−17 TRAF1 0.859728507 0.444877506 4.098 2.73E−20 2.82E−19 NDUFB8 0.805429864 0.527839644 1.922 4.48E−22 6.36E−21 TCP1 0.900452489 0.426503341 4.705 1.85E−24 3.82E−23 NFKBIE 0.470588235 0.804008909 0.911 1.02E−17 6.64E−17 HIF1A 0.800904977 0.521158129 4.03 9.86E−21 1.06E−19 ATP5G1 0.837104072 0.488864143 4.903 5.86E−22 8.13E−21 PLEKHO2 0.57918552 0.712694878 0.367 2.34E−17 1.45E−16 SIN3B 0.814479638 0.518930958 1.422 2.87E−22 4.25E−21 EDF1 0.936651584 0.36636971 6.946 5.63E−24 1.12E−22 PRDX1 0.977375566 0.29064588 5.303 4.29E−24 8.60E−23 VPS35 0.615384615 0.68986637 0.705 1.82E−18 1.34E−17 RFC2 0.733031674 0.593541203 0.766 1.67E−20 1.75E−19 EIF2S3X 0.819004525 0.494988864 0.367 3.32E−20 3.39E−19 MRPS33 0.669683258 0.650334076 4.597 9.21E−20 8.60E−19 CNOT3 0.583710407 0.708797327 0.39 2.30E−17 1.43E−16 ELK3 0.592760181 0.706013363 0.263 5.55E−18 3.76E−17 JAK3 0.914027149 0.376948775 0.651 3.66E−21 4.28E−20 IRF5 0.34841629 0.883073497 3.694 1.01E−16 5.61E−16 NFS1 0.470588235 0.800111359 0.864 3.60E−17 2.14E−16 STK24 0.656108597 0.652004454 1.803 1.89E−18 1.38E−17 AGPAT4 0.56561086 0.722717149 0.263 3.80E−17 2.25E−16 FAM162A 0.63800905 0.671492205 2.198 9.69E−19 7.44E−18 NDUFA9 0.71040724 0.621380846 5.242 4.67E−21 5.36E−20 NDUFB7 0.868778281 0.478285078 2.186 2.04E−25 4.95E−24 BRI3BP 0.520361991 0.777839644 2.924 1.87E−19 1.65E−18 DYNLT1C 0.619909502 0.681514477 3.331 5.76E−18 3.90E−17 TMEM173 0.692307692 0.625835189 6.206 1.80E−19 1.59E−18 DPYSL2 0.923076923 0.35467706 0.526 2.84E−20 2.92E−19 LCP1 0.932126697 0.328507795 9.251 4.84E−19 3.93E−18 TIMM8B 0.466063348 0.804565702 3.967 2.60E−17 1.58E−16 ARHGAP18 0.416289593 0.836859688 0.496 1.10E−16 6.03E−16 KLRK1 0.760180995 0.561247216 1.064 4.09E−20 4.07E−19 RAB14 0.728506787 0.58908686 1.824 1.82E−19 1.60E−18 PIGP 0.479638009 0.793986637 1.257 2.77E−17 1.67E−16 SERINC1 0.701357466 0.606904232 2.578 2.31E−18 1.66E−17 UQCRC2 0.79638009 0.543429844 6.406 1.13E−22 1.79E−21 CYFIP1 0.393665158 0.853006682 1.036 1.00E−16 5.55E−16 MFSD1 0.597285068 0.70935412 1.029 7.10E−19 5.56E−18 PPIP5K2 0.475113122 0.793429844 0.111 9.81E−17 5.45E−16 GATAD1 0.547511312 0.739977728 0.485 2.25E−17 1.40E−16 ILK 0.800904977 0.53674833 5.389 1.69E−22 2.63E−21 SNRPA 0.714932127 0.59298441 1.506 2.36E−18 1.69E−17 PHPT1 0.470588235 0.79844098 1.709 6.10E−17 3.47E−16 GLRX 0.755656109 0.588530067 3.046 1.04E−22 1.65E−21 CSTB 0.65158371 0.660356347 1.628 6.39E−19 5.08E−18 MRPS2 0.307692308 0.905345212 4.43 3.63E−16 1.82E−15 RSL24D1 0.71040724 0.596325167 0.986 3.27E−18 2.30E−17 ADAM17 0.533936652 0.752783964 2.124 1.46E−17 9.30E−17 ODC1 0.755656109 0.548997773 1.93 2.95E−18 2.09E−17 DUSP14 0.330316742 0.892538976 5.323 2.30E−16 1.20E−15 MTDH 0.65158371 0.659242762 3.239 8.62E−19 6.64E−18 MRPL33 0.751131222 0.574610245 2.738 1.61E−20 1.70E−19 PSMA4 0.828054299 0.523385301 3.329 1.09E−24 2.30E−23 GPI1 0.954751131 0.295657016 7.555 1.15E−19 1.05E−18 NSUN2 0.556561086 0.731625835 1.876 2.75E−17 1.66E−16 SEC11C 0.900452489 0.408685969 5.759 1.95E−22 3.00E−21 YWHAH 0.886877828 0.451002227 4.974 4.45E−25 1.02E−23 REXO2 0.628959276 0.677616927 2.642 1.77E−18 1.30E−17 LMAN1 0.411764706 0.839643653 1.22 1.28E−16 6.98E−16 LAMTOR5 0.683257919 0.629732739 4.233 6.71E−19 5.30E−18 ANXA4 0.393665158 0.850222717 0.546 2.72E−16 1.41E−15 MRPL17 0.542986425 0.748329621 1.709 5.99E−18 4.04E−17 CERS6 0.334841629 0.888641425 1.287 3.55E−16 1.79E−15 Gene gen_qval rank_hyper_qval rank_gen_qval mean_rank GLDC −85.741 2 1 1.5 TNFRSF9 −74.603 1 2 1.5 PRF1 −70.08 3 3 3 IRF8 −60.58 5 4 4.5 CCRL2 −57.892 7 5 6 PCYT1A −57.84 8 7 7.5 HAVCR2 −51.383 4 11 7.5 LAT2 −57.892 14 6 10 2900026A02RIK −53.112 12 10 11 CSF1 −56.864 16 8 12 ADAM8 −50.88 10 14 12 ITGAV −50.642 11 15 13 TMPRSS6 −53.736 26 9 17.5 ADAMTS14 −49.686 19 16 17.5 C1QTNF6 −51.184 24 12 18 RGS16 −39.659 6 31 18.5 SERPINE2 −51.019 25 13 19 LITAF −41.548 13 25 19 RBPJ −42.315 15 24 19.5 TNFRSF4 −42.493 17 23 20 GPR56 −44.618 23 18 20.5 PGLYRP1 −43.178 21 21 21 HILPDA −41.529 22 26 24 ANXA2 −43.087 28 22 25 PLEK −39.004 18 32 25 LAG3 −36.69 9 42 25.5 RGS8 −47.201 40 17 28.5 NABP1 −38.264 34 35 34.5 GPD2 −40.178 42 29 35.5 SLC37A2 −43.31 52 20 36 IKZF2 −37.446 36 37 36.5 AA467197 −43.648 55 19 37 UBASH3B −35.97 32 44 38 EPAS1 −38.289 49 34 41.5 SERPINB9 −36.781 44 40 42 GAPDH −35.534 37 47 42 CCNG1 −32.322 27 58 42.5 ACOT7 −32.602 30 56 43 BHLHE40 −32.471 29 57 43 TPI1 −32.629 33 55 44 RGS2 −34.658 38 51 44.5 CDK6 −36.931 51 39 45 CXCR6 −29.649 20 71 45.5 MNDA −40.982 65 27 46 GEM −36.705 54 41 47.5 GM5177 −33.888 43 53 48 CST7 −30.448 31 68 49.5 SLC2A3 −36.69 57 43 50 KIT −40.679 73 28 50.5 GZMB −35.205 56 50 53 S100A11 −32.158 46 60 53 IL1R2 −40.178 79 30 54.5 DSCAM −38.384 77 33 55 CCL3 −35.708 64 46 55 FAM3C −31.563 50 63 56.5 CASP3 −28.856 35 80 57.5 NR4A2 −31.351 53 64 58.5 CD244 −37.285 80 38 59 SLC16A11 −38.005 83 36 59.5 DUSP4 −31.906 59 61 60 CAPG −31.567 60 62 61 SAMSN1 −27.927 41 87 64 FAM110A −32.314 70 59 64.5 CIAPIN1 −27.949 45 86 65.5 NRGN −35.762 90 45 67.5 PLAC8 −35.511 87 48 67.5 IMPA2 −30.742 69 66 67.5 SRGAP3 −34.118 84 52 68 FOXRED2 −35.48 88 49 68.5 NRP1 −30.537 71 67 69 ARL14EP −29.195 66 75 70.5 EHD1 −28.975 63 78 70.5 LGALS1 −25.523 39 105 72 MT1 −33.823 91 54 72.5 ERGIC1 −29.048 82 76 79 OSBPL3 −28.093 76 85 80.5 SMIM3 −29.22 89 74 81.5 SERPINA3G −25.966 62 101 81.5 TOX −23.972 47 122 84.5 PKM −29.958 102 69 85.5 CX3CR1 −28.883 95 79 87 ID2 −29 103 77 90 PEX16 −28.699 98 82 90 GPR65 −26.057 81 100 90.5 SEPT11 −24.768 68 117 92.5 NFKB2 −25.366 78 108 93 FDX1 −28.187 106 84 95 ENTPD1 −26.13 99 99 99 BCL2A1D −23.195 72 127 99.5 DNMT3A −25.499 96 106 101 ZMIZ1 −24.896 86 116 101 NRN1 −28.795 124 81 102.5 STAT3 −29.78 136 70 103 CLIC4 −26.3 108 98 103 GDPD5 −29.436 138 72 105 CCR8 −29.292 142 73 107.5 NEDD9 −26.928 122 93 107.5 GSTO1 −25.935 117 102 109.5 PGK1 −25.564 116 104 110 PDCD1 −19.612 48 172 110 UHRF2 −27.41 131 91 111 PLSCR1 −25.165 113 111 112 TIGIT −21.13 75 151 113 ALDOA −27.783 140 88 114 LILRB4 −26.812 134 95 114.5 KLRC1 −22.062 94 135 114.5 TFF1 −30.862 165 65 115 HNRNPA1 −28.44 151 83 117 PTPRS −25.035 123 113 118 1700017B05RIK −23.832 114 124 119 PTPLAD1 −22.786 109 129 119 VAMP8 −20.364 74 164 119 ESD −19.013 61 183 122 GM14295 −22.272 112 134 123 NUCB1 −21.027 92 154 123 TUBB6 −27.679 163 89 126 SH2D2A −21.518 111 142 126.5 RCN1 −27.183 162 92 127 TRPS1 −25.165 143 112 127.5 RPS27L −21.356 110 147 128.5 SH3BGRL −20.969 101 156 128.5 FKBP1A −18.268 58 200 129 AFG3L2 −24.111 154 119 136.5 KDELR2 −21.276 126 148 137 IL2RB −27.616 185 90 137.5 SLC25A4 −18.569 85 190 137.5 LYRM4 −25.643 175 103 139 BCL2L11 −24.04 158 120 139 DUT −17.989 67 211 139 SERPINB6A −23.705 156 125 140.5 RFK −22.062 146 136 141 EEA1 −25.035 173 114 143.5 GALK1 −21.626 153 140 146.5 KLRC2 −20.64 141 161 151 TMBIM4 −21.991 168 137 152.5 PKP4 −22.686 183 130 156.5 RPS26 −19.14 135 181 158 LRRK1 −24.904 203 115 159 GLIPR1 −21.055 166 153 159.5 STK39 −25.214 211 109 160 SERPINA3H −22.871 192 128 160 SLC52A3 −26.78 225 96 160.5 GM5069 −26.822 228 94 161 CCDC50 −21.472 179 144 161.5 ACTG1 −25.203 218 110 164 SLA2 −18.315 130 199 164.5 IL10RA −18.023 120 209 164.5 CENPA −17.723 115 217 166 RUNX2 −20.044 167 167 167 NEK6 −26.34 240 97 168.5 TXN1 −17.362 107 231 169 RPN1 −18.422 148 195 171.5 STARD3NL −18.589 157 189 173 KDM2B −21.433 204 145 174.5 MPHOSPH6 −21.241 202 150 176 IL18RAP −21.027 199 155 177 CLTC −19.944 187 169 178 DEGS1 −17.807 144 214 179 0610007P14RIK −19.986 191 168 179.5 TNFRSF18 −16.98 125 240 182.5 TIPRL −17.608 147 220 183.5 ATXN10 −17.466 145 227 186 SERPINB6B −21.418 227 146 186.5 ISY1 −16.471 105 268 186.5 CMTM7 −16.368 104 273 188.5 SLC16A3 −25.499 271 107 189 ARSB −16.597 121 258 189.5 DDIT4 −22.58 253 131 192 PRELID1 −18.071 181 206 193.5 RBL2 −19.557 215 173 194 HSP90B1 −19.492 217 174 195.5 HMGCR −20.939 237 158 197.5 CETN2 −17.656 178 219 198.5 TWSG1 −23.987 282 121 201.5 COPS4 −16.618 150 256 203 TMEM123 −16.349 128 278 203 PREP −19.715 238 170 204 VPS52 −20.519 251 163 207 NCOR2 −19.689 247 171 209 S100A4 −16.811 169 250 209.5 CALR −18.422 229 196 212.5 RABGAP1L −20.528 268 162 215 UAP1 −21.07 281 152 216.5 PGAM1 −15.989 139 295 217 SERPINA3I −18.496 246 191 218.5 PTGER2 −22.388 308 132 220 COX17 −15.776 132 308 220 BCL2A1B −15.472 119 322 220.5 NAP1L1 −14.871 93 348 220.5 PIGS −16.223 161 284 222.5 SIK1 −16.799 195 252 223.5 FLNB −20.969 294 157 225.5 SEMA6D −24.639 334 118 226 MRPS21 −16.703 200 255 227.5 MAP2K3 −16.349 176 279 227.5 ENO3 −22.303 328 133 230.5 SMARCB1 −17.095 224 238 231 ATXN1 −18.207 263 202 232.5 CDV3 −15.902 164 301 232.5 SMPDL3B −21.964 332 138 235 AI662270 −15.982 174 296 235 SERPINA3F −21.93 333 139 236 PNKD −18.402 276 197 236.5 CISD1 −17.332 243 232 237.5 NCF4 −16.455 206 270 238 PTPN7 −15.868 177 304 240.5 IL12RB2 −23.202 359 126 242.5 PADI2 −16.48 221 266 243.5 ETFB −14.849 137 350 243.5 MED11 −17.51 264 224 244 RAB27A −15.278 160 331 245.5 TYK2 −17.137 262 237 249.5 GABARAPL1 −17.973 290 212 251 CTSC −16.298 223 281 252 AW112010 −16.372 234 272 253 ARL1 −16.038 214 293 253.5 PRDX2 −15.473 186 321 253.5 GNPNAT1 −18.958 330 184 257 SLC39A1 −18.183 311 204 257.5 GM14440 −17.437 288 228 258 CYB5B −16.529 259 262 260.5 ERO1L −19.368 350 175 262.5 NDFIP2 −17.516 302 223 262.5 PGLS −13.831 118 407 262.5 ACSL4 −18.853 340 186 263 FUCA2 −18.882 349 185 267 CD200 −21.601 400 141 270.5 XPNPEP1 −16.861 297 245 271 PLP2 −13.715 129 418 273.5 MT2 −23.836 426 123 274.5 LPIN2 −21.488 408 143 275.5 3830406C13RIK −19.078 371 182 276.5 SSR2 −13.864 152 403 277.5 NDUFS2 −13.502 127 431 279 2700060E02RIK −13.17 100 459 279.5 MTHFD1L −17.233 329 235 282 HIP1 −18.054 357 208 282.5 DYNLT3 −20.33 402 165 283.5 EFHD2 −15.078 233 339 286 TNFSF4 −20.871 414 159 286.5 FARS2 −19.261 398 177 287.5 CST3 −15.102 244 337 290.5 NOL7 −14.987 239 343 291 OXSR1 −19.212 407 179 293 DUSP6 −17.756 370 216 293 SEPT2 −14.651 235 357 296 UTF1 −21.255 447 149 298 ENO1 −19.242 418 178 298 MTMR1 −16.458 327 269 298 DCTN5 −14.969 252 344 298 PDCL3 −16.187 315 286 300.5 DDB1 −13.99 210 392 301 HDAC1 −14.043 220 386 303 SREBF2 −16.921 367 241 304 COMMD3 −15.961 310 298 304 GM9855 −17.276 385 233 309 CTSB −13.17 159 460 309.5 SIVA1 −16.842 373 248 310.5 COX7B −13.303 172 449 310.5 BEND4 −15.651 321 312 316.5 CBLB −14.327 265 368 316.5 ANKRD39 −18.44 443 193 318 KARS −13.425 198 438 318 LXN −18.233 437 201 319 D16ERTD472E −13.828 230 409 319.5 SPCS3 −16.349 363 280 321.5 TPM4 −13.413 205 440 322.5 CHST12 −16.596 387 259 323 ACOT9 −15.211 312 335 323.5 METAP2 −13.618 226 424 325 LAP3 −18.741 465 187 326 FUBP1 −14.855 307 349 328 TANK −17.063 419 239 329 MNF1 −16.808 411 251 331 GM12669 −14.119 283 380 331.5 ST14 −19.188 489 180 334.5 IPO7 −18.429 478 194 336 TARS −15.468 348 324 336 SLC25A17 −16.218 389 285 337 PFKL −15.05 339 340 339.5 TMBIM1 −18.339 492 198 345 CCT3 −12.015 133 559 346 OS9 −13.34 249 444 346.5 CALM3 −12.592 189 504 346.5 DAPK2 −17.678 477 218 347.5 SIL1 −19.348 526 176 351 GTF2E2 −16.707 448 254 351 CANX −13.839 298 406 352 NDUFA11 −13.536 277 427 352 UBE2N −13.808 296 410 353 BAX −13.004 236 473 354.5 IFRD1 −14.579 352 361 356.5 SDCBP2 −20.683 555 160 357.5 BIRC2 −16.549 456 260 358 MARC2 −12.853 231 485 358 RABGGTB −15.695 410 311 360.5 QDPR −14.657 366 356 361 LAMTOR4 −14.154 345 378 361.5 USMG5 −12.516 208 515 361.5 CUEDC2 −16.101 435 289 362 TSSC1 −16.02 431 294 362.5 GNB1 −13.733 309 416 362.5 TMEM254B −13.326 284 445 364.5 CTLA4 −11.36 97 632 364.5 RILPL2 −13.577 305 426 365.5 WDR61 −16.362 458 274 366 SPRY2 −18.137 528 205 366.5 XPOT −17.777 520 215 367.5 INF2 −18.451 544 192 368 GLUD1 −13.988 342 394 368 HCCS −17.495 511 226 368.5 ACTR10 −12.403 213 524 368.5 ITGB1BP1 −14.84 388 351 369.5 BSG −13.243 286 453 369.5 LIMSI −13.109 278 465 371.5 BCAP29 −16.406 473 271 372 FARP1 −17.401 519 230 374.5 DGAT1 −15.472 427 323 375 MMD −15.295 422 330 376 SSR3 −15.008 412 342 377 RHOF −13.472 323 433 378 ZBTB32 −18.611 570 188 379 VDAC3 −13.233 304 454 379 SMS −14.095 380 381 380.5 AKR1A1 −12.587 258 505 381.5 ACTN1 −16.472 498 267 382.5 ATP6V0B −14.244 397 371 384 PTK2B −14.567 409 362 385.5 REEP5 −11.423 155 618 386.5 CREM −13.17 314 461 387.5 HK1 −16.255 495 283 389 EIF1AX −13.883 377 401 389 RAP1A −13.689 358 420 389 SEC61G −12.302 242 536 389 SAR1B −14.438 415 365 390 RNH1 −13.101 316 467 391.5 BMYC −18.196 581 203 392 TMEM256 −15.827 481 306 393.5 NHP2 −13.062 318 471 394.5 TMEM135 −16.86 545 246 395.5 OTUB1 −12.63 293 499 396 MEA1 −13.176 336 458 397 SSBP1 −13.843 390 405 397.5 CYP51 −16.602 539 257 398 DCTN2 −13.445 362 436 399 TXNDC17 −12.67 303 496 399.5 PHB −13.17 338 462 400 CISD3 −16.105 515 288 401.5 SDF4 −12.513 287 516 401.5 ETOHI1 −17.157 572 236 404 LDHA −20.115 643 166 404.5 UQCR11 −14.167 433 376 404.5 MVP −16.541 549 261 405 DENND4A −15.873 509 303 406 DNAJC1 −15.39 487 325 406 RAB8B −13.365 372 442 407 ABHD4 −16.901 575 242 408.5 PLK2 −17.608 600 221 410.5 MIF −15.258 490 332 411 FBXW11 −16.351 552 277 414.5 SLC25A3 −15.605 514 315 414.5 XDH −16.526 567 263 415 MLF2 −13.226 375 456 415.5 MRPL40 −12.54 322 514 418 PDIA4 −14.183 464 375 419.5 CD200R1 −17.97 627 213 420 GUK1 −14.688 488 354 421 OSTF1 −16.818 594 249 421.5 9530068E07RIK −12.556 351 507 429 RAC1 −11.928 289 570 429.5 PLEKHB2 −11.492 250 609 429.5 DNAJB4 −17.561 638 222 430 IL21R −14.583 500 360 430 SSR4 −10.771 149 712 430.5 SMYD5 −18.019 652 210 431 IQSEC1 −15.713 554 310 432 STX11 −16.858 620 247 433.5 GGH −16.107 583 287 435 ATPIF1 −12.554 360 510 435 IDI1 −18.065 665 207 436 CNIH −14.217 499 373 436 NAPSA −17.416 646 229 437.5 BCL2A1C −14.621 518 359 438.5 COMT −11.528 272 605 438.5 APRT −11.831 300 578 439 ATP10A −16.799 629 253 441 ECH1 −11.212 232 650 441 SEPHS2 −15.315 556 328 442 GLRX3 −12.555 381 508 444.5 FDPS −14.722 543 353 448 RNPEP −13.896 496 400 448 TFG −14.035 512 387 449.5 TNFRSF1B −10.995 212 687 449.5 YWHAE −12.026 343 558 450.5 GNG2 −13.659 482 422 452 TRPV2 −13.709 486 419 452.5 HSP90AB1 −16.101 618 290 454 XBP1 −13.808 497 411 454 MRPS36 −13.853 505 404 454.5 STRAP −12.345 379 530 454.5 EIF4E −12.983 436 474 455 MXI1 −17.254 679 234 456.5 ECE1 −16.498 648 265 456.5 GM17745 −17.498 689 225 457 CHCHD10 −15.187 580 336 458 BIN1 −11.382 295 623 459 TDG −16.362 649 275 462 TMEM30A −15.306 596 329 462.5 ACP1 −13.396 485 441 463 PFDN1 −13.078 457 469 463 SEPT9 −11.881 355 575 465 PSMB4 −10.579 184 746 465 PA2G4 −12.943 454 477 465.5 P4HB −10.729 216 718 467 CCDC6 −14.167 561 377 469 BC004004 −12.722 446 493 469.5 COPS6 −11.122 274 665 469.5 SLC25A11 −11.666 353 588 470.5 IGBP1 −11.378 317 626 471.5 SSR1 −11.611 346 598 472 TRAF4 −15.968 650 297 473.5 HSD17B12 −15.594 631 317 474 COX6C −10.522 190 758 474 RIOK1 −14.086 569 383 476 RNASEK −11.025 275 680 477.5 SYTL2 −16.283 674 282 478 ORMDL1 −14.009 568 388 478 FXR1 −14.748 605 352 478.5 UGP2 −15.839 653 305 479 PTMS −14.634 602 358 480 LAMP2 −14.908 617 347 482 HSPD1 −12.229 432 538 485 HSBP1 −11.562 368 602 485 PDIA3 −11.136 313 660 486.5 ITFG1 −14.66 619 355 487 PERP −16.896 735 244 489.5 EXT2 −13.946 582 397 489.5 TRAF1 −11.745 401 581 491 NDUFB8 −10.949 292 691 491.5 TCP1 −10.352 201 782 491.5 NFKBIE −14.917 639 346 492.5 HIF1A −11.55 384 603 493.5 ATP5G1 −10.995 299 688 493.5 PLEKHO2 −15.604 672 316 494 SIN3B −10.781 280 710 495 EDF1 −10.298 209 787 498 PRDX1 −10.269 207 790 498.5 VPS35 −13.455 565 434 499.5 RFC2 −11.507 395 606 500.5 EIF2S3X −11.607 405 599 502 MRPS33 −11.993 444 562 503 CNOT3 −15.029 669 341 505 ELK3 −13.924 612 398 505 JAK3 −11.151 354 657 505.5 IRF5 −16.505 750 264 507 NFS1 −15.516 698 320 509 STK24 −13.25 566 452 509 AGPAT4 −15.531 701 319 510 FAM162A −12.924 540 480 510 NDUFA9 −11.14 361 659 510 NDUFB7 −10.011 171 854 512.5 BRI3BP −12.044 472 556 514 DYNLT1C −13.725 613 417 515 TMEM173 −11.951 469 566 517.5 DPYSL2 −11.329 403 635 519 LCP1 −12.345 510 531 520.5 TIMM8B −14.459 682 364 523 ARHGAP18 −16.043 756 292 524 KLRK1 −11.367 417 631 524 RAB14 −11.771 470 579 524.5 PIGP −14.466 687 363 525 SERINC1 −13.057 578 472 525 UQCRC2 −10.287 261 789 525 CYFIP1 −15.898 749 302 525.5 MFSD1 −12.419 529 522 525.5 PPIP5K2 −15.815 747 307 527 GATAD1 −13.999 667 390 528.5 ILK −10.267 266 791 528.5 SNRPA −12.937 579 479 529 PHPT1 −15.224 728 334 531 GLRX −10.201 260 803 531.5 CSTB −12.185 522 542 532 MRPS2 −16.9 824 243 533.5 RSL24D1 −12.943 589 478 533.5 ADAM17 −13.689 647 421 534 ODC1 −12.707 584 494 539 DUSP14 −16.063 791 291 541 MTDH −12.105 538 550 544 MRPL33 −10.843 392 701 546.5 PSMA4 −9.744 196 897 546.5 GPI1 −11.256 451 645 548 NSUN2 −13.79 686 412 549 SEC11C −10.105 270 830 550 YWHAH −9.634 180 921 550.5 REXO2 −12.204 562 541 551.5 LMAN1 −14.937 761 345 553 LAMTOR5 −11.701 525 584 554.5 ANXA4 −15.638 797 313 555 MRPL17 −12.621 615 500 557.5 CERS6 −15.916 822 300 561
TABLE-US-00004 TABLE 2 Ranked top transcription factors differentially expressed in cluster 7 Gene TP TN thresh_mhg hyper_pval hyper_qval gen_qval rank_hyper_qval rank_gen_qval mean_rank IRF8 0.886877828 0.663697105 1.501 4.18E−58 1.63E−55 −60.58 1 1 1 RBPJ 0.873303167 0.632516704 2.763 4.56E−49 5.93E−47 −42.315 3 2 2.5 LITAF 0.936651584 0.551224944 5.893 1.35E−49 2.64E−47 −41.548 2 3 2.5 IKZF2 0.719457014 0.737193764 0.084 6.49E−40 5.06E−38 −37.446 5 6 5.5 BHLHE40 0.977375566 0.422048998 6.796 6.69E−41 6.53E−39 −32.471 4 7 5.5 EPAS1 0.529411765 0.863585746 0.986 5.63E−37 3.14E−35 −38.289 7 5 6 MNDA 0.470588235 0.889755011 4.02 1.12E−34 4.86E−33 −40.982 9 4 6.5 NR4A2 0.914027149 0.498886414 0.595 2.62E−36 1.28E−34 −31.351 8 8 8 TOX 0.904977376 0.520044543 3.455 1.76E−37 1.14E−35 −23.972 6 15 10.5 ID2 0.972850679 0.341314031 4.705 6.02E−29 1.96E−27 −29 12 10 11 NFKB2 0.846153846 0.561804009 2.359 1.52E−32 5.92E−31 −25.366 10 12 11 STAT3 0.909502262 0.43596882 6.143 3.70E−27 1.03E−25 −29.78 14 9 11.5 UHRF2 0.542986425 0.809576837 0.971 2.48E−27 7.44E−26 −27.41 13 11 12 ZMIZ1 0.751131222 0.655345212 0.214 4.47E−31 1.58E−29 −24.896 11 14 12.5 TRPS1 0.511312217 0.829064588 0.986 9.50E−27 2.47E−25 −25.165 15 13 14 KDM2B 0.678733032 0.677616927 0.88 2.60E−24 5.97E−23 −21.433 17 16 16.5 RUNX2 0.78280543 0.582962138 1.546 1.20E−25 2.92E−24 −20.044 16 18 17 RBL2 0.832579186 0.511135857 0.239 6.99E−24 1.43E−22 −19.557 19 20 19.5 NCOR2 0.656108597 0.688752784 0.239 5.32E−23 9.02E−22 −19.689 23 19 21 CALR 0.923076923 0.384187082 2.844 1.64E−23 2.91E−22 −18.422 22 22 22 SMARCB1 0.65158371 0.698218263 4.752 9.93E−24 1.84E−22 −17.095 21 26 23.5 UTF1 0.330316742 0.909242762 4.976 1.01E−19 1.17E−18 −21.255 34 17 25.5 SREBF2 0.733031674 0.597438753 0.138 5.92E−21 7.97E−20 −16.921 29 27 28 COMMD3 0.733031674 0.60467706 3.134 8.29E−22 1.24E−20 −15.961 26 30 28 HDAC1 0.837104072 0.505011136 2.214 8.21E−24 1.60E−22 −14.043 20 36 28 FUBP1 0.733031674 0.605233853 0.31 7.11E−22 1.11E−20 −14.855 25 35 30 GTF2E2 0.533936652 0.768930958 1.546 1.02E−19 1.17E−18 −16.707 33 28 30.5 SPRY2 0.533936652 0.762806236 0.872 7.08E−19 6.91E−18 −18.137 40 23 31.5 ZBTB32 0.43438914 0.83518931 1.084 2.09E−18 1.89E−17 −18.611 43 21 32 DENND4A 0.886877828 0.396436526 0.124 4.72E−19 4.72E−18 −15.873 39 31 35 CREM 0.678733032 0.658129176 2.531 9.14E−22 1.32E−20 −13.17 27 44 35.5 SMYD5 0.352941176 0.884743875 1.157 1.54E−17 1.25E−16 −18.019 48 24 36 PHB 0.787330317 0.542873051 2.43 1.99E−21 2.77E−20 −13.17 28 45 36.5 MXI1 0.371040724 0.871937639 0.669 2.46E−17 1.88E−16 −17.254 51 25 38 XBP1 0.619909502 0.691536748 0.401 3.69E−19 3.78E−18 −13.808 38 39 38.5 NFKBIE 0.470588235 0.804008909 0.911 1.02E−17 8.49E−17 −14.917 47 34 40.5 CNOT3 0.583710407 0.708797327 0.39 2.30E−17 1.79E−16 −15.029 50 33 41.5 PFDN1 0.619909502 0.694877506 3.848 1.43E−19 1.55E−18 −13.078 36 47 41.5 PA2G4 0.787330317 0.526726058 2.995 1.22E−19 1.36E−18 −12.943 35 48 41.5 ELK3 0.592760181 0.706013363 0.263 5.55E−18 4.71E−17 −13.924 46 38 42 IRF5 0.34841629 0.883073497 3.694 1.01E−16 7.06E−16 −16.505 56 29 42.5 GATAD1 0.547511312 0.739977728 0.485 2.25E−17 1.79E−16 −13.999 49 37 43 EDF1 0.936651584 0.36636971 6.946 5.63E−24 1.22E−22 −10.298 18 71 44.5 HSBP1 0.746606335 0.582962138 0.856 6.34E−21 8.24E−20 −11.562 30 60 45 HIF1A 0.800904977 0.521158129 4.03 9.86E−21 1.24E−19 −11.55 31 61 46 HIVEP1 0.561085973 0.723830735 0.151 8.15E−17 5.78E−16 −13.609 54 41 47.5 SMYD2 0.393665158 0.847995546 0.623 5.95E−16 3.57E−15 −15.744 65 32 48.5 HTATIP2 0.533936652 0.743875278 0.748 1.86E−16 1.25E−15 −13.747 58 40 49 MORF4L2 0.656108597 0.648106904 2.157 5.22E−18 4.53E−17 −12.013 45 57 51 TBX21 0.628959276 0.66481069 5.5 5.13E−17 3.85E−16 −12.289 52 52 52 MED7 0.457013575 0.802895323 1.536 3.88E−16 2.40E−15 −13.313 63 43 53 C1D 0.601809955 0.688195991 0.516 7.59E−17 5.58E−16 −12.182 53 54 53.5 TMF1 0.701357466 0.592427617 0.202 8.04E−17 5.78E−16 −12.152 55 55 55 CSDA 0.570135747 0.707126949 0.926 8.49E−16 4.94E−15 −12.863 67 49 58 MED14 0.50678733 0.753340757 0.151 6.71E−15 3.44E−14 −13.341 76 42 59 NFAT5 0.592760181 0.683184855 0.124 2.17E−15 1.17E−14 −12.415 72 51 61.5 IKZF3 0.846153846 0.448218263 0.287 8.29E−19 7.89E−18 −8.956 41 84 62.5 GNPTAB 0.479638009 0.772828508 0.275 1.39E−14 6.79E−14 −13.104 80 46 63 NFIL3 0.398190045 0.83908686 3.536 4.07E−15 2.17E−14 −12.098 73 56 64.5 MYEF2 0.547511312 0.718262806 0.454 7.72E−15 3.91E−14 −12.214 77 53 65 PHB2 0.819004525 0.486636971 2.284 2.58E−19 2.72E−18 −8.162 37 93 65 ZRANB2 0.497737557 0.761135857 1.227 6.12E−15 3.18E−14 −11.704 75 58 66.5 NT5C 0.819004525 0.494988864 4.353 3.32E−20 4.05E−19 −7.857 32 101 66.5 ZMAT2 0.647058824 0.640868597 3.444 2.83E−16 1.84E−15 −9.591 60 79 69.5 RNF14 0.502262443 0.754454343 0.465 1.35E−14 6.68E−14 −11.308 79 65 72 ZC3H15 0.755656109 0.528953229 1.208 3.20E−16 2.05E−15 −9.211 61 83 72 COPS2 0.50678733 0.748329621 0.918 2.52E−14 1.20E−13 −11.369 82 64 73 NFKBIB 0.7239819 0.559576837 1 7.08E−16 4.19E−15 −9.252 66 82 74 PPIE 0.552036199 0.722717149 4.715 8.90E−16 5.10E−15 −9.543 68 81 74.5 TFDP1 0.502262443 0.751113586 1.401 3.25E−14 1.51E−13 −11.08 84 67 75.5 NR4A3 0.583710407 0.683184855 0.678 1.59E−14 7.67E−14 −10.379 81 70 75.5 YAF2 0.334841629 0.871937639 4.538 1.85E−13 7.68E−13 −11.498 94 62 78 FUBP3 0.398190045 0.820712695 0.604 1.08E−12 3.94E−12 −12.6 107 50 78.5 AEBP2 0.56561086 0.695434298 0.111 4.19E−14 1.83E−13 −10.681 89 68 78.5 TSG101 0.642533937 0.625835189 0.766 2.63E−14 1.24E−13 −10.099 83 74 78.5 GTF2E1 0.334841629 0.868596882 2.88 5.70E−13 2.18E−12 −11.665 102 59 80.5 PHF15 0.475113122 0.765033408 0.444 2.90E−13 1.17E−12 −11.133 97 66 81.5 SND1 0.597285068 0.667037862 3.206 3.82E−14 1.73E−13 −9.617 86 78 82 RBX1 0.805429864 0.496659243 4.931 1.13E−18 1.05E−17 −6.842 42 122 82 TCERG1 0.583710407 0.668151448 0.287 5.07E−13 1.98E−12 −10.298 100 72 86 MYBBP1A 0.63800905 0.623051225 0.791 1.28E−13 5.44E−13 −9.591 92 80 86 FOSL2 0.647058824 0.620267261 3.109 3.42E−14 1.57E−13 −8.551 85 88 86.5 SKIL 0.864253394 0.391982183 0.202 1.37E−15 7.65E−15 −7.736 70 104 87 VAMP7 0.411764706 0.807349666 1.531 2.45E−12 8.37E−12 −11.4 114 63 88.5 CAND1 0.475113122 0.757238307 0.189 2.03E−12 7.00E−12 −10.627 113 69 91 NDUFA13 0.972850679 0.288975501 4.019 8.55E−23 1.39E−21 −5.73 24 160 92 SSRP1 0.737556561 0.526726058 1.632 3.85E−14 1.73E−13 −7.942 87 99 93 STAT4 0.823529412 0.45545657 4.008 1.04E−16 7.09E−16 −6.4 57 132 94.5 SARNP 0.773755656 0.506124722 3.952 5.80E−16 3.53E−15 −6.629 64 126 95 KEAP1 0.457013575 0.771158129 0.356 2.58E−12 8.68E−12 −9.681 116 77 96.5 FLI1 0.791855204 0.448775056 0.275 1.15E−12 4.15E−12 −8.951 108 85 96.5 BTF3 0.941176471 0.279510022 9.346 1.26E−15 7.10E−15 −6.717 69 124 96.5 GTF2H5 0.619909502 0.635300668 1.459 3.95E−13 1.56E−12 −8.07 99 96 97.5 RUVBL2 0.497737557 0.739420935 2.441 1.53E−12 5.42E−12 −8.425 110 91 100.5 PRDM1 0.34841629 0.849109131 2.993 1.22E−11 3.74E−11 −10.067 127 75 101 DDX54 0.610859729 0.63752784 0.379 1.55E−12 5.44E−12 −8.125 111 94 102.5 RUNX3 0.791855204 0.457126949 0.926 2.21E−13 8.99E−13 −7.477 96 109 102.5 CCNT2 0.470588235 0.756124722 1.903 6.54E−12 2.13E−11 −8.809 120 87 103.5 FLII 0.669683258 0.58518931 2.915 5.12E−13 1.98E−12 −7.567 101 107 104 SMARCC2 0.642533937 0.609131403 0.214 9.69E−13 3.56E−12 −7.738 106 103 104.5 HCLS1 0.904977376 0.36247216 4.471 3.12E−18 2.76E−17 −5.668 44 165 104.5 ARNT 0.447963801 0.766703786 0.31 4.45E−11 1.27E−10 −9.974 136 76 106 MLX 0.50678733 0.724387528 0.722 8.18E−12 2.57E−11 −8.452 124 89 106.5 MKI67IP 0.466063348 0.755011136 0.566 2.05E−11 6.20E−11 −8.911 129 86 107.5 ERH 0.873303167 0.388641425 5.282 2.03E−16 1.34E−15 −5.735 59 157 108 ZBTB1 0.402714932 0.799554566 0.367 1.09E−10 2.94E−10 −10.1 144 73 108.5 MED28 0.778280543 0.486636971 0.333 1.29E−14 6.45E−14 −6.088 78 139 108.5 HMGB3 0.457013575 0.760022272 0.444 3.68E−11 1.09E−10 −8.432 132 90 111 RARA 0.438914027 0.776169265 0.566 2.76E−11 8.27E−11 −8.247 130 92 111 RUVBL1 0.520361991 0.704899777 0.485 4.26E−11 1.23E−10 −8.11 135 95 115 KDM5C 0.574660633 0.65701559 0.444 3.14E−11 9.34E−11 −7.773 131 102 116.5 IRF2 0.678733032 0.573496659 0.356 8.58E−13 3.19E−12 −6.591 105 128 116.5 YBX1 0.760180995 0.463808463 0.029 6.17E−11 1.72E−10 −7.488 140 108 124 MAX 0.515837104 0.706570156 1.138 6.96E−11 1.93E−10 −7.405 141 110 125.5 POLR1E 0.2760181 0.889198218 5.21 3.11E−10 7.78E−10 −8.022 156 97 126.5 BOLA2 0.520361991 0.703786192 2.444 5.38E−11 1.52E−10 −7.054 138 116 127 AES 0.683257919 0.545100223 0.422 8.39E−11 2.29E−10 −7.207 143 114 128.5 GTF3A 0.592760181 0.646993318 0.848 7.65E−12 2.43E−11 −6.216 122 135 128.5 GTF2F1 0.642533937 0.599665924 3.216 6.63E−12 2.14E−11 −6.206 121 136 128.5 LRRFIP1 0.895927602 0.330734967 1.632 5.98E−14 2.59E−13 −5.435 90 170 130 RPL7L1 0.529411765 0.704899777 3.505 7.60E−12 2.43E−11 −5.987 123 140 131.5 RNF166 0.601809955 0.630289532 3.454 3.90E−11 1.14E−10 −6.417 133 131 132 CBX3 0.986425339 0.185412027 1.07 5.34E−15 2.81E−14 −4.911 74 191 132.5 GTF2B 0.588235294 0.642538976 1.86 4.44E−11 1.27E−10 −6.586 137 129 133 ZBTB17 0.343891403 0.841314031 4.305 2.64E−10 6.70E−10 −7.265 154 113 133.5 PLAGL2 0.380090498 0.80623608 0.506 1.54E−09 3.56E−09 −7.878 169 100 134.5 MED17 0.384615385 0.808463252 2.128 3.96E−10 9.78E−10 −7.307 158 111 134.5 TBPL1 0.511312217 0.706013363 0.401 1.79E−10 4.71E−10 −6.725 148 123 135.5 REL 0.574660633 0.645879733 0.506 2.77E−10 6.97E−10 −7.026 155 117 136 MORF4L1 0.850678733 0.393652561 3.668 4.01E−14 1.78E−13 −5.141 88 184 136 ARID5B 0.484162896 0.718819599 0.367 1.67E−09 3.83E−09 −7.671 170 106 138 DR1 0.461538462 0.742761693 0.864 6.95E−10 1.64E−09 −7.307 165 112 138.5 HCFC1 0.683257919 0.563474388 0.731 2.53E−12 8.59E−12 −5.699 115 163 139 RNPS1 0.778280543 0.471046771 0.748 3.16E−13 1.26E−12 −5.239 98 180 139 MED24 0.411764706 0.776726058 0.31 3.60E−09 7.83E−09 −7.686 179 105 142 TOX4 0.574660633 0.659799555 2.004 1.78E−11 5.44E−11 −5.76 128 156 142 FUS 0.737556561 0.503340757 1.556 4.21E−12 1.39E−11 −5.641 118 166 142 SMARCA5 0.42081448 0.772828508 0.444 1.68E−09 3.83E−09 −7.181 171 115 143 CNOT8 0.561085973 0.662583519 0.322 1.27E−10 3.38E−10 −5.879 147 145 146 DEK 0.823529412 0.420935412 0.422 1.58E−13 6.64E−13 −4.677 93 202 147.5 LZTR1 0.371040724 0.801224944 0.496 2.27E−08 4.39E−08 −7.993 202 98 150 BAZ1A 0.497737557 0.702672606 0.379 3.69E−09 7.97E−09 −6.864 180 120 150 VGLL4 0.633484163 0.589643653 1.454 2.47E−10 6.34E−10 −5.836 152 149 150.5 PURB 0.547511312 0.654231626 0.176 6.32E−09 1.33E−08 −6.933 186 119 152.5 SUB1 0.972850679 0.198775056 4.258 2.15E−13 8.83E−13 −4.325 95 210 152.5 SQSTM1 0.932126697 0.275055679 7.008 8.09E−14 3.47E−13 −4.191 91 218 154.5 FOXN3 0.484162896 0.714365256 0.367 3.95E−09 8.46E−09 −6.397 182 133 157.5 PTTG1 0.669683258 0.580734967 4.849 1.28E−12 4.56E−12 −4.408 109 209 159 DEDD 0.416289593 0.763919822 0.356 2.24E−08 4.35E−08 −7.023 201 118 159.5 TARDBP 0.63800905 0.594654788 0.556 4.20E−11 1.22E−10 −5.107 134 185 159.5 CDC5L 0.520361991 0.684855234 3.622 2.28E−09 5.09E−09 −5.844 175 147 161 SMARCE1 0.719457014 0.5077951 0.832 7.11E−11 1.95E−10 −5.182 142 182 162 NOTCH2 0.714932127 0.500556793 0.202 6.02E−10 1.44E−09 −5.706 163 162 162.5 UBTF 0.57918552 0.638084633 1.526 5.36E−10 1.30E−09 −5.679 161 164 162.5 CNOT7 0.479638009 0.719933185 1.891 2.91E−09 6.45E−09 −5.83 176 150 163 RELB 0.497737557 0.699888641 0.444 6.19E−09 1.31E−08 −5.947 185 142 163.5 RLIM 0.696832579 0.522828508 0.731 3.57E−10 8.86E−10 −5.428 157 171 164 GTF3C1 0.533936652 0.669821826 0.098 3.70E−09 7.97E−09 −5.839 181 148 164.5 DTX3 0.416289593 0.761135857 0.345 3.83E−08 7.29E−08 −6.681 205 125 165 PSMC3 0.841628959 0.427616927 1.655 3.41E−16 2.14E−15 −3.255 62 268 165 CCNH 0.50678733 0.69766147 1.151 2.06E−09 4.61E−09 −5.732 174 158 166 STAT5A 0.606334842 0.60467706 0.014 1.99E−09 4.49E−09 −5.721 173 161 167 GTF2F2 0.461538462 0.719376392 0.993 6.16E−08 1.14E−07 −6.629 210 127 168.5 HMG20B 0.479638009 0.703786192 0.687 5.63E−08 1.05E−07 −6.421 208 130 169 BCLAF1 0.678733032 0.535634744 0.379 1.03E−09 2.42E−09 −5.391 166 173 169.5 CNOT1 0.624434389 0.599665924 0.151 2.03E−10 5.30E−10 −4.943 149 190 169.5 NFATC1 0.85520362 0.373051225 0.475 7.80E−13 2.93E−12 −3.762 104 235 169.5 VPS72 0.511312217 0.687082405 1.269 6.87E−09 1.42E−08 −5.822 189 151 170 MTA2 0.841628959 0.386414254 0.651 1.69E−12 5.89E−12 −3.939 112 229 170.5 ECD 0.488687783 0.703786192 0.151 1.34E−08 2.63E−08 −5.915 198 144 171 MBD1 0.352941176 0.804565702 0.367 2.25E−07 3.96E−07 −6.864 222 121 171.5 NMI 0.65158371 0.575723831 0.864 1.15E−10 3.10E−10 −4.687 145 201 173 KAT5 0.375565611 0.790089087 0.379 1.02E−07 1.87E−07 −6.288 213 134 173.5 E2F4 0.429864253 0.747772829 0.465 5.35E−08 1.01E−07 −5.982 207 141 174 COPS5 0.502262443 0.702115813 3.004 1.90E−09 4.31E−09 −5.288 172 178 175 CBX4 0.407239819 0.764476615 0.138 8.67E−08 1.60E−07 −5.935 212 143 177.5 TCEA1 0.787330317 0.424832962 0.623 2.51E−10 6.41E−10 −4.522 153 206 179.5 TSC22D4 0.647058824 0.576280624 2.632 2.39E−10 6.17E−10 −4.423 151 208 179.5 TARBP2 0.357466063 0.803452116 0.941 1.36E−07 2.47E−07 −5.877 215 146 180.5 NFKBIA 0.923076923 0.30623608 5.781 2.11E−15 1.16E−14 −2.701 71 292 181.5 RNF4 0.705882353 0.516146993 3.663 2.14E−10 5.57E−10 −4.246 150 215 182.5 GTF2H2 0.343891403 0.81013363 0.848 3.19E−07 5.46E−07 −6.141 228 138 183 RBBP4 0.79638009 0.432071269 0.202 1.01E−11 3.14E−11 −3.694 125 241 183 UBXN4 0.56561086 0.649777283 3.402 6.58E−10 1.57E−09 −4.587 164 204 184 DPF2 0.583710407 0.619710468 0.782 6.55E−09 1.37E−08 −5.145 187 183 185 EGR1 0.597285068 0.609131403 1.485 4.23E−09 9.02E−09 −4.95 183 189 186 ZFPL1 0.321266968 0.830734967 1.043 1.92E−07 3.41E−07 −5.793 219 154 186.5 SERTAD2 0.470588235 0.704899777 0.202 1.85E−07 3.31E−07 −5.773 218 155 186.5 UBE2K 0.601809955 0.605790646 0.566 3.53E−09 7.73E−09 −4.757 178 198 188 HDAC3 0.524886878 0.662026726 0.475 6.10E−08 1.14E−07 −5.502 209 168 188.5 ATF6B 0.443438914 0.727728285 0.299 2.30E−07 4.03E−07 −5.731 223 159 191 ANAPC11 0.556561086 0.644766147 1.795 7.50E−09 1.54E−08 −4.786 190 195 192.5 EYA3 0.343891403 0.807906459 0.275 4.91E−07 8.21E−07 −5.802 233 153 193 UTP6 0.34841629 0.797884187 0.202 1.57E−06 2.44E−06 −6.145 251 137 194 ZHX1 0.343891403 0.80623608 0.322 6.73E−07 1.10E−06 −5.822 239 152 195.5 SCAP 0.357466063 0.799554566 0.151 2.91E−07 5.01E−07 −5.584 226 167 196.5 MED27 0.393665158 0.772271715 0.757 1.71E−07 3.08E−07 −5.315 217 177 197 TCF25 0.850678733 0.343541203 0.39 5.43E−10 1.31E−09 −3.774 162 233 197.5 CCNT1 0.457013575 0.712138085 0.556 4.17E−07 7.07E−07 −5.456 230 169 199.5 MED15 0.570135747 0.628619154 2.667 1.31E−08 2.60E−08 −4.651 197 203 200 NPM1 0.932126697 0.232182628 9.342 4.25E−10 1.04E−09 −3.692 160 242 201 NR1H2 0.642533937 0.560690423 1.475 7.76E−09 1.59E−08 −4.264 191 212 201.5 PHRF1 0.488687783 0.68596882 0.263 2.81E−07 4.87E−07 −5.248 225 179 202 EIF3H 0.986425339 0.152004454 7.886 1.07E−11 3.30E−11 −2.924 126 280 203 TFAM 0.384615385 0.774498886 0.227 4.58E−07 7.70E−07 −5.33 232 176 204 AIP 0.674208145 0.545657016 1.501 4.08E−10 1.00E−09 −3.528 159 250 204.5 ATF1 0.429864253 0.739420935 0.39 2.38E−07 4.15E−07 −5.067 224 187 205.5 GLRX2 0.402714932 0.778953229 3.191 1.07E−08 2.14E−08 −4.243 195 216 205.5 NR3C1 0.452488688 0.719933185 0.138 2.23E−07 3.93E−07 −4.898 221 192 206.5 CHD4 0.746606335 0.450445434 0.202 7.90E−09 1.61E−08 −4.171 192 222 207 KAT2A 0.321266968 0.824053452 0.506 7.40E−07 1.20E−06 −5.388 241 174 207.5 TBC1D2B 0.380090498 0.776726058 0.239 6.08E−07 1.00E−06 −5.218 237 181 209 TBL1XR1 0.461538462 0.720489978 1.373 5.06E−08 9.57E−08 −4.261 206 213 209.5 SMARCA4 0.65158371 0.55233853 0.202 6.78E−09 1.41E−08 −3.872 188 231 209.5 RELA 0.592760181 0.609131403 4.227 8.94E−09 1.81E−08 −3.943 193 228 210.5 TWISTNB 0.429864253 0.734966592 0.465 5.08E−07 8.47E−07 −5.026 234 188 211 KDM6A 0.407239819 0.747772829 0.227 1.60E−06 2.47E−06 −5.406 252 172 212 PHF5A 0.556561086 0.643095768 4.788 1.00E−08 2.01E−08 −3.898 194 230 212 YEATS4 0.466063348 0.706013363 0.895 3.01E−07 5.18E−07 −4.713 227 199 213 NONO 0.923076923 0.270044543 1.417 4.07E−12 1.36E−11 −2.279 117 310 213.5 GABPA 0.42081448 0.740534521 0.227 7.51E−07 1.21E−06 −5.096 242 186 214 SNW1 0.63800905 0.557906459 0.687 2.55E−08 4.89E−08 −4.059 203 225 214 PBXIP1 0.683257919 0.530066815 0.189 1.20E−09 2.79E−09 −3.361 167 261 214 CREB3 0.343891403 0.800111359 0.39 2.06E−06 3.12E−06 −5.382 257 175 216 RNF125 0.570135747 0.618596882 1.911 6.79E−08 1.26E−07 −4.176 211 221 216 ZBTB7A 0.50678733 0.661469933 0.163 9.46E−07 1.51E−06 −4.85 244 193 218.5 HES6 0.307692308 0.832405345 0.66 1.20E−06 1.91E−06 −4.822 245 194 219.5 SBDS 0.561085973 0.635300668 1.084 1.82E−08 3.55E−08 −3.682 200 244 222 HMGB1 0.977375566 0.175946548 3.997 4.24E−12 1.39E−11 −1.798 119 327 223 WHSC1 0.452488688 0.70935412 0.214 1.24E−06 1.96E−06 −4.706 247 200 223.5 BLOC1S1 0.452488688 0.714365256 0.941 5.60E−07 9.25E−07 −4.185 236 219 227.5 BAZ2A 0.416289593 0.737750557 0.151 2.24E−06 3.36E−06 −4.773 260 197 228.5 RNF19A 0.49321267 0.670935412 0.239 1.51E−06 2.36E−06 −4.511 250 207 228.5 PFDN5 0.932126697 0.2655902 4.42 5.83E−13 2.21E−12 −0.818 103 356 229.5 XAB2 0.475113122 0.694320713 0.696 5.32E−07 8.83E−07 −4.025 235 226 230.5 PQBP1 0.520361991 0.655345212 0.941 3.49E−07 5.95E−07 −3.726 229 237 233 LIMD1 0.488687783 0.673162584 0.176 2.02E−06 3.07E−06 −4.297 256 211 233.5 GTF2A2 0.466063348 0.703786192 0.669 4.33E−07 7.31E−07 −3.707 231 240 235.5 RBM38 0.7239819 0.485523385 3.483 1.47E−09 3.42E−09 −2.402 168 303 235.5 ILF3 0.714932127 0.481069042 0.411 1.50E−08 2.93E−08 −3.092 199 274 236.5 MAZ 0.447963801 0.70155902 0.401 7.33E−06 1.03E−05 −4.783 278 196 237 SMAD2 0.371040724 0.771158129 0.176 5.70E−06 8.14E−06 −4.524 273 205 239 CNBP 1 0.107461024 6.679 5.57E−11 1.56E−10 −1.214 139 341 240 PHF20L1 0.497737557 0.660356347 0.151 3.80E−06 5.55E−06 −4.183 267 220 243.5 GABPB1 0.407239819 0.742761693 0.848 3.55E−06 5.23E−06 −4.109 265 224 244.5 CDK7 0.65158371 0.505567929 0.014 6.19E−06 8.74E−06 −4.248 276 214 245 HNRNPD 0.547511312 0.625835189 0.138 6.25E−07 1.02E−06 −3.476 238 254 246 DNMT1 0.606334842 0.577951002 0.275 1.54E−07 2.79E−07 −2.951 216 277 246.5 BAZ1B 0.479638009 0.673719376 0.163 6.18E−06 8.74E−06 −4.166 275 223 249 DTX3L 0.438914027 0.721603563 3.113 1.22E−06 1.93E−06 −3.521 246 252 249 NACA 0.950226244 0.185412027 9.038 1.25E−08 2.49E−08 −2.421 196 302 249 KDM5A 0.642533937 0.525055679 0.239 1.62E−06 2.50E−06 −3.528 253 251 252 ATF4 0.864253394 0.334632517 1.239 1.19E−10 3.17E−10 −0.639 146 360 253 ATF2 0.42081448 0.71714922 0.263 2.57E−05 3.43E−05 −4.226 292 217 254.5 UHRF1 0.375565611 0.770044543 0.379 3.65E−06 5.35E−06 −3.683 266 243 254.5 CIZ1 0.43438914 0.718819599 0.239 3.50E−06 5.17E−06 −3.681 264 245 254.5 THRAP3 0.71040724 0.473273942 2.441 1.04E−07 1.89E−07 −2.599 214 295 254.5 UIMC1 0.447963801 0.704899777 0.516 4.52E−06 6.50E−06 −3.709 271 239 255 EED 0.375565611 0.763919822 0.585 9.63E−06 1.32E−05 −3.997 284 227 255.5 TRIM27 0.325791855 0.816815145 2.077 1.47E−06 2.30E−06 −3.29 249 267 258 CCNL1 0.719457014 0.470489978 2.428 3.62E−08 6.93E−08 −2.261 204 312 258 MED8 0.366515837 0.771158129 0.774 1.05E−05 1.43E−05 −3.77 286 234 260 RNF44 0.656108597 0.510579065 0.227 1.74E−06 2.67E−06 −3.238 254 270 262 RNF5 0.398190045 0.744988864 1.091 8.53E−06 1.19E−05 −3.661 280 246 263 CHURC1 0.43438914 0.717706013 6.17 4.14E−06 6.00E−06 −3.374 269 259 264 MED12 0.547511312 0.614142539 0.124 3.31E−06 4.91E−06 −3.326 263 265 264 PWP1 0.375565611 0.757238307 0.251 2.61E−05 3.47E−05 −3.737 293 236 264.5 MAF1 0.800904977 0.393652561 2.403 3.34E−09 7.36E−09 −0.873 177 352 264.5 EOMES 0.352941176 0.773942094 0.176 4.02E−05 5.24E−05 −3.778 299 232 265.5 PREB 0.520361991 0.638084633 0.214 4.36E−06 6.30E−06 −3.347 270 262 266 MED1 0.57918552 0.566258352 0.227 2.91E−05 3.86E−05 −3.711 295 238 266.5 MYSM1 0.457013575 0.69766147 2.856 3.92E−06 5.70E−06 −3.307 268 266 267 TBP 0.34841629 0.783407572 0.642 1.74E−05 2.35E−05 −3.606 289 247 268 TGIF1 0.633484163 0.533407572 0.585 1.83E−06 2.79E−06 −2.887 255 282 268.5 TRIP12 0.56561086 0.58908686 0.084 8.95E−06 1.24E−05 −3.337 282 264 273 MMS19 0.34841629 0.777839644 0.356 4.03E−05 5.24E−05 −3.557 300 248 274 BUD31 0.588235294 0.577394209 1.449 2.20E−06 3.32E−06 −2.816 259 290 274.5 MLLT6 0.511312217 0.64142539 0.098 8.87E−06 1.23E−05 −3.208 281 271 276 SMYD3 0.398190045 0.736080178 0.163 3.09E−05 4.07E−05 −3.385 296 258 277 SREBF1 0.447963801 0.687639198 0.227 4.82E−05 6.24E−05 −3.42 301 256 278.5 BATF 0.601809955 0.571269488 1.098 7.94E−07 1.27E−06 −2.155 243 315 279 IKZF1 0.828054299 0.334632517 0.39 2.13E−07 3.77E−07 −1.485 220 338 279 SCAND1 0.334841629 0.786191537 1.036 6.54E−05 8.31E−05 −3.512 307 253 280 CTNNB1 0.321266968 0.795100223 0.422 9.70E−05 0.000120418 −3.534 313 249 281 MKL1 0.561085973 0.59688196 0.176 5.76E−06 8.19E−06 −2.851 274 288 281 HMGB2 0.868778281 0.30623608 1.967 5.95E−09 1.26E−08 0 184 379 281.5 PER1 0.669683258 0.497772829 0.824 1.46E−06 2.29E−06 −2.116 248 316 282 AATF 0.343891403 0.777839644 0.687 7.07E−05 8.96E−05 −3.391 308 257 282.5 TCF20 0.674208145 0.482739421 0.084 5.65E−06 8.10E−06 −2.571 272 298 285 E4F1 0.330316742 0.793429844 0.496 3.98E−05 5.21E−05 −3.193 298 273 285.5 ING3 0.42081448 0.70935412 0.322 7.21E−05 9.10E−05 −3.347 309 263 286 CXXC1 0.479638009 0.669265033 0.506 1.14E−05 1.55E−05 −2.876 288 285 286.5 CNOT2 0.529411765 0.623051225 0.651 1.03E−05 1.41E−05 −2.822 285 289 287 PNN 0.574660633 0.56403118 0.287 6.43E−05 8.20E−05 −3.239 306 269 287.5 GTF2A1 0.407239819 0.71714922 0.176 0.000127921 0.000156392 −3.367 319 260 289.5 REXO4 0.371040724 0.756124722 0.614 5.36E−05 6.90E−05 −2.964 303 276 289.5 SF1 0.800904977 0.349665924 0.422 2.43E−06 3.62E−06 −2.069 262 317 289.5 MLXIP 0.529411765 0.600222717 0.202 0.00016273 0.000195276 −3.441 325 255 290 ATRX 0.547511312 0.59298441 0.07 4.94E−05 6.38E−05 −2.951 302 278 290 ABT1 0.791855204 0.340757238 0.111 2.92E−05 3.86E−05 −2.876 294 286 290 CDCA4 0.466063348 0.673162584 0.422 3.60E−05 4.73E−05 −2.718 297 291 294 SP3 0.411764706 0.71325167 0.263 0.000124537 0.000152734 −3.195 318 272 295 MTF2 0.34841629 0.770601336 0.322 0.000111835 0.000138024 −3.09 316 275 295.5 STAT6 0.633484163 0.519487751 0.163 1.11E−05 1.51E−05 −2.377 287 304 295.5 PNRC1 0.597285068 0.559576837 0.526 7.11E−06 1.00E−05 −2.217 277 314 295.5 ING4 0.452488688 0.682071269 0.731 5.74E−05 7.37E−05 −2.615 304 294 299 RORA 0.366515837 0.755011136 0.74 0.000107207 0.000132733 −2.881 315 284 299.5 TRIM28 0.375565611 0.747772829 0.31 9.67E−05 0.000120418 −2.853 314 287 300.5 SP110 0.814479638 0.342427617 0.214 7.28E−07 1.18E−06 −0.59 240 361 300.5 NFYC 0.461538462 0.673162584 0.433 6.12E−05 7.83E−05 −2.468 305 301 303 RNF114 0.701357466 0.461024499 0.299 2.27E−06 3.39E−06 −1.109 261 345 303 PNRC2 0.520361991 0.614142539 0.496 9.06E−05 0.000113305 −2.581 312 296 304 IFI35 0.529411765 0.624721604 0.766 8.28E−06 1.16E−05 −1.773 279 329 304 CIR1 0.380090498 0.736080178 0.322 0.000255489 0.000301029 −2.932 331 279 305 CAMTA2 0.36199095 0.75389755 0.239 0.000208539 0.000247959 −2.887 328 283 305.5 NCOA4 0.43438914 0.690423163 0.275 0.000160385 0.000193056 −2.656 324 293 308.5 JARID2 0.380090498 0.729955457 0.138 0.000527461 0.000606814 −2.894 339 281 310 MLL5 0.742081448 0.388084633 0.163 7.78E−05 9.75E−05 −2.262 311 311 311 HSF1 0.425339367 0.70155902 0.536 0.000114139 0.000140423 −2.376 317 306 311.5 DNM2 0.701357466 0.444877506 0.275 1.76E−05 2.36E−05 −1.605 290 335 312.5 RPL7 0.914027149 0.208797327 11.198 2.12E−06 3.20E−06 −0.328 258 369 313.5 PMF1 0.402714932 0.718262806 1.007 0.000185052 0.000220704 −2.377 327 305 316 PLRG1 0.321266968 0.784521158 0.848 0.000406362 0.00047167 −2.58 336 297 316.5 CEBPZ 0.389140271 0.723830735 0.401 0.00041407 0.000479191 −2.495 337 299 318 TLE3 0.511312217 0.615256125 0.176 0.000214079 0.000253771 −2.313 329 309 319 BRD8 0.610859729 0.511135857 0.07 0.000385821 0.000449165 −2.37 335 307 321 PTMA 0.995475113 0.066258352 7.631 9.55E−06 1.32E−05 −0.646 283 359 321 MED30 0.497737557 0.632516704 1.064 0.000133075 0.00016168 −1.936 321 323 322 PHF6 0.398190045 0.70545657 0.214 0.001251094 0.001402088 −2.481 348 300 324 ZNRD1 0.398190045 0.722717149 1.406 0.000177338 0.000212153 −1.93 326 324 325 TAF1B 0.36199095 0.741648107 0.632 0.000898856 0.001016098 −2.338 345 308 326.5 SMAD7 0.479638009 0.643095768 0.239 0.000281171 0.000330291 −1.953 332 322 327 ILF2 0.447963801 0.668708241 0.299 0.000450103 0.000519349 −2.044 338 319 328.5 MYC 0.429864253 0.683184855 0.333 0.000587319 0.000671713 −2.057 341 318 329.5 SPOP 0.552036199 0.578507795 0.379 0.000155797 0.000188114 −1.526 323 336 329.5 CREBBP 0.479638009 0.642538976 0.163 0.000298881 0.000348993 −1.873 334 326 330 STAT1 0.837104072 0.290089087 0.124 2.21E−05 2.96E−05 −0.239 291 371 331 NFX1 0.470588235 0.631959911 0.176 0.00208768 0.002299986 −2.258 354 313 333.5 NCOR1 0.746606335 0.378619154 0.832 0.000128543 0.000156662 −1.081 320 347 333.5 NFYB 0.425339367 0.683184855 0.485 0.000918983 0.001035848 −1.885 346 325 335.5 THOC2 0.43438914 0.665924276 0.138 0.002194353 0.002410698 −1.958 355 321 338 VAV1 0.805429864 0.29844098 0.07 0.000602489 0.000687049 −1.636 342 334 338 MBNL1 0.904977376 0.195991091 5.051 7.55E−05 9.50E−05 −0.362 310 366 338 GABPB2 0.57918552 0.517260579 0.029 0.004168801 0.004554152 −1.987 357 320 338.5 GTF3C2 0.470588235 0.634187082 0.239 0.00169389 0.0018821 −1.775 351 328 339.5 GON4L 0.42081448 0.684298441 0.057 0.001265881 0.001412898 −1.767 349 330 339.5 NCOA2 0.447963801 0.661469933 0.084 0.000963269 0.001082637 −1.68 347 333 340 HDAC7 0.628959276 0.484966592 0.263 0.000823589 0.00093372 −1.495 344 337 340.5 MIER1 0.615384615 0.5 0.287 0.000736355 0.000837254 −1.158 343 343 343 STAT5B 0.502262443 0.599665924 0.07 0.002431195 0.002663388 −1.733 356 331 343.5 RNF7 0.678733032 0.44376392 1.05 0.000292294 0.000342326 −0.696 333 357 345 PML 0.36199095 0.726057906 0.163 0.004461983 0.00484728 −1.725 359 332 345.5 HBP1 0.479638009 0.615256125 0.227 0.004253197 0.004633371 −1.436 358 339 348.5 RPL6 0.995475113 0.052895323 10.212 0.000146579 0.000177533 −0.022 322 377 349.5 NFKB1 0.411764706 0.674832962 0.151 0.006755416 0.007257885 −1.283 363 340 351.5 ELF1 0.787330317 0.319599109 0.872 0.000559335 0.00064159 −0.41 340 365 352.5 IRF3 0.43438914 0.650890869 0.696 0.008241059 0.008829706 −1.122 364 344 354 MXD1 0.479638009 0.610801782 0.189 0.006176842 0.006673043 −1.081 361 348 354.5 JUNB 0.963800905 0.106347439 8.485 0.000222969 0.000263509 0 330 380 355 SMARCA2 0.366515837 0.704899777 0.275 0.01882142 0.019785321 −1.209 371 342 356.5 GATA3 0.511312217 0.582962138 0.379 0.004795813 0.005195464 −0.857 360 354 357 NRF1 0.380090498 0.696547884 0.322 0.0132967 0.014053423 −1.107 369 346 357.5 DAXX 0.375565611 0.704342984 0.546 0.00996954 0.01062328 −1.033 366 349 357.5 CCNL2 0.687782805 0.415367483 0.496 0.001805368 0.001994599 −0.426 353 364 358.5 NCOA3 0.619909502 0.461581292 0.176 0.012714663 0.013474779 −1.007 368 350 359 NFATC3 0.511312217 0.574053452 0.111 0.009750684 0.010418539 −0.868 365 353 359 NSD1 0.597285068 0.493318486 0.084 0.006586043 0.007095461 −0.678 362 358 360 KLF6 0.800904977 0.296213808 0.333 0.001267985 0.001412898 −0.093 350 375 362.5 PIAS1 0.343891403 0.716035635 0.322 0.039478525 0.041057666 −0.945 375 351 363 ELF4 0.366515837 0.697104677 0.251 0.033149145 0.034659964 −0.857 373 355 364 KLF13 0.923076923 0.147550111 0.903 0.001765897 0.001956534 0 352 381 366.5 ARID1A 0.696832579 0.375835189 0.124 0.019757865 0.02071389 −0.589 372 362 367 NR4A1 0.665158371 0.413697105 0.275 0.014002034 0.014758901 −0.341 370 368 369 JUN 0.371040724 0.668708241 0.367 0.134780588 0.138327445 −0.494 380 363 371.5 BTG2 0.71040724 0.370824053 0.214 0.010060004 0.010690468 −0.02 367 378 372.5 ATF7IP 0.552036199 0.508351893 0.275 0.052223876 0.054024699 −0.239 377 372 374.5 MAML2 0.416289593 0.617483296 0.098 0.183886522 0.187247372 −0.343 383 367 375 RNF138 0.610859729 0.454342984 0.401 0.038087039 0.039716431 −0.06 374 376 375 LDB1 0.398190045 0.634743875 0.516 0.18815501 0.191094932 −0.24 384 370 377 MTA3 0.429864253 0.60467706 0.444 0.179506517 0.183265816 −0.22 382 373 377.5 NOTCH1 0.524886878 0.512249443 0.07 0.165838562 0.169756009 −0.165 381 374 377.5 SP100 0.814479638 0.238864143 0.475 0.043616752 0.04524078 0 376 382 379 GTF2I 0.751131222 0.299554566 0.263 0.067640587 0.069787907 0 378 383 380.5 WHSC1L1 0.746606335 0.298997773 0.111 0.091267343 0.093916263 0 379 384 381.5 ARID5A 0.57918552 0.437082405 0.111 0.349663504 0.354204588 0 385 385 385 ZFP36L1 0.574660633 0.415367483 0.333 0.640096896 0.646730025 0 386 386 386 IRF1 0.56561086 0.415367483 0.642 0.730789354 0.736454387 0 387 387 387 PYHIN1 0.357466063 0.595211581 0.333 0.924007685 0.928770611 0 388 388 388 ZFP36L2 0.628959276 0.323496659 0.189 0.931648747 0.934043731 0 389 389 389 FOS 0.461538462 0.423162584 0.31 0.999549404 0.999549404 0 390 390 390
TABLE-US-00005 TABLE 3 Ranked top surface cytokines differentially expressed in cluster 7 Gene TP TN thresh_mhg hyper_pval hyper_qval TNFRSF9 0.873303167 0.744988864 8.537 2.48E−73 5.27E−71 CCRL2 0.7239819 0.791759465 1.05 1.60E−52 1.13E−50 HAVCR2 0.873303167 0.683184855 2.154 5.96E−59 6.31E−57 CSF1 0.556561086 0.885300668 0.911 1.02E−47 3.08E−46 ADAM8 0.787330317 0.726057906 0.864 7.94E−50 2.80E−48 ITGAV 0.85520362 0.657572383 0.084 7.25E−50 2.80E−48 SERPINE2 0.542986425 0.873051225 3.895 1.05E−41 1.85E−40 TNFRSF4 0.773755656 0.723830735 3.144 8.39E−47 2.22E−45 LAG3 0.963800905 0.513919822 4.793 7.81E−51 4.14E−49 GPR56 0.647058824 0.806792873 0.696 2.30E−42 4.44E−41 PGLYRP1 0.923076923 0.53674833 4.954 5.99E−44 1.27E−42 CXCR6 0.986425339 0.423719376 5.506 4.32E−44 1.02E−42 KIT 0.466063348 0.88752784 0.516 2.23E−33 2.63E−32 CCL3 0.642533937 0.773942094 3.904 8.83E−35 1.17E−33 NR4A2 0.914027149 0.498886414 0.595 2.62E−36 3.71E−35 IL1R2 0.407239819 0.915924276 3.396 2.28E−32 2.42E−31 CD244 0.466063348 0.883073497 3.545 3.23E−32 3.26E−31 NRP1 0.751131222 0.670935412 0.163 1.76E−33 2.20E−32 LGALS1 0.923076923 0.508351893 10.112 1.29E−39 2.10E−38 CX3CR1 0.511312217 0.843541203 1.646 1.21E−29 1.07E−28 GPR65 0.760180995 0.652561247 2.585 5.08E−32 4.89E−31 ENTPD1 0.701357466 0.692093541 0.202 2.00E−29 1.63E−28 TIGIT 0.981900452 0.354120267 4.895 4.50E−33 5.02E−32 PDCD1 0.968325792 0.415367483 5.101 2.34E−37 3.54E−36 CLIC4 0.619909502 0.758351893 1.202 9.73E−29 7.37E−28 TFF1 0.384615385 0.904788419 5.97 6.36E−26 3.74E−25 CCR8 0.443438914 0.874164811 5.401 7.64E−27 4.76E−26 KLRC1 0.841628959 0.546213808 4.198 1.16E−29 1.07E−28 LILRB4 0.597285068 0.767817372 5.621 2.81E−27 1.86E−26 IL2RB 0.561085973 0.782293987 9.964 5.64E−25 3.23E−24 KLRC2 0.778280543 0.597995546 1.766 5.80E−27 3.73E−26 IL10RA 0.837104072 0.538975501 0.214 5.38E−28 3.93E−27 IL18RAP 0.733031674 0.626948775 0.66 1.40E−24 7.83E−24 TNFRSF18 0.895927602 0.459910913 4.331 1.10E−27 7.78E−27 CMTM7 0.864253394 0.512249443 1.761 6.60E−29 5.18E−28 PTGER2 0.479638009 0.824053452 0.227 7.64E−22 3.52E−21 IL12RB2 0.447963801 0.841870824 0.66 4.40E−21 1.90E−20 NCOR2 0.656108597 0.688752784 0.239 5.32E−23 2.68E−22 CALR 0.923076923 0.384187082 2.844 1.64E−23 8.71E−23 TMEM123 0.891402715 0.464922049 4.878 1.61E−27 1.10E−26 CD200 0.34841629 0.901447661 1.614 2.61E−20 1.04E−19 GABARAPL1 0.597285068 0.733853007 0.595 4.23E−22 1.99E−21 TNFSF4 0.384615385 0.878619154 3.874 3.78E−20 1.49E−19 SEPT2 0.954751131 0.329064588 0.536 2.54E−23 1.31E−22 SIVA1 0.57918552 0.739977728 2.032 7.74E−21 3.17E−20 CTSB 0.959276018 0.346325167 2.31 2.72E−26 1.65E−25 LAP3 0.429864253 0.845211581 0.88 1.60E−19 5.67E−19 CTLA4 0.936651584 0.413140312 2.685 1.42E−29 1.20E−28 BSG 0.932126697 0.357461024 0.575 3.86E−22 1.90E−21 XPOT 0.466063348 0.815701559 0.411 6.17E−19 2.04E−18 CD200R1 0.384615385 0.865812918 1.454 8.03E−18 2.40E−17 MIF 0.941176471 0.315701559 6.412 2.87E−19 9.80E−19 RAC1 0.918552036 0.378619154 0.872 4.21E−22 1.99E−21 PDIA4 0.63800905 0.678173719 2.128 1.54E−19 5.54E−19 ATPIF1 0.678733032 0.652561247 4.168 4.49E−21 1.90E−20 IL21R 0.841628959 0.457126949 0.993 3.88E−19 1.30E−18 HSP90AB1 0.936651584 0.31013363 9.834 6.45E−18 1.98E−17 TRPV2 0.701357466 0.615256125 4.401 2.71E−19 9.43E−19 LAMP2 0.547511312 0.744432071 1.982 6.23E−18 1.94E−17 ECE1 0.429864253 0.832962138 2.101 1.46E−17 4.12E−17 P4HB 0.936651584 0.365256125 0.526 7.55E−24 4.10E−23 HSPD1 0.846153846 0.458797327 1.585 6.50E−20 2.46E−19 PDIA3 0.945701357 0.331291759 6.479 9.01E−22 4.07E−21 KLRK1 0.760180995 0.561247216 1.064 4.09E−20 1.58E−19 ADAM17 0.533936652 0.752783964 2.124 1.46E−17 4.12E−17 GPI1 0.954751131 0.295657016 7.555 1.15E−19 4.21E−19 CD82 0.941176471 0.334632517 6.884 2.75E−21 1.21E−20 CTSD 0.850678733 0.418151448 9.5 2.16E−16 5.52E−16 KLRE1 0.330316742 0.886414254 2.583 2.75E−15 6.28E−15 TFRC 0.49321267 0.771158129 2.356 1.05E−15 2.49E−15 CCL4 0.619909502 0.667594655 5.124 2.13E−16 5.52E−16 M6PR 0.891402715 0.40701559 4.087 7.77E−21 3.17E−20 IRAK2 0.542986425 0.737750557 1.536 1.23E−16 3.22E−16 KLRD1 0.78280543 0.493318486 5.966 1.01E−15 2.46E−15 IL2RA 0.303167421 0.902561247 2.452 3.98E−15 8.78E−15 AIMP1 0.683257919 0.618040089 0.986 1.32E−17 3.84E−17 CD44 0.805429864 0.478285078 0.367 8.14E−17 2.18E−16 HSPA9 0.701357466 0.594097996 3.417 5.39E−17 1.47E−16 CD8A 0.945701357 0.273942094 8.096 7.90E−16 1.95E−15 ERP44 0.787330317 0.513363029 1.899 3.16E−18 1.01E−17 ITGB3 0.389140271 0.83518931 0.124 1.12E−13 2.23E−13 TMX3 0.502262443 0.75 0.227 4.34E−14 8.93E−14 USP14 0.497737557 0.761135857 2.091 6.12E−15 1.34E−14 CD27 0.904977376 0.378062361 4.648 7.70E−20 2.86E−19 C1QBP 0.696832579 0.599665924 4.777 4.27E−17 1.17E−16 FERMT3 0.932126697 0.316258352 3.5 8.68E−18 2.56E−17 PEBP1 0.85520362 0.430957684 1.637 3.13E−18 1.01E−17 GPR160 0.357466063 0.85467706 0.766 3.12E−13 6.06E−13 IL18R1 0.597285068 0.668708241 3.714 2.59E−14 5.38E−14 ANXA5 0.696832579 0.58518931 3.898 1.28E−15 3.01E−15 IDE 0.737556561 0.537861915 0.651 3.54E−15 7.90E−15 LYST 0.624434389 0.645879733 0.669 1.43E−14 3.03E−14 CD2BP2 0.678733032 0.606347439 0.345 6.58E−16 1.64E−15 SCARB2 0.371040724 0.84298441 3.57 5.76E−13 1.07E−12 LY75 0.457013575 0.777282851 0.39 5.47E−13 1.04E−12 IFNG 0.488687783 0.750556793 4.6 6.54E−13 1.21E−12 SEMA4D 0.895927602 0.341314031 2.077 6.49E−15 1.40E−14 ITGB2 0.959276018 0.253340757 6.382 3.58E−16 9.05E−16 FLOT2 0.443438914 0.786191537 0.888 9.14E−13 1.67E−12 CD96 0.692307692 0.579621381 3.331 1.25E−14 2.68E−14 GRN 0.339366516 0.855790646 3.126 1.17E−11 2.01E−11 H13 0.909502262 0.353563474 4.489 5.21E−18 1.65E−17 ATP5B 0.990950226 0.146993318 6.427 2.81E−12 5.01E−12 PDLIM2 0.520361991 0.724944321 4.378 4.78E−13 9.13E−13 HNRNPU 0.787330317 0.485523385 0.516 1.77E−15 4.13E−15 NCKAP1L 0.764705882 0.492761693 0.856 8.83E−14 1.78E−13 PGRMC1 0.561085973 0.679844098 0.614 3.65E−12 6.44E−12 CD226 0.687782805 0.572383073 1.05 1.60E−13 3.14E−13 LY6A 0.683257919 0.596325167 5.895 2.33E−15 5.37E−15 GDI2 0.959276018 0.263919822 4.652 3.10E−17 8.64E−17 SMPD1 0.398190045 0.810690423 5.212 1.62E−11 2.73E−11 AAMP 0.760180995 0.513363029 3.018 3.33E−15 7.52E−15 CD9 0.43438914 0.782293987 5.837 1.53E−11 2.61E−11 TNIP1 0.619909502 0.620824053 1.111 8.05E−12 1.40E−11 ADAM10 0.737556561 0.492761693 0.214 3.07E−11 5.08E−11 CD38 0.429864253 0.777282851 2.091 1.20E−10 1.91E−10 CD74 0.312217195 0.86247216 1.683 4.65E−10 6.81E−10 FASL 0.656108597 0.60467706 3.863 1.47E−13 2.92E−13 PSTPIP1 0.778280543 0.479398664 3.501 5.82E−14 1.19E−13 CD3E 0.900452489 0.287861915 6.221 7.79E−11 1.25E−10 F2R 0.520361991 0.706013363 2.744 3.37E−11 5.53E−11 ATP6AP2 0.547511312 0.685412027 2.956 1.54E−11 2.61E−11 LSM1 0.497737557 0.723273942 0.546 5.85E−11 9.47E−11 TLN1 0.936651584 0.287861915 0.926 1.03E−15 2.49E−15 PTPRCAP 0.968325792 0.2422049 7.465 8.60E−17 2.28E−16 ERP29 0.592760181 0.630846325 0.956 1.85E−10 2.84E−10 CAP1 0.737556561 0.479398664 0.824 3.34E−10 4.95E−10 CCR5 0.511312217 0.703229399 3.733 3.14E−10 4.73E−10 CR1L 0.606334842 0.618596882 2.31 1.59E−10 2.48E−10 CCL5 0.977375566 0.233853007 3.234 7.29E−18 2.21E−17 H2-M3 0.529411765 0.688752784 2.766 2.22E−10 3.38E−10 IL27RA 0.665158371 0.56013363 1.227 1.61E−10 2.49E−10 SLC3A2 0.846153846 0.368596882 4.681 1.68E−11 2.80E−11 CD48 0.864253394 0.364699332 5.154 3.94E−13 7.59E−13 CAST 0.705882353 0.518930958 1.064 1.30E−10 2.05E−10 TNFSF10 0.343891403 0.814587973 2.926 1.31E−07 1.75E−07 EZR 0.895927602 0.319599109 0.632 5.78E−13 1.07E−12 NOTCH2 0.714932127 0.500556793 0.202 6.02E−10 8.69E−10 ITGAL 0.932126697 0.28285078 4.104 1.54E−14 3.22E−14 THY1 0.868778281 0.33518931 5.619 3.62E−11 5.90E−11 CLPTM1 0.402714932 0.770044543 0.299 6.24E−08 8.47E−08 IGF2R 0.552036199 0.629732739 0.111 1.80E−07 2.37E−07 CD160 0.488687783 0.714365256 0.895 1.83E−09 2.57E−09 CD47 0.959276018 0.216035635 6.062 1.34E−12 2.42E−12 LRPAP1 0.443438914 0.7344098 0.333 7.17E−08 9.68E−08 CD164 0.918552036 0.282293987 4.285 1.38E−12 2.48E−12 HMGB1 0.977375566 0.175946548 3.997 4.24E−12 7.43E−12 CD55 0.325791855 0.821269488 0.299 6.28E−07 8.02E−07 TRAF3 0.371040724 0.785634744 0.163 4.80E−07 6.21E−07 CMTM6 0.574660633 0.634187082 3.522 2.37E−09 3.31E−09 CD3G 0.981900452 0.140311804 8.624 1.13E−09 1.60E−09 CD6 0.823529412 0.380289532 2.757 3.24E−10 4.84E−10 ITGA4 0.886877828 0.299554566 0.556 2.88E−10 4.37E−10 NR3C1 0.452488688 0.719933185 0.138 2.23E−07 2.92E−07 SBDS 0.561085973 0.635300668 1.084 1.82E−08 2.50E−08 TGFBR2 0.769230769 0.438752784 1.646 8.22E−10 1.18E−09 RPS6KB1 0.502262443 0.670378619 0.251 4.61E−07 5.99E−07 IL12RB1 0.321266968 0.820155902 0.465 1.56E−06 1.92E−06 RALA 0.371040724 0.781737194 0.401 9.65E−07 1.21E−06 TSPAN32 0.321266968 0.816258352 0.824 3.20E−06 3.89E−06 SPN 0.737556561 0.444320713 0.251 9.53E−08 1.28E−07 HSPA5 0.923076923 0.222160356 6.319 2.99E−08 4.08E−08 HSP90AA1 0.823529412 0.378062361 2.521 4.77E−10 6.93E−10 CD52 0.941176471 0.224387528 9.42 1.24E−10 1.97E−10 CD5 0.57918552 0.59688196 5.913 4.91E−07 6.31E−07 ROCK1 0.56561086 0.601336303 0.111 1.72E−06 2.11E−06 PEAR1 0.371040724 0.7655902 0.287 1.36E−05 1.63E−05 CD37 0.882352941 0.304008909 3.294 3.90E−10 5.74E−10 IL2RG 1 0.08908686 5.342 3.79E−09 5.25E−09 LTB 0.891402715 0.283964365 6.104 1.54E−09 2.17E−09 BST2 0.502262443 0.663697105 1.345 1.27E−06 1.59E−06 ICAM1 0.515837104 0.631403118 0.251 1.88E−05 2.22E−05 STX4A 0.316742081 0.800111359 0.816 8.20E−05 9.40E−05 CD97 0.79638009 0.375278396 0.546 1.36E−07 1.80E−07 SLAMF1 0.325791855 0.79064588 0.444 0.00010523 0.000119298 IFNAR1 0.714932127 0.439309577 3.279 5.74E−06 6.95E−06 B4GALT1 0.882352941 0.253340757 2.046 1.52E−06 1.88E−06 CORO1A 0.914027149 0.214922049 10.504 8.20E−07 1.04E−06 GPR174 0.334841629 0.760022272 0.043 0.001761276 0.001914823 FLT3L 0.389140271 0.715478842 0.918 0.001048641 0.001145938 ICOS 0.678733032 0.449331849 0.39 0.000162874 0.00017984 SYNJ2BP 0.859728507 0.248886414 0.585 0.000123973 0.000138328 CCND2 0.737556561 0.405902004 0.111 1.72E−05 2.05E−05 B2M 0.995475113 0.061247216 11.727 2.69E−05 3.13E−05 PSEN1 0.452488688 0.647550111 0.401 0.00245109 0.002651179 CD53 0.950226244 0.162583519 5.988 7.25E−07 9.20E−07 NUP85 0.36199095 0.716035635 0.526 0.01085838 0.011567721 STK10 0.742081448 0.384187082 0.239 0.000120222 0.000134852 CD3D 0.986425339 0.087416481 6.219 7.12E−06 8.57E−06 HCST 0.819004525 0.301781737 2.546 7.28E−05 8.39E−05 MSN 0.950226244 0.140868597 5.287 2.53E−05 2.97E−05 PTPRC 0.986425339 0.081848552 3.674 2.06E−05 2.42E−05 ITGB1 0.656108597 0.44376392 0.239 0.002730536 0.002938445 HSPA8 0.986425339 0.063474388 10.474 0.000590012 0.000648096 CD8B1 0.968325792 0.106347439 8.815 7.23E−05 8.38E−05 MYO9B 0.389140271 0.652004454 0.163 0.128803746 0.133854873 CD28 0.687782805 0.39142539 0.251 0.012756924 0.013522339 LY6E 0.954751131 0.126391982 6.449 8.36E−05 9.53E−05 IL4RA 0.488687783 0.571269488 0.287 0.052465723 0.054791789 RPS19 0.963800905 0.110801782 9.967 0.000111218 0.000125416 NOTCH1 0.524886878 0.512249443 0.07 0.165838562 0.171501343 CNP 0.592760181 0.472717149 0.496 0.038042717 0.03992602 SELPLG 0.995475113 0.052895323 0.678 0.000146579 0.000162694 CD247 0.832579186 0.246659243 0.766 0.004665044 0.004994896 DPP4 0.325791855 0.691536748 0.239 0.324787096 0.331033002 PDE4B 0.475113122 0.546770601 0.31 0.292572864 0.299639841 CD84 0.520361991 0.513363029 0.275 0.190762572 0.196318763 CD2 0.868778281 0.188195991 0.888 0.021107237 0.022262359 IL16 0.457013575 0.549554566 0.287 0.454103629 0.460621863 IL17RA 0.411764706 0.572383073 0.163 0.698347268 0.704998194 CCR7 0.325791855 0.587416481 0.322 0.995063869 0.999581424 CD69 0.484162896 0.400334076 0.516 0.999581424 0.999581424 Gene gen_qval rank_hyper_qval rank_gen_qval mean_rank TNFRSF9 −74.603 1 1 1 CCRL2 −57.892 3 2 2.5 HAVCR2 −51.383 2 4 3 CSF1 −56.864 7 3 5 ADAM8 −50.88 5 6 5.5 ITGAV −50.642 6 7 6.5 SERPINE2 −51.019 12 5 8.5 TNFRSF4 −42.493 8 10 9 LAG3 −36.69 4 14 9 GPR56 −44.618 11 8 9.5 PGLYRP1 −43.178 10 9 9.5 CXCR6 −29.649 9 19 14 KIT −40.679 18 11 14.5 CCL3 −35.708 16 15 15.5 NR4A2 −31.351 15 16 15.5 IL1R2 −40.178 20 12 16 CD244 −37.285 21 13 17 NRP1 −30.537 17 18 17.5 LGALS1 −25.523 13 27 20 CX3CR1 −28.883 23 21 22 GPR65 −26.057 22 26 24 ENTPD1 −26.13 26 25 25.5 TIGIT −21.13 19 32 25.5 PDCD1 −19.612 14 37 25.5 CLIC4 −26.3 28 24 26 TFF1 −30.862 36 17 26.5 CCR8 −29.292 34 20 27 KLRC1 −22.062 24 30 27 LILRB4 −26.812 32 23 27.5 IL2RB −27.616 37 22 29.5 KLRC2 −20.64 33 35 34 IL10RA −18.023 29 40 34.5 IL18RAP −21.027 38 33 35.5 TNFRSF18 −16.98 30 44 37 CMTM7 −16.368 27 47 37 PTGER2 −22.388 46 29 37.5 IL12RB2 −23.202 50 28 39 NCOR2 −19.689 42 36 39 CALR −18.422 40 39 39.5 TMEM123 −16.349 31 49 40 CD200 −21.601 53 31 42 GABARAPL1 −17.973 44 41 42.5 TNFSF4 −20.871 54 34 44 SEPT2 −14.651 41 53 47 SIVA1 −16.842 52 45 48.5 CTSB −13.17 35 62 48.5 LAP3 −18.741 60 38 49 CTLA4 −11.36 25 75 50 BSG −13.243 43 61 52 XPOT −17.777 64 43 53.5 CD200R1 −17.97 71 42 56.5 MIF −15.258 62 51 56.5 RAC1 −11.928 45 69 57 PDIA4 −14.183 59 56 57.5 ATPIF1 −12.554 49 66 57.5 IL21R −14.583 63 54 58.5 HSP90AB1 −16.101 69 50 59.5 TRPV2 −13.709 61 58 59.5 LAMP2 −14.908 68 52 60 ECE1 −16.498 75 46 60.5 P4HB −10.729 39 83 61 HSPD1 −12.229 56 68 62 PDIA3 −11.136 47 77 62 KLRK1 −11.367 55 74 64.5 ADAM17 −13.689 74 59 66.5 GPI1 −11.256 58 76 67 CD82 −9.818 48 89 68.5 CTSD −14.202 83 55 69 KLRE1 −16.362 93 48 70.5 TFRC −13.761 88 57 72.5 CCL4 −12.771 82 65 73.5 M6PR −8.074 51 99 75 IRAK2 −11.616 81 72 76.5 KLRD1 −11.474 87 73 80 IL2RA −12.37 96 67 81.5 AIMP1 −9.402 73 90 81.5 CD44 −10.21 79 85 82 HSPA9 −10.168 78 86 82 CD8A −10.988 86 79 82.5 ERP44 −7.981 65 100 82.5 ITGB3 −13.483 106 60 83 TMX3 −12.816 103 64 83.5 USP14 −11.619 97 71 84 CD27 −7.169 57 111 84 C1QBP −9.227 77 92 84.5 FERMT3 −8.337 72 97 84.5 PEBP1 −7.934 66 103 84.5 GPR160 −12.901 109 63 86 IL18R1 −11.684 102 70 86 ANXA5 −10.769 90 82 86 IDE −9.306 95 91 93 LYST −10.055 100 87 93.5 CD2BP2 −7.848 85 105 95 SCARB2 −11.036 114 78 96 LY75 −10.847 112 80 96 IFNG −10.788 115 81 98 SEMA4D −8.169 98 98 98 ITGB2 −7.109 84 112 98 FLOT2 −10.567 116 84 100 CD96 −7.454 99 107 103 GRN −9.864 123 88 105.5 H13 −4.232 67 144 105.5 ATP5B −9.158 119 93 106 PDLIM2 −7.959 111 101 106 HNRNPU −6.105 91 122 106.5 NCKAP1L −7.248 105 110 107.5 PGRMC1 −8.598 120 96 108 CD226 −7.374 108 108 108 LY6A −5.969 92 125 108.5 GDI2 −4.262 76 143 109.5 SMPD1 −8.841 126 94 110 AAMP −5.882 94 128 111 CD9 −7.854 124 104 114 TNIP1 −7.367 122 109 115.5 ADAM10 −7.667 128 106 117 CD38 −7.94 133 102 117.5 CD74 −8.642 145 95 120 FASL −5.108 107 133 120 PSTPIP1 −4.954 104 137 120.5 CD3E −6.868 132 113 122.5 F2R −6.63 129 117 123 ATP6AP2 −6.121 125 121 123 LSM1 −6.477 131 119 125 TLN1 −2.194 89 164 126.5 PTPRCAP −1.214 80 175 127.5 ERP29 −6.503 138 118 128 CAP1 −6.815 143 114 128.5 CCR5 −6.744 141 116 128.5 CR1L −6.103 136 123 129.5 CCL5 −0.345 70 189 129.5 H2-M3 −5.642 139 130 134.5 IL27RA −5.354 137 132 134.5 SLC3A2 −4.424 127 142 134.5 CD48 −2.79 110 161 135.5 CAST −4.945 135 138 136.5 TNFSF10 −6.763 159 115 137 EZR −2.638 113 162 137.5 NOTCH2 −5.706 147 129 138 ITGAL −1.055 101 177 139 THY1 −3.591 130 149 139.5 CLPTM1 −6.014 156 124 140 IGF2R −6.348 161 120 140.5 CD160 −5.379 151 131 141 CD47 −2.122 117 165 141 LRPAP1 −5.951 157 126 141.5 CD164 −1.546 118 172 145 HMGB1 −1.798 121 170 145.5 CD55 −5.938 166 127 146.5 TRAF3 −5.108 164 134 149 CMTM6 −3.97 152 147 149.5 CD3G −3.555 149 150 149.5 CD6 −3.009 142 157 149.5 ITGA4 −2.818 140 159 149.5 NR3C1 −4.898 162 139 150.5 SBDS −3.682 154 148 151 TGFBR2 −3.089 148 155 151.5 RPS6KB1 −4.584 163 141 152 IL12RB1 −5.039 172 135 153.5 RALA −4.625 169 140 154.5 TSPAN32 −4.996 174 136 155 SPN −3.122 158 154 156 HSPA5 −2.998 155 158 156.5 HSP90AA1 −2.037 146 167 156.5 CD52 −0.714 134 180 157 CD5 −3.346 165 152 158.5 ROCK1 −4.092 173 145 159 PEAR1 −4.013 177 146 161.5 CD37 −0.561 144 182 163 IL2RG −1.145 153 176 164.5 LTB −0.806 150 179 164.5 BST2 −2.813 170 160 165 ICAM1 −3.054 179 156 167.5 STX4A −3.347 185 151 168 CD97 −0.861 160 178 169 SLAMF1 −3.3 187 153 170 IFNAR1 −1.854 175 169 172 B4GALT1 −0.618 171 181 176 CORO1A −0.466 168 187 177.5 GPR174 −2.295 195 163 179 FLT3L −2.047 194 166 180 ICOS −1.965 192 168 180 SYNJ2BP −1.673 190 171 180.5 CCND2 −0.541 178 184 181 B2M −0.551 182 183 182.5 PSEN1 −1.501 196 173 184.5 CD53 0 167 202 184.5 NUP85 −1.259 199 174 186.5 STK10 −0.54 189 185 187 CD3D −0.029 176 199 187.5 HCST −0.043 184 197 190.5 MSN −0.028 181 200 190.5 PTPRC 0 180 203 191.5 ITGB1 −0.385 197 188 192.5 HSPA8 −0.119 193 194 193.5 CD8B1 0 183 204 193.5 MYO9B −0.495 204 186 195 CD28 −0.298 200 190 195 LY6E 0 186 205 195.5 IL4RA −0.253 203 191 197 RPS19 0 188 206 197 NOTCH1 −0.165 205 193 199 CNP −0.048 202 196 199 SELPLG 0 191 207 199 CD247 −0.019 198 201 199.5 DPP4 −0.171 208 192 200 PDE4B −0.081 207 195 201 CD84 −0.038 206 198 202 CD2 0 201 208 204.5 IL16 0 209 209 209 IL17RA 0 210 210 210 CCR7 0 211 211 211 CD69 0 212 212 212
TABLE-US-00006 TABLE 4 Ranked top 100 differentially expressed genes in cluster 7 as compared to all 15 CD8 T cell clusters adj.pval.cluster adj.pval.cluster adj.pval.cluster adj.pval.cluster adj.pval.cluster 1 2 3 4 5 GLDC 0 0 0 0 0 TNFRSF9 0 0 0 0 0 PRF1 0 0 0 0 0 IRF8 0 0 0 0 0 CCRL2 0 0 0 0 0 LAT2 0 0 0 0 0 PCYT1A 0 0 0 0 0 CSF1 0 0 0 0 0 MYO10 0 0 0 0 0 TMPRSS6 0 0 0 0 0 2900026A02RIK 0 0 0 0 0 HAVCR2 0 0 0 0 0 C1QTNF6 0 0 0 0 0 SERPINE2 0 0 0 0 0 ADAM8 0 0 0 0 0 ITGAV 0 0 0 0 0 ADAMTS14 0 0 0 0 0 RGS8 0 0 0 0 0 GPR56 0 0 0 0 0 AA467197 0 0 0 0 0 SLC37A2 0 0 0 0 0 PGLYRP1 0 0 0 0 0 ANXA2 0 0 0 0 0 TNFRSF4 0 0 0 0 0 RBPJ 0 0 0 0 0 LITAF 0 0 0 0 0 HILPDA 0 0 0 −2.032 0 MNDA 0 0 0 0 0 KIT 0 0 0 0 0 GPD2 0 0 0 0 0 IL1R2 0 0 0 0 0 RGS16 0 0 0 0 0 PLEK 0 0 0 0 0 DSCAM 0 0 0 0 0 EPAS1 0 0 0 0 0 NABP1 0 0 0 0 0 SLC16A11 0 0 0 0 0 GZMF 0 0 0 0 0 IKZF2 0 0 0 0 0 CD244 0 0 0 0 0 GZMC 0 0 0 0 0 CDK6 0 0 0 0 0 SERPINB9 0 0 0 0 0 GEM 0 0 0 0 0 LAG3 0 0 0 0 0 SLC2A3 0 0 0 0 0 UBASH3B 0 0 0 0 0 NRGN 0 0 0 0 0 CCL3 0 0 0 0 0 GAPDH 0 0 0 0 0 PLAC8 0 0 0 0 0 FOXRED2 0 0 0 0 0 GZMB 0 0 0 0 0 FILIP1 0 0 0 0 0 RGS2 0 0 0 −0.462 0 EXPH5 0 0 0 0 0 SRGAP3 0 0 0 0 0 GM5177 0 0 0 0 0 MT1 0 0 0 0 0 TPI1 0 0 0 0 0 ACOT7 0 0 0 0 0 BHLHE40 0 0 0 0 0 CCNG1 0 0 0 0 0 FAM110A 0 0 0 0 0 S100A11 0 0 0 0 0 DUSP4 0 0 0 0 0 CAPG 0 0 0 0 0 FAM3C 0 0 0 0 0 NR4A2 0 0 0 0 0 TFF1 0 0 0 0 0 IMPA2 0 0 0 0 0 NRP1 0 0 0 0 0 CST7 0 0 0 0 0 PLXND1 0 0 0 0 0 PKM 0 0 0 0 0 STAT3 0 0 0 0 0 CXCR6 0 0 0 −0.53 0 GDPD5 0 0 0 0 0 CCR8 0 0 0 0 0 SMIM3 0 0 0 0 0 ARL14EP 0 0 0 0 0 ERGIC1 0 0 0 0 0 ID2 0 0 0 0 0 EHD1 0 0 0 0 0 CX3CR1 0 0 0 0 0 CASP3 0 0 0 0 0 NRN1 0 0 0 0 0 PEX16 0 0 0 0 0 HNRNPA1 0 0 0 0 0 FDX1 0 0 0 0 0 OSBPL3 0 0 0 0 0 GZME 0 0 0 0 0 CIAPIN1 0 0 0 0 0 SAMSN1 0 0 0 0 0 ALDOA 0 0 0 0 0 TUBB6 0 0 0 0 0 IL2RB 0 0 0 0 0 GZMD 0 0 0 0 0 UHRF2 0 0 0 0 0 adj.pval.cluster adj.pval.cluster adj.pval.cluster adj.pval.cluster adj.pval.cluster 6 7 8 9 10 GLDC 0 −85.741 −0.349 −8.74 −5.177 TNFRSF9 0 −74.603 −5.868 −9.018 −6.921 PRF1 −1.31 −70.08 0 −8.936 −6.49 IRF8 0 −60.58 −8.638 −11.165 −5.51 CCRL2 0 −57.892 −0.224 −14.77 −4.152 LAT2 0 −57.892 −0.572 −10.136 −2.469 PCYT1A 0 −57.84 −0.662 −11.248 −2.084 CSF1 0 −56.864 −5.975 −6.433 −2.708 MYO10 0 −54.348 −1.064 −1.523 −1.588 TMPRSS6 0 −53.736 0 −3.033 −4.619 2900026A02RIK −0.094 −53.112 −0.364 −7.417 −8.528 HAVCR2 −5.269 −51.383 0 −16.568 −11.845 C1QTNF6 0 −51.184 −0.046 −5.849 −8.317 SERPINE2 0 −51.019 −1.886 −10.282 −1.85 ADAM8 −0.568 −50.88 0 −13.585 −3.536 ITGAV 0 −50.642 −5.945 −8.788 −6.619 ADAMTS14 0 −49.686 −0.611 −5.926 −9.936 RGS8 0 −47.201 −0.241 −5.434 −8.407 GPR56 −11.808 −44.618 0 −7.91 −8.024 AA467197 0 −43.648 −0.129 −3.303 −2.284 SLC37A2 0 −43.31 −0.479 −1.185 −5.219 PGLYRP1 0 −43.178 −5.804 −13.116 −7.444 ANXA2 −4.007 −43.087 −7.039 −17.945 −7.336 TNFRSF4 0 −42.493 −37.64 −6.475 −1.862 RBPJ 0 −42.315 −9.234 −5.337 −3.259 LITAF −3.899 −41.548 −3.66 −13.046 −7.349 HILPDA 0 −41.529 −0.028 −4.275 −6.589 MNDA 0 −40.982 −10.506 −8.14 −0.138 KIT 0 −40.679 −22.015 −0.725 −3.094 GPD2 0 −40.178 −0.519 −13.917 −7.064 IL1R2 0 −40.178 −9.473 −0.35 0 RGS16 −9.843 −39.659 −3.736 −22.439 −12.941 PLEK −1.487 −39.004 −2.892 −10.591 −8.925 DSCAM 0 −38.384 −2.139 −8.24 −5.086 EPAS1 0 −38.289 −0.12 −4.994 −2.887 NABP1 0 −38.264 −0.256 −4.082 −3.117 SLC16A11 0 −38.005 −14.163 −4.89 −1.423 GZMF 0 −37.709 0 −1.555 −0.551 IKZF2 0 −37.446 −10.474 −4.472 −3.435 CD244 0 −37.285 0 −10.792 −12.777 GZMC 0 −37.022 −0.047 −3.473 −0.97 CDK6 −0.679 −36.931 0 −3.291 −11.204 SERPINB9 0 −36.781 −0.198 −6.539 −2.276 GEM 0 −36.705 −2.772 −7.375 −1.815 LAG3 −10.838 −36.69 −24.857 −4.285 −9.648 SLC2A3 0 −36.69 −0.858 −5.126 −0.392 UBASH3B −1.011 −35.97 −1.123 −9.111 −2.621 NRGN 0 −35.762 −16.934 −6.835 −1.884 CCL3 −1.341 −35.708 0 −7.774 −2.31 GAPDH −3.878 −35.534 −1.651 −28.733 −14.377 PLAC8 −0.15 −35.511 0 −12.622 −3.435 FOXRED2 0 −35.48 −0.706 −4.364 −10.171 GZMB −17.027 −35.205 0 −17.517 −9.369 FILIP1 0 −34.687 0 −5.945 −2.659 RGS2 0 −34.658 −4.62 −6.204 −2.36 EXPH5 0 −34.452 −3.942 −1.893 −0.23 SRGAP3 0 −34.118 −0.864 −6.231 −5.259 GM5177 −1.85 −33.888 −2.021 −26.362 −13.092 MT1 0 −33.823 0 −12.657 −10.364 TPI1 0 −32.629 −2.816 −21.536 −12.198 ACOT7 0 −32.602 −9.357 −6.331 −9.956 BHLHE40 −0.301 −32.471 −34.275 −4.262 −0.569 CCNG1 0 −32.322 −0.599 −10.943 −5.354 FAM110A 0 −32.314 −3.177 −12.491 −6.369 S100A11 −2.849 −32.158 −2.028 −10.953 −5.371 DUSP4 0 −31.906 −22.596 −2.854 −4.287 CAPG 0 −31.567 −16.812 −3.977 −1.984 FAM3C 0 −31.563 −2.316 −9.625 −8.321 NR4A2 −1.781 −31.351 −10.637 −8.09 −7.402 TFF1 0 −30.862 −4.387 −2.848 −4.229 IMPA2 0 −30.742 −2.661 −20.435 −11.402 NRP1 0 −30.537 −30.902 −2.005 −4.848 CST7 0 −30.448 −8.982 −1.397 −2.186 PLXND1 0 −30.229 −0.273 −5.416 −2.422 PKM 0 −29.958 −0.613 −12.041 −9.718 STAT3 0 −29.78 −4.825 −1.639 −1.529 CXCR6 −17.027 −29.649 0 −2.242 −10.395 GDPD5 0 −29.436 −4.136 −4.718 −1.394 CCR8 0 −29.292 −36.056 −1.86 −0.433 SMIM3 0 −29.22 −6.398 −14.507 −0.831 ARL14EP 0 −29.195 −9.693 −12.507 −5.873 ERGIC1 0 −29.048 −4.429 −5.476 −8.829 ID2 −3.382 −29 0 −4.316 −3.54 EHD1 −0.727 −28.975 −1.406 −6.07 −2.538 CX3CR1 0 −28.883 −4.262 −11.074 −1.089 CASP3 −8.408 −28.856 −0.755 −13.285 −15.872 NRN1 0 −28.795 −39.128 −4.33 −1.816 PEX16 0 −28.699 −2.777 −2.117 −1.075 HNRNPA1 0 −28.44 −1.621 −11.938 −8.143 FDX1 0 −28.187 −1.805 −14.381 −4.935 OSBPL3 −5.169 −28.093 −0.769 −16.399 −10.473 GZME 0 −28.084 0 −1.257 −0.075 CIAPIN1 −0.55 −27.949 −3.79 −6.224 −8.771 SAMSN1 −0.812 −27.927 −5.485 −9.544 −4.631 ALDOA −5.221 −27.783 −0.04 −3.877 −2.09 TUBB6 0 −27.679 0 −27.279 −5.756 IL2RB −5.313 −27.616 −0.082 −2.376 −5.386 GZMD 0 −27.52 0 −1.044 −0.241 UHRF2 0 −27.41 −1.698 −7.039 −3.537 adj.pval.cluster adj.pval.cluster adj.pval.cluster adj.pval.cluster adj.pval.cluster 11 12 13 14 15 GLDC −0.001 −0.109 0 0 −1.259 TNFRSF9 −0.27 −15.96 0 0 −0.619 PRF1 −0.001 −1.811 0 0 −0.032 IRF8 −0.001 −13.999 0 0 −0.83 CCRL2 −0.001 0 0 0 −0.091 LAT2 −0.001 0 0 0 −0.049 PCYT1A −0.001 −0.683 0 0 −0.336 CSF1 −0.001 0 0 0 −0.198 MYO10 −0.001 0 0 0 −0.063 TMPRSS6 −0.001 0 0 0 −0.008 2900026A02RIK −0.001 0 0 0 −0.051 HAVCR2 −0.001 −3.738 0 0 0 C1QTNF6 −0.001 0 0 0 −0.048 SERPINE2 −0.001 0 0 0 −1.4 ADAM8 −0.001 −0.079 0 −1.071 −0.132 ITGAV −0.001 −5.295 0 0 −0.93 ADAMTS14 −0.001 −0.273 −0.141 0 −0.294 RGS8 −0.001 0 −0.141 0 −0.032 GPR56 −0.001 −0.171 0 0 −0.011 AA467197 −0.001 0 0 −0.152 −0.006 SLC37A2 −0.001 0 0 0 −0.225 PGLYRP1 −0.001 0 0 0 −0.597 ANXA2 −0.252 −0.485 0 −0.065 −1.032 TNFRSF4 −0.093 −5.661 0 0 −4.988 RBPJ −0.001 −5.328 0 0 −1.932 LITAF −0.001 −0.137 0 0 −1.067 HILPDA −0.001 −0.247 0 0 −0.493 MNDA −0.001 −0.022 0 0 −1.517 KIT −0.001 −0.022 0 0 −0.121 GPD2 −0.001 −1.482 0 0 −0.483 IL1R2 −0.001 −0.517 0 −0.697 −5.067 RGS16 −0.095 −2.418 −0.595 0 −0.986 PLEK −0.001 −7.355 0 0 −0.548 DSCAM −0.001 0 −0.438 0 −0.461 EPAS1 −0.001 −0.023 −0.184 0 −0.233 NABP1 −0.001 −0.877 0 0 −0.04 SLC16A11 −0.001 0 0 0 −1.047 GZMF −0.001 −0.002 0 0 −0.052 IKZF2 −0.001 −0.15 0 0 −1.383 CD244 −0.001 0 0 0 −0.012 GZMC −0.001 0 0 −0.326 −0.088 CDK6 −0.001 −3.568 0 0 −0.434 SERPINB9 −0.001 −1.839 0 0 −0.411 GEM −0.001 0 0 0 −0.647 LAG3 −0.108 −4.982 0 0 −1.917 SLC2A3 −0.001 −0.46 0 0 −0.668 UBASH3B −0.001 −3.389 0 0 −0.022 NRGN −0.001 0 −0.069 0 −3.422 CCL3 −0.001 −10.724 0 0 −0.093 GAPDH −0.417 −4.935 0 0 −1.463 PLAC8 −0.001 0 0 0 0 FOXRED2 −0.001 −0.4 0 0 −0.252 GZMB −0.001 −0.426 0 0 0 FILIP1 −0.001 −0.039 0 0 −0.068 RGS2 −0.001 0 0 0 −0.672 EXPH5 −0.001 −0.184 −0.485 0 −1.176 SRGAP3 −0.001 −0.701 0 0 −0.018 GM5177 −0.432 −4.98 0 0 −1.502 MT1 −0.001 −0.183 0 0 −0.232 TPI1 −0.09 −3.506 0 0 −2.568 ACOT7 −0.001 −0.436 0 −2.29 −2.183 BHLHE40 −0.125 −4.679 0 0 −1.518 CCNG1 −0.001 0 0 0 −0.919 FAM110A −0.001 −2.034 0 0 −1.327 S100A11 −0.001 0 0 0 −0.729 DUSP4 −0.001 −9.348 0 0 −2.344 CAPG −0.001 0 0 −0.408 −2.146 FAM3C −0.001 −0.472 0 0 −0.726 NR4A2 −0.001 −1.067 −0.279 0 −0.99 TFF1 −0.001 0 0 −0.185 −0.85 IMPA2 −0.001 0 0 −0.066 −1.337 NRP1 0 −2.099 0 −3.231 −3.686 CST7 −0.001 −1.396 0 0 −0.093 PLXND1 −0.001 0 0 0 −0.068 PKM −0.001 −6.583 0 0 −1.77 STAT3 −0.496 −10.55 −1.172 0 −0.553 CXCR6 −0.001 −0.018 0 0 0 GDPD5 −0.001 −0.882 0 −2.974 −2.711 CCR8 −0.001 −1.64 0 0 −2.288 SMIM3 −0.001 −0.51 0 −1.908 −1.071 ARL14EP −0.001 −0.244 0 0 −3.948 ERGIC1 −0.022 −7.328 0 0 −1.126 ID2 −0.001 −0.416 0 0 −0.061 EHD1 −0.001 −4.721 0 0 −0.262 CX3CR1 −0.001 −0.17 0 0 −0.165 CASP3 −0.001 −1.659 0 0 −2.174 NRN1 −0.001 −0.014 0 0 −5.958 PEX16 −0.001 0 0 −1.498 −0.78 HNRNPA1 −0.055 −7.899 0 0 −2.267 FDX1 −0.001 0 0 0 −1.121 OSBPL3 −0.001 −0.386 0 0 −0.401 GZME −0.001 0 0 −0.472 −0.068 CIAPIN1 −0.001 −1.959 0 0 −0.719 SAMSN1 −0.001 −2.181 0 −0.061 −0.308 ALDOA −0.001 −2.078 0 0 −0.055 TUBB6 −0.001 0 0 −9.47 −4.64 IL2RB −0.001 0 0 0 −0.001 GZMD −0.001 0 0 0 −0.072 UHRF2 −0.001 −0.063 0 0 −1.752
TABLE-US-00007 TABLE 5 Cluster 7 Specific Gene Signature 0 8 9 10 rank_0 rank_8 rank_9 rank_10 mean_rank TNFRSF9 −91.791 14.331 14.793 13.779 2 6 1 1 2.5 PRF1 −79.24 29.216 13.275 −11.21 6 1 2 2 2.75 GLDC 113.856 14.208 −7.744 −8.202 1 7 5 5 4.5 IRF8 −83.708 −4.672 −7.942 −9.831 4 44 4 3 13.75 ADAM8 −63.45 16.254 −3.094 −6.172 18 4 36 9 16.75 SERPINB9 −43.259 11.006 −4.253 −6.666 36 15 18 6 18.75 LAT2 −78.786 −8.281 −3.519 −5.725 8 24 30 13 18.75 CCRL2 −79.074 12.487 −2.528 −6.172 7 12 48 11 19.5 NABP1 −45.027 −9.903 −6.648 −5.353 34 19 7 19 19.75 HILPDA −50.028 −12.93 −6.973 −3.258 27 10 6 38 20.25 SLC2A3 −42.969 −7.103 −4.913 −8.887 38 28 13 4 20.75 PCYT1A −79.651 −8.38 −2.581 −5.38 5 23 45 18 22.75 2900026A02RIK −71.856 10.685 −3.96 −2.875 11 16 23 41 22.75 TMPRSS6 −67.607 10.618 −4.739 −2.384 15 17 15 55 25.5 MYO10 −70.953 −5.129 −4.707 −3.772 14 40 16 33 25.75 ID2 −32.463 12.505 −5.358 −3.609 47 11 12 36 26.5 RBPJ −57.177 −1.82 −5.411 −6.536 21 67 11 8 26.75 ITGAV −71.527 −5.709 −3.643 −3.728 13 35 26 34 27 STAT3 −34.747 −2.777 −8.191 −6.615 45 55 3 7 27.5 LITAF −55.012 −6.153 −2.705 −6.172 26 33 44 10 28.25 SERPINE2 −73.535 −5.105 −2.535 −5.436 9 42 47 16 28.5 PGLYRP1 −59.204 −4.039 −3.643 −5.014 19 47 27 21 28.5 ALDOA −31.109 12.007 −3.074 −5.422 48 13 37 17 28.75 CSF1 −87.97 −2.774 −3.364 −4.438 3 56 32 25 29 GEM −47.97 −4.672 −3.388 −5.711 28 45 31 14 29.5 HAVCR2 −64.475 28.612 −2.425 −2.598 17 2 50 49 29.5 IL2RB −30.885 11.694 −5.935 −2.605 49 14 9 47 29.75 EPAS1 −47.895 −9.44 −3.336 −3.315 29 21 33 37 30 AA467197 −55.604 −7.01 −3.64 −3 24 29 28 40 30.25 RGS2 −45.144 −3.008 −4.105 −5.039 33 53 19 20 31.25 LILRB4 −30.192 −8.596 −5.464 −2.766 50 22 10 43 31.25 SLC37A2 −55.738 −6.098 −5.942 −2.076 23 34 8 61 31.5 UBASH3B −46.981 −6.695 −2.92 −4.125 30 31 41 29 32.75 SH2D2A −22.905 13.497 −3.954 −3.078 62 9 24 39 33.5 CCL3 −42.757 13.952 −2.096 −3.705 40 8 54 35 34.25 PLAC8 −42.778 15.592 −1.435 −4.693 39 5 72 22 34.5 ANXA2 −57.193 −5.113 −1.633 −6.172 20 41 66 12 34.75 GPR56 −55.013 20.844 −2.995 −1.571 25 3 40 73 35.25 ADAMTS14 −71.564 −7.445 −3.954 −1.436 12 27 25 78 35.5 BCL2L11 −27.381 −4.72 −4.051 −4.63 56 43 21 24 36 PEX16 −36.099 −2.394 −4.791 −4.42 44 60 14 26 36 C1QTNF6 −71.908 10.129 −2.852 −1.567 10 18 42 74 36 EHD1 −36.304 −5.416 −3.159 −3.847 43 36 35 31 36.25 RGS8 −67.32 −7.49 −3.585 −1.429 16 25 29 79 37.25 S100A11 −40.349 −6.891 −2.113 −3.933 42 30 53 30 38.75 GPD2 −56.588 −9.512 −1.734 −1.998 22 20 62 62 41.5 GZMC −46.719 −5.383 −1.956 −2.723 32 37 56 44 42.25 DENND4A −17.686 −2.592 −4.01 −4.635 70 57 22 23 43 EXPH5 −46.88 −1.602 −2.757 −4.261 31 71 43 28 43.25 CBLB −15.239 −6.307 −4.266 −2.107 72 32 17 59 45 GZMF −42.15 −5.285 −2.132 −2.474 41 38 52 51 45.5 CCNG1 −43.191 −7.49 −1.353 −2.419 37 26 79 53 48.75 SERPINB6B −27.486 −1.621 −1.918 −5.66 55 70 57 15 49.25 IL12RB2 −29.107 −2.489 −1.779 −4.264 52 58 61 27 49.5 GDPD5 −43.403 −1.575 −1.85 −2.683 35 72 59 45 52.75 RPS2 −11.518 −2.415 −2.998 −2.774 75 59 39 42 53.75 SLC25A4 −22.912 −2.934 −4.07 −1.377 61 54 20 80 53.75 GIPC2 −34.711 −1.384 −2.169 −2.605 46 75 51 48 55 LPIN2 −26.773 −3.391 −1.581 −2.621 57 50 69 46 55.5 GZME −28.851 −3.604 −1.388 −2.41 54 48 76 54 58 MAP3K1 −11.979 −2.207 −3.043 −2.217 74 63 38 58 58.25 DGAT1 −18.408 −4.261 −1.786 −1.994 69 46 60 63 59.5 RARA −7.991 −2.277 −3.295 −1.733 78 61 34 68 60.25 RIOK1 −15.921 −5.188 −1.96 −1.523 71 39 55 77 60.5 AI662270 −19.804 −3.455 −1.376 −2.526 67 49 77 50 60.75 NPNT −28.907 −1.748 −1.677 −2.32 53 68 65 57 60.75 GZMD −29.386 −3.315 −1.399 −1.823 51 52 73 67 60.75 ADCK3 −21.125 −1.311 −2.528 −2.436 64 80 49 52 61.25 SDCBP2 −26.342 −3.357 −1.395 −1.836 58 51 74 66 62.25 MVP −20.821 −1.34 −1.393 −3.779 65 78 75 32 62.5 TRAF4 −19.908 −1.884 −1.454 −2.337 66 65 70 56 64.25 CALR −24.033 −2.21 −1.376 −2.091 60 62 78 60 65 SKIL −8.274 −2.069 −2.539 −1.532 77 64 46 76 65.75 FUZ −21.768 −1.404 −1.86 −1.588 63 74 58 70 66.25 OSR2 −18.773 −1.73 −1.697 −1.588 68 69 64 71 68 ZC3H12C −26.294 −1.322 −1.436 −1.855 59 79 71 65 68.5 FNDC3A −9.517 −1.378 −1.701 −1.957 76 77 63 64 70 ZFP296 −12.662 −1.822 −1.62 −1.545 73 66 67 75 70.25 FXYD5 −3.349 −1.494 −1.614 −1.58 80 73 68 72 73.25 CD3E −7.741 −1.383 −1.336 −1.615 79 76 80 69 76
TABLE-US-00008 TABLE 6 Cluster 8 Specific Gene Signature 0 7 9 10 rank_0 rank_7 rank_9 rank_10 mean_rank XCL1 −78.965 −29.841 −24.436 −20.16 2 1 1 3 1.75 CD83 −88.362 −15.592 −20.823 −22.072 1 7 3 2 3.25 CRTAM −33.776 −14.059 −12.701 −15.302 19 8 11 6 11 CCR7 −18.368 −21.529 −23.19 −28.251 41 2 2 1 11.5 PLXDC2 −71.452 −9.421 −11.795 −10.375 3 17 12 19 12.75 TNFSF8 −24.19 −15.693 −13.869 −11.662 29 6 7 13 13.75 ITGB1 −24.198 −15.992 −10.416 −12.554 28 5 16 10 14.75 LAD1 −55.63 −6.096 −9.452 −12.126 8 33 20 11 18 BACE2 −69.074 −8.157 −9.459 −7.48 4 21 19 34 19.5 DAPL1 −13.482 −18.487 −13.608 −11.095 52 4 9 17 20.5 NFKBIA −16.006 −7.19 −10.896 −15.26 44 27 14 8 23.25 RAMP3 −34.608 −8.003 −8.408 −9.242 18 23 27 26 23.5 BHLHE40 −42.042 −2.784 −13.721 −18.354 14 70 8 4 24 ZFP36L1 −6.392 −12.969 −14.084 −15.601 81 10 6 5 25.5 MS4A4C −11.437 −13.198 −8.726 −10.831 58 9 25 18 27.5 CD82 −23.206 −3.998 −15.113 −9.885 32 51 5 22 27.5 GPM6B −57.374 −3.421 −9.528 −8.458 7 58 18 29 28 TNFSF11 −36.834 −9.097 −10.238 −5.111 17 18 17 67 29.75 TNFRSF18 −30.082 −2.855 −10.896 −11.284 23 68 15 16 30.5 BCL6 −21.408 −10.089 −7.222 −8.015 36 14 40 32 30.5 DUSP1 −14.369 −8.166 −9.038 −7.455 49 20 22 35 31.5 CD81 −49.127 −7.93 −5.697 −7.028 11 24 54 43 33 CD74 −51.295 −4.662 −8.008 −6.573 9 47 32 47 33.75 TBC1D4 −25.573 −6.179 −6.977 −7.4 26 32 45 37 35 TNFRSF4 −60.701 −1.854 −8.088 −11.56 6 97 30 14 36.75 SAT1 −12.105 −5.073 −8.132 −10.182 57 41 28 21 36.75 SLAMF6 −8.565 −18.545 −6.896 −8.584 71 3 48 28 37.5 ZC3H12D −19.725 −5.207 −5.383 −11.679 40 39 61 12 38 TRAF1 −20.148 −2.371 −7.982 −15.302 38 75 33 7 38.25 TNFSF14 −12.7 −10.057 −7.055 −6.816 55 15 43 45 39.5 NRN1 −65.513 −2.043 −7.482 −7.788 5 87 37 33 40.5 SYNPO −33.308 −6.868 −6.115 −5.708 20 28 52 62 40.5 CD160 −25.982 −5.073 −8.529 −4.497 25 40 26 75 41.5 KLRK1 −22.898 −2.81 −6.977 −9.685 33 69 46 23 42.75 GRAMD1B −23.425 −7.52 −3.543 −7.442 30 25 80 36 42.75 JUNB −1.558 −4.775 −17.825 −13.964 116 45 4 9 43.5 ARAP2 −15.032 −6.868 −7.826 −5.523 48 29 34 65 44 REL −24.382 −3.171 −5.587 −7.202 27 63 56 39 46.25 SPRY2 −45.566 −1.864 −6.899 −8.152 13 96 47 31 46.75 CPNE8 −1.962 −5.508 −8.096 −11.307 110 37 29 15 47.75 NDFIP1 −17.485 −1.877 −7.288 −9.401 43 94 39 25 50.25 BACH2 −6.88 −5.282 −7.776 −6.197 77 38 35 51 50.25 RPL34-PS1 −2.54 −4.801 −11.304 −7.216 107 44 13 38 50.5 RAB37 −9.84 −11.336 −3.886 −6.153 63 13 74 52 50.5 SLC2A6 −38.243 −4.75 −3.903 −5.078 16 46 72 68 50.5 NRP1 −47.337 −1.333 −9.082 −6.03 12 116 21 54 50.75 SDF4 −21.778 −1.66 −7.185 −8.659 35 104 41 27 51.75 CXXC5 −20.248 −6.361 −5.486 −4.019 37 31 60 81 52.25 1700019D03RIK −50.655 −1.905 −4.792 −7.012 10 91 66 44 52.75 2310001H17RIK −15.603 −8.427 −3.388 −5.691 46 19 84 63 53 RPL7 −3.694 −3.536 −13.608 −6.234 100 56 10 49 53.75 SAMD3 −8.112 −11.786 −3.879 −5.736 72 12 75 59 54.5 CTSW −4.513 −9.713 −7.546 −4.974 98 16 36 70 55 FAM53B −7.148 −6.806 −5.644 −4.785 75 30 55 73 58.25 TESPA1 −3.511 −12.574 −3.721 −6.637 101 11 77 46 58.75 PFDN5 −6.67 −3.872 −6.46 −5.736 78 52 50 58 59.5 BTLA −9.134 −6.064 −4.655 −4.888 67 34 67 71 59.75 SESN3 −7.815 −4.637 −5.566 −5.718 73 48 58 61 60 TGIF1 −9.583 −2.202 −4.807 −8.312 64 82 65 30 60.25 JUN −8.569 −3.411 −5.012 −6.202 70 59 63 50 60.5 CD37 −4.975 −3.728 −7.175 −5.924 92 53 42 55 60.5 FAS −5.692 −8.037 −3.888 −5.523 84 22 73 66 61.25 ST6GAL1 −3.123 −5.516 −6.458 −5.769 105 36 51 56 62 LTA −15.725 −2.871 −5.57 −4.304 45 67 57 79 62 CALCOCO1 −13.449 −1.752 −5.799 −6.305 53 98 53 48 63 TNFAIP3 −1.882 −2.684 −7.055 −9.626 113 72 44 24 63.25 RPS15A-PS6 −5.402 −2.319 −8.778 −5.006 86 78 24 69 64.25 CD9 −26.185 −2.184 −1.607 −7.173 24 83 111 40 64.5 GUCY1A3 −31.31 −3.185 −3.772 −2.615 21 62 76 101 65 RPL29 −4.605 −3.279 −6.896 −5.736 95 61 49 57 65.5 SDC4 −30.372 −1.453 −4.837 −4.814 22 109 64 72 66.75 PENK −38.625 −1.936 −3.608 −3.791 15 89 79 85 67 NFKBIZ −2.299 −4.07 −2.907 −10.277 108 50 95 20 68.25 RPS15A −5.036 −1.752 −9.013 −5.639 90 99 23 64 69 RPS15A-PS4 −5.192 −2.072 −8.063 −4.42 87 84 31 77 69.75 LRIG1 −7.284 −4.928 −4.075 −3.25 74 42 71 93 70 SSH1 −22.485 −1.425 −2.485 −7.106 34 110 99 41 71 PAIP2 −6.132 −2.346 −3.453 −7.105 83 76 83 42 71 SLA −9.49 −5.667 −2.994 −3.335 65 35 94 91 71.25 ASAP1 −5.046 −7.354 −3.363 −3.469 88 26 85 88 71.75 EEF1B2 −4.603 −2.394 −7.394 −3.964 96 74 38 82 72.5 RAF1 −13.043 −3.641 −2.426 −3.964 54 55 100 83 73 CPNE3 −6.527 −3.394 −3.713 −4.447 79 60 78 76 73.25 ABCA3 −9.907 −3.43 −3.055 −3.883 62 57 91 84 73.5 TSPAN32 −23.34 −2.212 −1.847 −4.762 31 80 110 74 73.75 B4GALNT1 −10.134 −1.571 −3.252 −6.072 61 106 89 53 77.25 SIGIRR −8.915 −2.065 −1.966 −5.736 68 86 107 60 80.25 RORA −12.639 −1.721 −4.402 −2.504 56 100 69 104 82.25 EGR2 −10.901 −2.319 −1.38 −4.384 60 77 117 78 83 AFF3 −1.421 −4.9 −3.291 −3.708 117 43 87 87 83.5 CXCR5 −3.297 −4.07 −3.128 −2.941 102 49 90 95 84 H2-OA −14.122 −1.566 −3.314 −3.25 50 107 86 94 84.25 RNF19A −15.401 −1.669 −2.679 −3.285 47 103 96 92 84.5 KLRI2 −13.58 −2.21 −3.033 −1.385 51 81 93 116 85.25 LANCL1 −19.914 −1.91 −1.567 −2.257 39 90 113 106 87 CAR2 −11.17 −2.931 −1.937 −1.545 59 66 109 114 87 PRNP −5.582 −2.768 −2.659 −2.677 85 71 97 98 87.75 UQCRH −6.526 −1.385 −3.491 −4.15 80 113 82 80 88.75 PTPRK −17.906 −1.408 −1.579 −3.383 42 112 112 89 88.75 RPL35A −1.571 −2.593 −4.636 −2.558 114 73 68 102 89.25 SLC25A42 −3.975 −3.654 −1.996 −2.536 99 54 105 103 90.25 ZHX2 −3.151 −2.256 −4.242 −2.069 104 79 70 108 90.25 PER1 −7.043 −1.381 −3.543 −3.335 76 115 81 90 90.5 RPS25 −3.088 −1.625 −5.538 −2.792 106 105 59 96 91.5 MGAT5 −8.877 −1.708 −3.054 −2.082 69 101 92 107 92.25 NT5E −1.976 −3.026 −3.278 −1.934 109 64 88 111 93 RPSA −1.904 −1.882 −5.333 −1.952 112 93 62 109 94 ZFP467 −6.381 −2.981 −1.522 −1.522 82 65 114 115 94 NFKB1 −9.258 −1.954 −1.455 −1.379 66 88 115 117 96.5 NDUFA6 −4.952 −1.425 −2.376 −3.786 93 111 101 86 97.75 2010015L04RIK −3.282 −2.072 −2.271 −1.92 103 85 102 112 100.5 EPHX1 −5.021 −1.479 −1.977 −2.627 91 108 106 100 101.25 CD3D −1.945 −1.87 −2.066 −2.688 111 95 104 97 101.75 DHRS3 −5.037 −1.901 −1.391 −1.744 89 92 116 113 102.5 GM10548 −4.635 −1.31 −2.09 −2.635 94 117 103 99 103.25 SCP2 −4.523 −1.385 −2.581 −2.345 97 114 98 105 103.5 UTRN −1.565 −1.693 −1.947 −1.946 115 102 108 110 108.75
TABLE-US-00009 TABLE 7 Ranked top transcription factors differentially expressed in cluster 8 Gene TP TN thresh_mhg hyper_pval hyper_qval gen_qval rank_hyper_qval rank_gen_qval mean_rank BHLHE40 0.937062937 0.525613661 8.143 5.56E−31 1.37E−28 −34.275 1 1 1 SPRY2 0.671328671 0.766275347 0.986 3.37E−26 4.15E−24 −30.895 2 2 2 BCL6 0.363636364 0.92529349 2.409 3.05E−20 2.50E−18 −24.943 3 3 3 REL 0.692307692 0.688367129 2.398 3.25E−19 2.00E−17 −19.474 4 4 4 NFKBIA 0.636363636 0.715581644 10.017 5.68E−17 2.33E−15 −16.891 6 5 5.5 NFAT5 0.573426573 0.782283885 1.417 1.35E−18 6.63E−17 −16.854 5 6 5.5 NR4A3 0.664335664 0.677694771 0.604 9.07E−16 3.19E−14 −14.001 7 7 7 CALCOCO1 0.34965035 0.893276414 1.975 2.22E−13 4.97E−12 −12.968 11 8 9.5 KDM2B 0.622377622 0.696905016 1.934 3.97E−14 1.09E−12 −10.571 9 12 10.5 HIF1A 0.846153846 0.44076841 1.014 1.32E−12 2.50E−11 −12.65 13 9 11 RNF19A 0.601398601 0.703308431 1.687 4.25E−13 8.72E−12 −11.762 12 10 11 ZFP36L1 0.818181818 0.5 2.578 2.23E−14 6.85E−13 −10.353 8 16 12 NR4A2 0.811188811 0.473852721 0.595 5.87E−12 1.03E−10 −10.637 14 11 12.5 RORA 0.51048951 0.763073639 0.903 1.13E−11 1.64E−10 −10.539 17 13 15 IKZF2 0.573426573 0.707043757 0.084 2.00E−11 2.74E−10 −10.474 18 15 16.5 BACH2 0.370629371 0.880469584 1.293 2.15E−13 4.97E−12 −8.19 10 23 16.5 JUN 0.573426573 0.712913554 2.154 6.92E−12 1.14E−10 −9.04 15 20 17.5 MNDA 0.20979021 0.950373533 7.663 2.85E−10 3.05E−09 −10.506 23 14 18.5 NFKB2 0.727272727 0.563500534 4.05 1.06E−11 1.62E−10 −8.281 16 22 19 TGIF1 0.713286713 0.566168623 2.82 6.71E−11 7.50E−10 −9.342 22 18 20 RBPJ 0.734265734 0.544290288 0.227 6.51E−11 7.50E−10 −9.234 21 19 20 IRF5 0.307692308 0.893276414 5.865 4.48E−10 4.59E−09 −9.75 24 17 20.5 IRF8 0.636363636 0.644610459 5.574 4.77E−11 5.87E−10 −8.638 20 21 20.5 SQSTM1 0.832167832 0.437566702 8.455 3.04E−11 3.94E−10 −7.861 19 24 21.5 NFKB1 0.559440559 0.696371398 0.642 9.86E−10 8.98E−09 −7.433 27 25 26 PFDN5 0.769230769 0.488794023 8.598 7.83E−10 7.40E−09 −7.298 26 27 26.5 RELB 0.433566434 0.795624333 6.262 2.66E−09 2.26E−08 −6.795 29 29 29 FUBP3 0.405594406 0.808964781 0.367 1.24E−08 8.69E−08 −7.384 35 26 30.5 ELK3 0.34965035 0.851654216 3.559 1.00E−08 7.26E−08 −7.039 34 28 31 DTX3 0.447552448 0.779615795 1.496 6.44E−09 4.95E−08 −6.601 32 30 31 PER1 0.594405594 0.652614728 4.371 6.05E−09 4.80E−08 −6.384 31 31 31 TOX 0.804195804 0.451974386 0.536 4.86E−10 4.78E−09 −4.979 25 40 32.5 RPL7 0.608391608 0.640875133 11.985 4.94E−09 4.05E−08 −5.287 30 36 33 TCF25 0.755244755 0.486659552 6.649 8.57E−09 6.39E−08 −5.271 33 37 35 RUNX2 0.72027972 0.513340448 0.124 3.70E−08 2.39E−07 −5.793 38 33 35.5 STAT5A 0.51048951 0.719850587 3.797 2.06E−08 1.37E−07 −5.447 37 34 35.5 TRPS1 0.426573427 0.778014941 0.214 1.39E−07 8.13E−07 −5.965 42 32 37 JUNB 0.804195804 0.442902882 10.527 1.69E−09 1.49E−08 −3.803 28 47 37.5 STAT3 0.818181818 0.409284952 6.094 1.56E−08 1.07E−07 −4.825 36 41 38.5 NFKBIB 0.657342657 0.573105656 3.442 7.39E−08 4.54E−07 −5 40 39 39.5 FOSB 0.454545455 0.749199573 1.93 3.22E−07 1.76E−06 −5.363 45 35 40 ZC3H15 0.65034965 0.580576307 5.379 6.97E−08 4.40E−07 −4.217 39 45 42 EIF3H 0.972027972 0.160618997 8.3 6.93E−07 3.62E−06 −4.647 47 42 44.5 LITAF 0.769230769 0.452508004 1.104 8.79E−08 5.27E−07 −3.66 41 48 44.5 NFE2L1 0.265734266 0.884738527 4.66 1.93E−06 8.94E−06 −5.245 53 38 45.5 HIVEP1 0.48951049 0.70864461 0.227 1.31E−06 6.63E−06 −4.628 48 43 45.5 NSD1 0.692307692 0.528815368 0.454 2.09E−07 1.20E−06 −3.636 43 49 46 STAT4 0.79020979 0.415154749 3.141 4.24E−07 2.27E−06 −3.552 46 51 48.5 PLRG1 0.272727273 0.889541089 7.45 2.72E−07 1.52E−06 −3.384 44 53 48.5 BATF 0.622377622 0.565635005 1.098 1.01E−05 4.35E−05 −4.344 57 44 50.5 MLLT3 0.538461538 0.654215582 0.345 4.39E−06 1.96E−05 −4.2 55 46 50.5 NACA 0.335664336 0.835645678 10.873 1.32E−06 6.63E−06 −3.506 49 52 50.5 FOSL2 0.748251748 0.441835646 0.214 4.23E−06 1.93E−05 −3.379 54 54 54 HMG20B 0.251748252 0.884738527 5.986 1.20E−05 5.01E−05 −3.553 59 50 54.5 NR4A1 0.587412587 0.607257204 7.138 4.62E−06 2.03E−05 −3.299 56 55 55.5 ATRX 0.594405594 0.59284952 0.189 1.05E−05 4.47E−05 −3.294 58 56 57 SPOP 0.461538462 0.731590181 6.173 1.60E−06 7.82E−06 −2.646 51 63 57 VGLL4 0.608391608 0.595517609 2.254 1.74E−06 8.22E−06 −2.56 52 64 58 CHD4 0.706293706 0.475453575 0.926 1.45E−05 5.94E−05 −3.143 60 57 58.5 ZMIZ1 0.482517483 0.690501601 2.007 2.41E−05 9.14E−05 −2.945 65 59 62 CAND1 0.377622378 0.783351121 1.899 2.01E−05 7.73E−05 −2.707 63 61 62 MED27 0.34965035 0.802027748 4.335 3.55E−05 0.000128279 −2.886 67 60 63.5 CSDA 0.475524476 0.685699039 0.696 7.91E−05 0.000266655 −3.114 72 58 65 NFKBIE 0.237762238 0.892209178 6.61 1.87E−05 7.43E−05 −2.308 62 68 65 MORF4L1 0.846153846 0.308964781 2.242 2.88E−05 0.000107482 −2.521 66 65 65.5 ARID5B 0.265734266 0.8660619 5.459 4.74E−05 0.000169149 −2.35 69 67 68 BTF3 0.979020979 0.123265742 7.6 1.74E−05 7.02E−05 −2.072 61 75 68 GATA3 0.405594406 0.748132337 5.593 7.84E−05 0.000266655 −2.425 73 66 69.5 SMARCE1 0.643356643 0.537886873 3.002 1.98E−05 7.73E−05 −2.036 64 77 70.5 MED24 0.363636364 0.777481323 1.144 0.000165835 0.000503646 −2.65 81 62 71.5 RPL6 0.951048951 0.16488794 10.87 3.51E−05 0.000128279 −1.971 68 80 74 MYSM1 0.559440559 0.60298826 0.585 0.00011387 0.000359127 −2.169 78 71 74.5 LZTR1 0.13986014 0.948772679 7.504 0.000109278 0.000351326 −2.131 76 73 74.5 PBXIP1 0.594405594 0.576307364 3.812 5.59E−05 0.000196549 −1.866 70 83 76.5 MYEF2 0.433566434 0.69850587 0.454 0.000897689 0.002349272 −2.241 94 70 82 HDAC3 0.482517483 0.651013874 0.475 0.001066063 0.002731785 −2.292 96 69 82.5 TLE3 0.531468531 0.611526147 0.176 0.000587785 0.001624665 −2.062 89 76 82.5 EDF1 0.867132867 0.309498399 2.635 1.62E−06 7.82E−06 −1.2 50 115 82.5 HCLS1 0.846153846 0.294557097 0.496 0.000117041 0.000364458 −1.623 79 89 84 JARID2 0.398601399 0.72678762 0.138 0.001215883 0.003083579 −2.075 97 74 85.5 ANAPC11 0.566433566 0.570971185 0.202 0.000996094 0.00257936 −1.985 95 78 86.5 GATAD1 0.034965035 0.996798292 8.116 0.00054503 0.001523606 −1.802 88 85 86.5 ILF3 0.657342657 0.466915688 0.227 0.00246127 0.00582185 −2.156 104 72 88 DPF2 0.426573427 0.721451441 5.761 0.000187098 0.000561294 −1.451 82 94 88 MED15 0.433566434 0.702241195 5.027 0.000643695 0.001759432 −1.72 90 87 88.5 TCF7 0.531468531 0.630202775 0.287 0.000109968 0.000351326 −1.372 77 100 88.5 NFATC1 0.783216783 0.353788687 0.287 0.000425336 0.001202675 −1.508 87 91 89 SMARCB1 0.496503497 0.631803629 0.585 0.001717899 0.004226031 −1.981 100 79 89.5 NT5C 0.692307692 0.45624333 0.918 0.000330403 0.000967609 −1.451 84 95 89.5 SCAND1 0.335664336 0.781216649 1.036 0.001351791 0.003393272 −1.862 98 84 91 HSBP1 0.573426573 0.556029883 0.856 0.001842416 0.004443475 −1.939 102 81 91.5 BTG2 0.699300699 0.463180363 4.946 9.47E−05 0.000314926 −1.269 74 110 92 CALR 0.783216783 0.333511206 0.632 0.002126523 0.005078881 −1.887 103 82 92.5 HDAC1 0.671328671 0.46905016 1.043 0.000701578 0.001875957 −1.45 92 96 94 COPS5 0.335664336 0.788153682 7.241 0.000680003 0.00183825 −1.389 91 99 95 SNW1 0.34965035 0.781216649 6.926 0.00040347 0.001154113 −1.356 86 104 95 PQBP1 0.475524476 0.644610459 0.941 0.002966167 0.006883746 −1.76 106 86 96 KDM5C 0.503496503 0.625400213 0.189 0.001681029 0.004177101 −1.43 99 97 98 GTF2A1 0.398601399 0.7113127 0.176 0.004355241 0.009829259 −1.612 109 90 99.5 HMGB3 0.363636364 0.743863394 0.444 0.004098352 0.009422379 −1.502 107 92 99.5 GTF2E2 0.363636364 0.739060832 1.029 0.005977103 0.01312828 −1.667 112 88 100 PHB2 0.692307692 0.455176094 1.17 0.000361132 0.001045159 −1.132 85 123 104 CAMTA2 0.34965035 0.748132337 0.239 0.007846193 0.01663934 −1.497 116 93 104.5 TOX4 0.20979021 0.882604055 7.013 0.001791234 0.004362807 −1.259 101 111 106 MAX 0.426573427 0.680896478 0.506 0.006075808 0.013226981 −1.362 113 102 107.5 NDUFA13 0.839160839 0.308431163 5.877 7.02E−05 0.00024334 −0.823 71 145 108 NCOA3 0.643356643 0.459978655 0.176 0.010131389 0.020769347 −1.42 120 98 109 GTF2H5 0.496503497 0.612593383 0.88 0.006888713 0.014735857 −1.294 115 109 112 BLOC1S1 0.391608392 0.702774813 0.941 0.012737582 0.024868612 −1.372 126 101 113.5 HDAC7 0.622377622 0.479722519 0.263 0.011272481 0.022729756 −1.34 122 105 113.5 GLRX2 0.258741259 0.850053362 4.508 0.000843321 0.002230719 −0.981 93 134 113.5 COMMD3 0.545454545 0.567235859 1.411 0.005869327 0.013007699 −1.172 111 117 114 CIR1 0.363636364 0.729989328 0.322 0.011602863 0.023018583 −1.332 123 107 115 STAT6 0.601398601 0.510672359 0.163 0.006160575 0.013293872 −1.186 114 116 115 NR1H2 0.58041958 0.536286019 0.575 0.004562854 0.0102042 −1.138 110 122 116 CREM 0.496503497 0.601921025 0.731 0.013604679 0.026352369 −1.327 127 108 117.5 PPIE 0.41958042 0.678762006 1.144 0.011047485 0.022460177 −1.21 121 114 117.5 RELA 0.573426573 0.544290288 0.401 0.004255991 0.009694201 −1.023 108 129 118.5 UBE2K 0.524475524 0.580042689 0.202 0.009728043 0.020280497 −1.15 118 121 119.5 GTF3C1 0.433566434 0.653681964 0.098 0.023036811 0.04136537 −1.361 137 103 120 ING4 0.41958042 0.673959445 0.731 0.015070881 0.02873982 −1.238 129 112 120.5 HSF1 0.391608392 0.693703308 0.536 0.022662307 0.040992113 −1.337 136 106 121 PHF6 0.391608392 0.700640342 0.214 0.01465928 0.028173304 −1.165 128 119 123.5 GTF2F1 0.538461538 0.563500534 0.651 0.011562838 0.023018583 −1.072 124 126 125 RBX1 0.692307692 0.430096051 0.566 0.002500625 0.005858607 −0.814 105 146 125.5 CREBBP 0.468531469 0.63660619 0.163 0.008338674 0.017532597 −0.979 117 135 126 CIZ1 0.377622378 0.708110993 0.239 0.020908084 0.038099176 −1.167 135 118 126.5 MED8 0.321678322 0.762006403 0.774 0.01787206 0.033307021 −1.123 132 124 128 LRRFIP1 0.797202797 0.292422625 0.401 0.012424909 0.024452222 −0.993 125 131 128 NONO 0.853146853 0.284951974 4.189 0.000129207 0.000397311 −0.536 80 178 129 PHF2OL1 0.433566434 0.648879402 0.151 0.030262913 0.052799125 −1.163 141 120 130.5 PFDN1 0.426573427 0.653148346 1.07 0.034580757 0.057127802 −1.233 149 113 131 YBX1 0.643356643 0.445570971 0.029 0.023294215 0.041524471 −1.116 138 125 131.5 AIP 0.58041958 0.514941302 0.411 0.017250076 0.032393272 −0.979 131 136 133.5 STAT5B 0.48951049 0.594450374 0.07 0.030759407 0.053287423 −1.027 142 128 135 NPM1 0.986013986 0.096051227 7.479 0.000105358 0.000345573 −0.355 75 196 135.5 KDM5A 0.594405594 0.502134472 0.084 0.016031586 0.030336694 −0.859 130 142 136 SMARCC2 0.503496503 0.588046958 0.214 0.020605234 0.037827519 −0.92 134 139 136.5 ATF2 0.370629371 0.707577375 0.263 0.031987067 0.054308374 −0.979 144 137 140.5 ZBTB7A 0.426573427 0.648345784 0.163 0.044589518 0.070018891 −1.047 157 127 142 GTF3C2 0.447552448 0.628068303 0.239 0.044686853 0.070018891 −0.991 154 132 143 GTF2A2 0.384615385 0.690501601 0.669 0.03983419 0.06404713 −0.983 153 133 143 UBXN4 0.594405594 0.494130203 0.084 0.025034559 0.044305766 −0.662 139 156 147.5 SND1 0.531468531 0.545891142 0.227 0.044564418 0.070018891 −0.875 155 141 148 CNOT8 0.41958042 0.642475987 0.322 0.081913949 0.118288494 −1.001 170 130 150 SREBF2 0.51048951 0.566702241 0.138 0.044430666 0.070018891 −0.842 156 144 150 YEATS4 0.384615385 0.692636073 0.895 0.035396521 0.058050295 −0.791 150 151 150.5 PML 0.342657343 0.720917823 0.163 0.064815807 0.096634476 −0.973 165 138 151.5 RBL2 0.608391608 0.479722519 0.239 0.025361876 0.04456444 −0.623 140 163 151.5 CDCA4 0.405594406 0.662753469 0.422 0.059530039 0.090397467 −0.813 162 147 154.5 GON4L 0.384615385 0.677161153 0.057 0.078251103 0.114581972 −0.858 168 143 155.5 XBP1 0.405594406 0.662219851 0.401 0.06110584 0.092221084 −0.797 163 148 155.5 LIMD1 0.398601399 0.659551761 0.176 0.094429449 0.130503621 −0.881 178 140 159 C1D 0.405594406 0.661152615 0.516 0.064352513 0.096528769 −0.649 164 157 160.5 MORF4L2 0.482517483 0.597652081 0.651 0.03722153 0.060240108 −0.577 152 170 161 HMGB2 0.839160839 0.295090715 1.84 0.000242843 0.000719752 0 83 242 162.5 UBTF 0.468531469 0.59284952 0.275 0.089063751 0.126645566 −0.723 173 153 163 PNN 0.51048951 0.553361793 0.287 0.082224929 0.118288494 −0.677 171 155 163 HBP1 0.461538462 0.609925293 0.227 0.055986197 0.086620154 −0.605 159 167 163 SSRP1 0.601398601 0.482390608 0.287 0.032011034 0.054308374 −0.519 145 181 163 DR1 0.335664336 0.719850587 0.345 0.094270969 0.130503621 −0.794 177 150 163.5 MTA2 0.713286713 0.364461046 0.345 0.036213597 0.058996985 −0.541 151 176 163.5 PTTG1 0.552447552 0.532017076 0.322 0.031297292 0.053840096 −0.457 143 184 163.5 BUD31 0.503496503 0.564034152 1.449 0.069722873 0.103324258 −0.626 166 162 164 PURB 0.433566434 0.636072572 0.138 0.05876303 0.08978699 −0.592 161 169 165 IRF2 0.531468531 0.551760939 0.356 0.033143696 0.055844858 −0.426 146 187 166.5 CNOT3 0.377622378 0.680896478 0.39 0.089691999 0.126805929 −0.638 174 160 167 MLX 0.356643357 0.703308431 0.722 0.080361563 0.116976004 −0.621 169 165 167 CEBPZ 0.342657343 0.715581644 0.401 0.084334111 0.120617391 −0.622 172 164 168 AES 0.531468531 0.524012807 0.422 0.116424164 0.151536213 −0.795 189 149 169 MKL1 0.496503497 0.585378869 0.176 0.034601799 0.057127802 −0.358 148 194 171 NCOA2 0.405594406 0.653681964 0.084 0.090828883 0.127679459 −0.564 175 174 174.5 AEBP2 0.377622378 0.67022412 0.111 0.140771452 0.180363423 −0.645 192 158 175 GABPB1 0.321678322 0.729989328 0.848 0.108856919 0.144296015 −0.614 184 166 175 BRD8 0.545454545 0.501067236 0.07 0.162139267 0.200433466 −0.783 199 152 175.5 NCOA4 0.370629371 0.68036286 0.275 0.122812686 0.159010109 −0.634 190 161 175.5 TBX21 0.48951049 0.557097118 0.433 0.160233183 0.19907759 −0.712 198 154 176 CCNT2 0.342657343 0.702241195 0.31 0.150742274 0.189196935 −0.642 196 159 177.5 ZRANB2 0.321678322 0.732123799 0.757 0.098695522 0.132672669 −0.568 183 172 177.5 TMF1 0.496503497 0.562966916 0.138 0.098236071 0.132672669 −0.538 182 177 179.5 PHB 0.573426573 0.498399146 0.642 0.058110224 0.08934447 −0.347 160 199 179.5 PA2G4 0.622377622 0.459978655 0.31 0.033847539 0.056642821 −0.194 147 214 180.5 HTATIP2 0.328671329 0.716648879 0.748 0.144962238 0.182875438 −0.599 194 168 181 CCNH 0.377622378 0.673425827 0.506 0.123782177 0.159426259 −0.572 191 171 181 HMGB1 0.944055944 0.120064034 0.356 0.010017874 0.020709218 0 119 243 181 NFYC 0.391608392 0.662219851 0.433 0.112496833 0.147706182 −0.552 188 175 181.5 FUBP1 0.496503497 0.570437567 0.151 0.071287384 0.105010159 −0.353 167 197 182 TCF20 0.587412587 0.469583778 0.084 0.109101865 0.144296015 −0.521 186 179 182.5 SARNP 0.601398601 0.455709712 0.956 0.108011214 0.144296015 −0.503 185 183 184 LDB1 0.41958042 0.635005336 0.516 0.112881147 0.147706182 −0.443 187 185 186 ZMAT2 0.496503497 0.563500534 0.367 0.096095714 0.132064501 −0.35 179 198 188.5 ERH 0.748251748 0.339381003 1.176 0.018546483 0.034304022 0 133 244 188.5 VPS72 0.377622378 0.658484525 0.444 0.21541336 0.25354874 −0.566 209 173 191 CNOT7 0.356643357 0.685165422 0.454 0.172842905 0.211539078 −0.519 200 182 191 SP110 0.741258741 0.330309498 0.214 0.045752596 0.071235054 −0.138 158 224 191 NFX1 0.433566434 0.624866596 0.176 0.097646028 0.132672669 −0.257 181 204 192.5 TET3 0.34965035 0.691568837 0.124 0.175211299 0.2127228 −0.398 202 188 195 SMARCA4 0.503496503 0.532550694 0.202 0.227808254 0.26434354 −0.521 212 180 196 CCNL2 0.65034965 0.408217716 0.496 0.098343384 0.132672669 −0.192 180 215 197.5 PNRC2 0.433566434 0.601921025 0.496 0.227133778 0.26434354 −0.427 211 186 198.5 CXXC1 0.384615385 0.655816435 0.506 0.18685466 0.223137119 −0.369 206 192 199 NFATC3 0.475524476 0.567769477 0.111 0.178923239 0.215760376 −0.358 204 195 199.5 TSG101 0.440559441 0.599252935 0.766 0.198155958 0.235489689 −0.364 207 193 200 ZNRD1 0.321678322 0.711846318 1.406 0.223503921 0.261818879 −0.379 210 191 200.5 PHF5A 0.461538462 0.582710779 0.74 0.172132209 0.211539078 −0.299 201 201 201 DDX54 0.41958042 0.612593383 0.379 0.250025471 0.287412458 −0.396 214 189 201.5 TRIP12 0.468531469 0.575240128 0.084 0.175539547 0.2127228 −0.311 203 200 201.5 MED12 0.447552448 0.599786553 0.124 0.153010283 0.191068679 −0.244 197 206 201.5 RNF7 0.615384615 0.433831377 1.05 0.144881668 0.182875438 −0.232 195 208 201.5 ECD 0.342657343 0.684631804 0.151 0.27796789 0.316574541 −0.396 216 190 203 MBNL1 0.958041958 0.07470651 0.189 0.09250318 0.129294218 −0.031 176 233 204.5 MIER1 0.552447552 0.490394877 0.287 0.1838009 0.22056108 −0.229 205 209 207 SBDS 0.426573427 0.611526147 0.722 0.208171758 0.246203137 −0.216 208 211 209.5 MAZ 0.335664336 0.686766275 0.401 0.318864273 0.356548232 −0.294 220 202 211 TCEA1 0.657342657 0.39167556 0.239 0.142010537 0.181008249 −0.05 193 230 211.5 ILF2 0.370629371 0.657950907 0.299 0.271875058 0.311075648 −0.227 215 210 212.5 XAB2 0.342657343 0.677161153 0.696 0.343455099 0.382307485 −0.243 221 207 214 TCERG1 0.384615385 0.642475987 0.287 0.28597316 0.324190771 −0.21 217 212 214.5 NFYB 0.342657343 0.672358591 0.485 0.388068091 0.4224104 −0.247 226 205 215.5 GTF2B 0.412587413 0.613660619 0.669 0.296079986 0.332582998 −0.204 219 213 216 SREBF1 0.335664336 0.673425827 0.227 0.444408803 0.475324198 −0.285 230 203 216.5 BOLA2 0.335664336 0.68036286 2.444 0.377759743 0.414861146 −0.173 224 217 220.5 MYC 0.342657343 0.671824973 0.333 0.393116468 0.42602049 −0.185 227 216 221.5 RNF166 0.440559441 0.567235859 0.356 0.461339079 0.489178506 −0.17 232 218 225 CNOT1 0.433566434 0.575773746 0.151 0.446822803 0.475837271 −0.165 231 219 225 CDC5L 0.384615385 0.625400213 0.475 0.438399685 0.47094464 −0.156 229 221 225 RBBP4 0.608391608 0.408217716 0.202 0.383247493 0.419017259 −0.131 225 226 225.5 RNF114 0.573426573 0.444503735 0.299 0.372201809 0.410590337 −0.069 222 229 225.5 MED1 0.461538462 0.551227321 0.227 0.416482261 0.449362439 −0.138 228 225 226.5 PSMC3 0.636363636 0.390608324 0.696 0.293008681 0.330642823 −0.025 218 235 226.5 RNPS1 0.587412587 0.446104589 0.748 0.245525482 0.283564642 −0.014 213 240 226.5 SMAD7 0.370629371 0.629669157 0.239 0.530296375 0.555118758 −0.16 235 220 227.5 RUVBL1 0.321678322 0.68036286 0.485 0.513132931 0.539447441 −0.156 234 222 228 RNF44 0.524475524 0.493596585 0.227 0.370922777 0.410590337 −0.031 223 234 228.5 MLXIP 0.398601399 0.584845251 0.202 0.68149627 0.701456412 −0.149 239 223 231 GTF3A 0.377622378 0.620597652 0.848 0.549945672 0.573248455 −0.085 236 228 232 RPL7L1 0.671328671 0.317502668 0.251 0.647171388 0.668925048 −0.119 238 227 232.5 KLF6 0.72027972 0.28601921 0.333 0.478913334 0.505633821 −0.024 233 236 234.5 MLL5 0.608391608 0.372465315 0.163 0.70887087 0.723577735 −0.048 241 231 236 MYBBP1A 0.398601399 0.581109925 0.299 0.711963723 0.723731718 −0.046 242 232 237 TSC22D4 0.503496503 0.485058698 0.356 0.637279135 0.661479609 −0.02 237 238 237.5 TARDBP 0.41958042 0.561366062 0.176 0.701153823 0.718682668 −0.018 240 239 239.5 MED30 0.356643357 0.616328709 1.064 0.766554961 0.776018603 −0.024 243 237 240 IFI35 0.356643357 0.605122732 0.766 0.839261146 0.846140335 −0.004 244 241 242.5 IKZF3 0.545454545 0.41248666 0.263 0.857972288 0.861474216 0 245 245 245 EGR1 0.363636364 0.555496265 0.214 0.976020285 0.976020285 0 246 246 246
TABLE-US-00010 TABLE 8 Ranked top surface cytokines differentially expressed in cluster 8 rank_hyperq Gene TP TN thresh_mhg hyper_pval hyper_qval gen_qval val rank_gen_qval mean_rank XCL1 0.741258741 0.892209178 5.031 2.31E−62 3.55E−60 −85.872 1 1 1 CD83 0.664335664 0.918890075 6.743 9.79E−59 7.54E−57 −80.672 2 2 2 BACE2 0.314685315 0.985058698 5.661 3.92E−36 2.01E−34 −64.954 3 3 3 CD81 0.34965035 0.970117396 7.464 1.28E−32 3.95E−31 −41.599 4 4 4 TNFRSF4 0.622377622 0.842582711 8.793 1.07E−32 3.95E−31 −37.64 5 6 5.5 CD74 0.48951049 0.913020277 3.975 9.03E−32 2.32E−30 −37.012 6 7 6.5 CCR8 0.566433566 0.857524013 4.547 6.52E−29 1.43E−27 −36.056 7 8 7.5 TNFSF11 0.300699301 0.967982924 4.371 4.59E−25 5.44E−24 −40.55 13 5 9 TNFSF8 0.398601399 0.930629669 0.872 2.22E−25 3.42E−24 −34.906 10 9 9.5 NRP1 0.692307692 0.758804696 4.885 1.78E−27 3.04E−26 −30.902 9 10 9.5 LAG3 0.951048951 0.47171825 1.401 9.29E−28 1.79E−26 −24.857 8 13 10.5 CCR7 0.769230769 0.670757737 6.844 4.40E−25 5.44E−24 −26.11 12 11 11.5 ITGB1 0.65034965 0.775346852 7.52 3.42E−25 4.79E−24 −24.519 11 15 13 TNFRSF18 0.93006993 0.464781217 5.798 7.20E−24 7.92E−23 −24.642 14 14 14 CD200 0.440559441 0.886872999 0.632 9.74E−21 8.82E−20 −25.027 17 12 14.5 TNFSF4 0.461538462 0.870330843 3.183 4.63E−20 3.75E−19 −24.486 19 16 17.5 CD160 0.664335664 0.723052295 1.674 3.04E−20 2.61E−19 −21.394 18 18 18 PDCD1 0.965034965 0.398078975 5.024 3.15E−23 3.24E−22 −16.441 15 23 19 KIT 0.454545455 0.869797225 0.379 2.64E−19 1.84E−18 −22.015 22 17 19.5 CD82 0.657342657 0.722518677 9.763 1.55E−19 1.19E−18 −21.225 20 19 19.5 KLRK1 0.818181818 0.562966916 1.956 1.69E−19 1.24E−18 −18.913 21 20 20.5 TIGIT 0.972027972 0.381003202 7.438 6.24E−23 6.01E−22 −14.863 16 26 21 CD9 0.475524476 0.853255069 7.807 8.10E−19 5.43E−18 −18.364 23 21 22 TSPAN32 0.363636364 0.916755603 7.665 1.67E−18 1.07E−17 −16.662 24 22 23 KLRC1 0.832167832 0.51547492 1.828 7.29E−17 4.32E−16 −15.365 26 25 25.5 KLRD1 0.832167832 0.517609392 6.666 4.90E−17 3.02E−16 −12.835 25 29 27 IL2RA 0.391608392 0.879935966 1.664 4.36E−15 2.17E−14 −16.072 31 24 27.5 GABARAPL1 0.517482517 0.798292423 4.788 1.28E−15 6.77E−15 −14.714 29 27 28 IL18R1 0.699300699 0.645677695 2.803 7.51E−16 4.13E−15 −12.642 28 30 29 AXL 0.34965035 0.887940235 0.465 1.16E−12 5.41E−12 −13.839 33 28 30.5 IL18RAP 0.594405594 0.732657417 5.275 3.63E−15 1.86E−14 −11.837 30 31 30.5 KLRC2 0.713286713 0.612059765 2.356 3.24E−14 1.56E−13 −10.905 32 32 32 CTLA4 0.86013986 0.476520811 6.115 1.59E−16 9.08E−16 −8.491 27 37 32 NR4A2 0.811188811 0.473852721 0.595 5.87E−12 2.66E−11 −10.637 34 33 33.5 CD8A 0.853146853 0.394877268 8.687 3.19E−10 1.29E−09 −8.998 38 36 37 ECE1 0.468531469 0.776414088 0.322 5.61E−10 2.06E−09 −9.736 41 34 37.5 GDI2 0.867132867 0.375133404 7.442 3.98E−10 1.53E−09 −9.626 40 35 37.5 FAS 0.321678322 0.882070438 2.534 7.86E−10 2.82E−09 −7.925 43 38 40.5 TNFRSF9 0.734265734 0.55923159 2.104 6.46E−12 2.84E−11 −5.868 35 49 42 CD52 0.657342657 0.601921025 10.995 1.48E−09 4.96E−09 −7.664 46 39 42.5 TNFSF10 0.405594406 0.821237994 3.084 1.18E−09 4.04E−09 −6.28 45 43 44 ITGAV 0.643356643 0.622198506 0.151 5.59E−10 2.06E−09 −5.945 42 46 44 ICOS 0.811188811 0.462646745 0.714 3.18E−11 1.32E−10 −5.503 37 52 44.5 PEBP1 0.853146853 0.419423693 1.664 8.95E−12 3.83E−11 −5.136 36 55 45.5 GYPC 0.307692308 0.878335112 5.377 1.75E−08 5.18E−08 −6.795 52 41 46.5 PRKCA 0.307692308 0.87620064 2.903 2.81E−08 8.01E−08 −7.019 54 40 47 CD37 0.923076923 0.284951974 1.501 1.95E−09 6.40E−09 −5.937 47 47 47 CD96 0.664335664 0.575773746 3.936 2.10E−08 6.11E−08 −5.973 53 45 49 PTGER2 0.391608392 0.808964781 0.678 8.37E−08 2.26E−07 −6.744 57 42 49.5 PGLYRP1 0.741258741 0.498399146 4.224 1.38E−08 4.33E−08 −5.804 49 50 49.5 ANXA5 0.531468531 0.706510139 7.636 9.66E−09 3.10E−08 −5.387 48 53 50.5 ATPIF1 0.573426573 0.665421558 5.814 1.58E−08 4.76E−08 −5.684 51 51 51 CSF1 0.293706294 0.868729989 2.678 9.30E−07 2.27E−06 −5.975 63 44 53.5 GRN 0.363636364 0.820704376 0.536 4.48E−07 1.15E−06 −5.908 60 48 54 LY6E 0.804195804 0.418890075 9.168 3.82E−08 1.05E−07 −4.603 56 56 56 CTSB 0.909090909 0.309498399 0.214 1.16E−09 4.04E−09 −2.478 44 68 56 PTPN11 0.377622378 0.808964781 0.632 5.12E−07 1.27E−06 −5.357 62 54 58 ITGB3 0.27972028 0.884738527 3.894 2.74E−07 7.15E−07 −4.517 59 57 58 CD3G 0.671328671 0.554962647 10.492 1.21E−07 3.22E−07 −3.89 58 59 58.5 BSG 0.839160839 0.376734258 5.705 3.70E−08 1.04E−07 −3.198 55 64 59.5 TMEM123 0.818181818 0.381003202 1.214 4.83E−07 1.22E−06 −3.639 61 61 61 LTB 0.902097902 0.249733191 5.194 7.27E−06 1.62E−05 −3.642 69 60 64.5 CX3CR1 0.391608392 0.77588047 0.287 1.17E−05 2.50E−05 −4.262 72 58 65 CD6 0.776223776 0.406616862 5.365 6.29E−06 1.46E−05 −2.782 66 66 66 SLAMF7 0.314685315 0.843116329 4.72 5.24E−06 1.24E−05 −2.753 65 67 66 LAMP1 0.300699301 0.849519744 4.044 1.02E−05 2.25E−05 −3.446 70 63 66.5 CD27 0.713286713 0.48452508 7.773 2.59E−06 6.24E−06 −2.34 64 70 67 TNIP1 0.531468531 0.651013874 2.457 1.31E−05 2.76E−05 −3.065 73 65 69 LGALS1 0.972027972 0.21398079 3.829 3.32E−10 1.31E−09 −1.081 39 102 70.5 HSP90AB1 1 0.123265742 8.641 1.41E−08 4.33E−08 −1.368 50 92 71 CD44 0.713286713 0.458911419 0.356 3.51E−05 6.67E−05 −3.624 81 62 71.5 ADAM10 0.685314685 0.49733191 0.66 1.50E−05 3.12E−05 −2.415 74 69 71.5 2-Sep 0.783216783 0.386872999 3.131 2.07E−05 4.14E−05 −1.893 77 75 76 CD97 0.692307692 0.479722519 5.654 4.07E−05 7.64E−05 −1.939 82 74 78 CD3D 0.867132867 0.27054429 8.86 9.74E−05 0.000170432 −2.242 88 71 79.5 IFNAR1 0.643356643 0.521878335 4.367 9.15E−05 0.000162009 −2.225 87 72 79.5 PDIA3 0.902097902 0.242796158 0.333 1.56E−05 3.20E−05 −1.498 75 87 81 ITGAL 0.727272727 0.439167556 6.641 5.43E−05 9.84E−05 −1.78 85 80 82.5 TRAF3 0.286713287 0.837780149 3.392 0.000245285 0.000401849 −2.188 94 73 83.5 CD84 0.545454545 0.624332978 2.722 5.32E−05 9.75E−05 −1.585 84 83 83.5 GPR174 0.27972028 0.848452508 4.085 0.000126254 0.00021366 −1.857 91 77 84 FERMT3 0.797202797 0.371931697 6.194 1.84E−05 3.73E−05 −1.202 76 96 86 CD48 0.832167832 0.340448239 3.865 6.56E−06 1.49E−05 −0.956 68 105 86.5 P4HB 0.734265734 0.436499466 6.456 3.40E−05 6.55E−05 −1.201 80 97 88.5 AMICA1 0.307692308 0.80416222 0.465 0.001498757 0.002285233 −1.827 101 78 89.5 CD53 0.888111888 0.241728922 7.389 0.000119166 0.000203906 −1.402 90 89 89.5 M6PR 0.741258741 0.4226254 6.386 6.10E−05 0.000109315 −1.329 86 93 89.5 CALR 0.783216783 0.333511206 0.632 0.002126523 0.00314889 −1.887 104 76 90 CD226 0.58041958 0.570971185 2.108 0.000319444 0.000501983 −1.587 98 82 90 CD28 0.741258741 0.392209178 0.251 0.000830814 0.001279454 −1.636 100 81 90.5 IL2RG 0.804195804 0.334044824 9.555 0.000295753 0.000474437 −1.516 96 85 90.5 CD69 0.608391608 0.564034152 7.249 4.80E−05 8.91E−05 −1.13 83 99 91 ITGB2 0.93006993 0.2113127 5.017 6.34E−06 1.46E−05 −0.64 67 120 93.5 ERP29 0.496503497 0.614194237 0.956 0.006186193 0.008582647 −1.792 111 79 95 TMX3 0.384615385 0.730522946 0.227 0.002599987 0.00377734 −1.508 106 86 96 SPN 0.692307692 0.433297759 0.251 0.001985611 0.002997884 −1.327 102 94 98 IGF2R 0.48951049 0.617395945 0.111 0.007838293 0.010682275 −1.577 113 84 98.5 PEAR1 0.342657343 0.75773746 0.287 0.006082512 0.008515517 −1.38 110 90 100 RPS19 0.839160839 0.320170758 10.803 2.21E−05 4.37E−05 −0.499 78 124 101 CLPTM1 0.335664336 0.75773746 0.299 0.009829981 0.013050148 −1.487 116 88 102 IL27RA 0.587412587 0.533084312 0.444 0.003517435 0.005062477 −1.121 107 100 103.5 CD8B1 0.958041958 0.132870864 9.067 0.000387061 0.000602095 −0.836 99 110 104.5 ERP44 0.636363636 0.476520811 0.475 0.005603821 0.007917324 −1.03 109 104 106.5 NAMPT 0.314685315 0.767342583 0.189 0.019141924 0.023773035 −1.374 124 91 107.5 CLIC4 0.384615385 0.712913554 0.263 0.009931626 0.013072397 −1.175 117 98 107.5 SYNJ2BP 0.293706294 0.836179296 4.12 0.000147864 0.000247512 −0.441 92 125 108.5 ROCK1 0.503496503 0.589647812 0.111 0.018799573 0.023537677 −1.224 123 95 109 IL2RB 0.979020979 0.127001067 2.976 1.07E−05 2.31E−05 −0.082 71 148 109.5 IL10RA 0.601398601 0.505336179 0.214 0.008657115 0.011693943 −0.944 114 106 110 RAC1 0.762237762 0.348986126 0.485 0.003749065 0.00534589 −0.739 108 113 110.5 CD3E 0.986013986 0.072572038 0.748 0.002042816 0.003054307 −0.65 103 118 110.5 ATP5B 0.965034965 0.133404482 6.142 0.000102936 0.000178114 −0.246 89 135 112 GPI1 0.909090909 0.228922092 6.698 2.49E−05 4.86E−05 −0.088 79 147 113 PSEN1 0.454545455 0.643543223 0.401 0.012639807 0.016221086 −0.873 120 109 114.5 NCKAP1L 0.65034965 0.455176094 0.322 0.00873249 0.011693943 −0.701 115 114 114.5 AIMP1 0.48951049 0.590715048 0.986 0.037419439 0.044671268 −1.048 129 103 116 TRPV2 0.559440559 0.537353255 0.444 0.015893899 0.020062791 −0.819 122 111 116.5 MIF 0.86013986 0.267876201 1.891 0.000283486 0.000459545 −0.187 95 138 116.5 MS4A6B 0.804195804 0.309498399 7.085 0.002176457 0.003192137 −0.36 105 129 117 IL21R 0.643356643 0.411419424 0.367 0.115265771 0.131488361 −1.119 135 101 118 GPR65 0.48951049 0.596051227 0.642 0.028218632 0.033950542 −0.9 128 108 118 PTPRCAP 0.923076923 0.188367129 1.036 0.000232134 0.000384394 −0.141 93 143 118 CD5 0.601398601 0.491462113 0.566 0.019663834 0.024225843 −0.765 125 112 118.5 CTSD 0.944055944 0.155816435 4.385 0.000310803 0.00049344 −0.158 97 140 118.5 C1QBP 0.538461538 0.560298826 0.956 0.01402454 0.017849415 −0.654 121 117 119 PDIA4 0.440559441 0.631270011 0.356 0.053404352 0.061836618 −0.923 133 107 120 AAMP 0.643356643 0.447171825 0.465 0.021336414 0.026077839 −0.668 126 116 121 ITGA4 0.853146853 0.22945571 0.084 0.012018357 0.015553168 −0.547 119 123 121 CD2 0.895104895 0.187833511 0.888 0.006478663 0.008908162 −0.339 112 130 121 HNRNPU 0.629370629 0.458377801 0.356 0.025313734 0.030695394 −0.625 127 121 124 ADAM17 0.356643357 0.693703308 0.251 0.123421792 0.13975703 −0.692 136 115 125.5 ATP6AP2 0.41958042 0.644076841 0.526 0.076181691 0.087552092 −0.65 134 119 126.5 PGRMC1 0.412587413 0.658484525 0.614 0.05273109 0.061519604 −0.58 132 122 127 CAST 0.587412587 0.491995731 0.401 0.040257455 0.0476896 −0.303 130 132 131 SIVA1 0.335664336 0.708110993 2.032 0.15594075 0.174020837 −0.379 138 126 132 IFNG 0.328671329 0.699573106 0.949 0.267352682 0.289470869 −0.371 142 127 134.5 HMGB1 0.944055944 0.120064034 0.356 0.010017874 0.013074174 0 118 151 134.5 IDE 0.545454545 0.503735326 0.251 0.147487788 0.165789193 −0.225 137 136 136.5 CD2BP2 0.447552448 0.576840982 0.345 0.314275824 0.331496417 −0.364 146 128 137 LY9 0.307692308 0.719850587 0.566 0.268794378 0.289470869 −0.286 143 133 138 SBDS 0.426573427 0.611526147 0.722 0.208171758 0.228988934 −0.216 140 137 138.5 HSPD1 0.657342657 0.419423693 0.623 0.042833945 0.050354409 −0.089 131 146 138.5 CR1L 0.440559441 0.582177161 0.714 0.327701742 0.340986948 −0.323 148 131 139.5 LSM1 0.321678322 0.700640342 0.546 0.317551735 0.332673247 −0.266 147 134 140.5 CXCR3 0.342657343 0.689434365 0.614 0.239110071 0.261155681 −0.155 141 142 141.5 RPS6KB1 0.370629371 0.653148346 0.251 0.312065574 0.331435161 −0.169 145 139 142 CAP1 0.573426573 0.45357524 0.401 0.295867542 0.316413899 −0.156 144 141 142.5 EZR 0.741258741 0.296691569 0.465 0.194332008 0.215303088 0 139 152 145.5 HSPA9 0.482517483 0.530416222 0.411 0.415633226 0.426716779 −0.108 150 144 147 ICAM1 0.384615385 0.615261473 0.251 0.534335901 0.544951846 −0.098 151 145 148 PDE4B 0.447552448 0.54375667 0.31 0.612589334 0.62064972 −0.08 152 149 150.5 CXCR6 0.664335664 0.351654216 0.714 0.38664039 0.3996149 0 149 153 151 H2-M3 0.335664336 0.646211313 0.678 0.699273421 0.703843835 −0.067 153 150 151.5 LILRB4 0.335664336 0.608858058 0.632 0.920475822 0.920475822 0 154 154 154
TABLE-US-00011 TABLE 9 Ranked top 100 differentially expressed genes in cluster 8 as compared to all 15 CD8 T cell clusters adj.pval.cluster adj.pval.cluster adj.pval.cluster adj.pval.cluster adj.pval.cluster 1 2 3 4 5 XCL1 0 0 0 0 0 CD83 0 0 0 0 0 PLXDC2 0 0 0 0 0 BACE2 0 0 0 0 0 LAD1 0 0 0 0 0 GPM6B 0 0 0 0 0 CD81 0 0 0 0 0 AI836003 0 0 0 0 0 SYNPO 0 0 0 0 0 TNFSF11 0 0 0 0 0 NRN1 0 0 0 0 0 TNFRSF4 0 0 0 0 0 CD74 0 0 0 0 0 CCR8 0 0 0 0 0 RAMP3 0 0 0 0 0 CRTAM 0 0 0 0 0 SLC2A6 0 0 0 0 0 TNFSF8 −1.234 0 −2.538 0 0 BHLHE40 0 0 0 0 0 1700019D03RIK 0 0 0 0 0 NRP1 0 0 0 0 0 SPRY2 0 0 0 0 0 GUCY1A3 0 0 0 0 0 CXXC5 0 0 0 0 0 CCR7 −54.429 0 −33.406 0 0 TBC1D4 0 0 0 0 0 CD200 0 0 0 0 0 PENK 0 0 0 0 0 BCL6 0 0 0 0 0 SDC4 0 0 0 0 0 LAG3 0 0 0 0 0 TNFRSF18 0 0 0 0 0 ITGB1 0 −2.378 0 0 −16.568 TNFSF4 0 0 0 0 0 CCL1 0 0 0 0 0 DUSP4 0 0 0 0 0 DAPL1 −8.031 0 −8.574 0 0 KIT 0 0 0 0 0 FAM178B 0 0 0 0 0 CD160 0 0 0 0 0 CD82 0 0 0 0 0 GRAMD1B 0 0 0 0 0 FAM46A 0 0 0 0 0 REL 0 0 0 0 0 KLRK1 0 −2.058 0 0 −0.691 PLK2 0 0 0 0 0 CD9 0 0 0 0 0 TNFSF14 0 −0.387 0 0 0 TRAF1 0 0 0 0 0 ZC3H12D 0 0 0 0 0 SDF4 0 0 0 0 0 PTPRS 0 0 0 0 0 SH3BGRL 0 0 0 0 0 SSH1 0 0 0 0 0 NRGN 0 0 0 0 0 NFKBIA 0 0 0 0 0 NFAT5 0 0 0 0 0 CAPG 0 0 0 0 0 TSPAN32 0 0 0 0 0 DCLK1 0 0 0 0 0 PDCD1 0 0 0 0 0 CD70 0 0 0 0 0 IL2RA 0 0 0 0 0 SLC17A6 0 0 0 0 0 LTA 0 0 0 0 0 2310001H17RIK 0 0 0 0 0 ARAP2 0 0 −0.024 0 0 KLRC1 0 0 0 0 −0.71 NDFIP1 0 0 0 0 0 TMEM173 0 0 0 0 0 TMEM180 0 0 0 0 0 TIGIT 0 0 0 −0.592 0 MRPS6 0 0 0 0 0 MS4A4C 0 0 −2.75 0 −2.782 GABARAPL1 0 0 0 0 0 DUSP1 0 −1.807 0 0 0 RABGAP1L 0 0 0 0 0 BCL2AID 0 0 0 0 0 SLC16A11 0 0 0 0 0 PTPRK 0 0 0 0 0 NR4A3 0 0 0 0 0 AXL 0 0 0 0 0 DUSP14 0 0 0 0 0 FAM162A 0 0 0 0 0 LANCL1 0 0 0 0 0 SCYL2 0 0 0 0 0 OSTF1 0 0 0 0 0 PLSCR1 0 0 0 0 0 EEA1 0 0 0 0 0 CALCOCO1 0 0 0 0 0 KLRD1 0 0 0 0 0 SEMA4C 0 0 0 0 0 GM17745 0 0 0 0 0 HIF1A 0 0 0 0 0 ASNSD1 0 0 0 0 0 IL18R1 0 0 0 0 −0.23 SAT1 0 0 0 0 0 RAB37 0 0 0 0 −9.038 SLAMF6 −0.287 0 −2.279 0 −5.378 adj.pval.cluster adj.pval.cluster adj.pval.cluster adj.pval.cluster adj.pval.cluster 6 7 8 9 10 XCL1 0 −0.001 −85.872 −0.006 −0.093 CD83 0 −6.859 −80.672 −0.137 0 PLXDC2 0 −2.094 −68.219 −0.023 −0.022 BACE2 0 −1.489 −64.954 −0.031 −0.124 LAD1 0 −8.069 −44.851 −0.738 0 GPM6B 0 −9.613 −43.038 −0.164 −0.174 CD81 0 −1.064 −41.599 −1.361 −0.194 AI836003 0 −23.667 −41.348 −1.667 −0.126 SYNPO 0 −0.059 −41.343 −0.007 0 TNFSF11 0 −0.109 −40.55 −0 −0.42 NRN1 0 −28.795 −39.128 −4.33 −1.816 TNFRSF4 0 −42.493 −37.64 −6.475 −1.862 CD74 0 −8.642 −37.012 −1.217 −1.089 CCR8 0 −29.292 −36.056 −1.86 −0.433 RAMP3 0 −0.562 −36.056 −0.069 0 CRTAM 0 −0.457 −35.199 −0.223 0 SLC2A6 0 −0.86 −35.046 −0.559 −0.021 TNFSF8 0 0 −34.906 0 0 BHLHE40 −0.301 −32.471 −34.275 −4.262 −0.569 1700019D03RIK 0 −13.97 −32.226 −2.363 −0.185 NRP1 0 −30.537 −30.902 −2.005 −4.848 SPRY2 0 −18.137 −30.895 −2.979 −0.819 GUCY1A3 0 −0.733 −29.136 −0.078 −0.249 CXXC5 0 0 −26.956 0 −0.013 CCR7 0 0 −26.11 0 0 TBC1D4 0 −0.726 −25.601 −0.096 −0.012 CD200 0 −21.601 −25.027 −0.568 −1.085 PENK 0 −7.181 −24.963 −1.51 −0.82 BCL6 0 0 −24.943 −0.049 0 SDC4 0 −5.069 −24.939 −0.048 −0.007 LAG3 −10.838 −36.69 −24.857 −4.285 −9.648 TNFRSF18 0 −16.98 −24.642 −1.505 −0.839 ITGB1 0 −0.385 −24.519 −2.107 −0.221 TNFSF4 0 −20.871 −24.486 −3.686 −0.181 CCL1 0 −11.492 −23.03 −0.853 −0.077 DUSP4 0 −31.906 −22.596 −2.854 −4.287 DAPL1 0 0 −22.015 0 0 KIT 0 −40.679 −22.015 −0.725 −3.094 FAM178B 0 −6.313 −21.751 −0.037 0 CD160 0 −5.379 −21.394 −0.39 −1.583 CD82 −1.578 −9.818 −21.225 −0.062 −0.582 GRAMD1B 0 −0.624 −20.691 −3.117 −0.1 FAM46A 0 −10.576 −19.874 −2.797 −0.944 REL 0 −7.026 −19.474 −1.999 −0.32 KLRK1 0 −11.367 −18.913 −1.273 −0.232 PLK2 0 −17.608 −18.471 −3.47 −0.019 CD9 0 −7.854 −18.364 −8.001 −0.13 TNFSF14 0 0 −17.998 0 0 TRAF1 0 −11.745 −17.992 −1.584 0 ZC3H12D 0 −3.017 −17.992 −2.226 0 SDF4 0 −12.513 −17.847 −1.981 −0.432 PTPRS 0 −25.035 −17.249 −3.841 −1.861 SH3BGRL 0 −20.969 −17.143 −11.59 −6.456 SSH1 0 −6.551 −16.979 −2.032 0 NRGN 0 −35.762 −16.934 −6.835 −1.884 NFKBIA 0 −2.701 −16.891 −0.07 0 NFAT5 0 −12.415 −16.854 −2.562 −1.357 CAPG 0 −31.567 −16.812 −3.977 −1.984 TSPAN32 0 −4.996 −16.662 −4.315 −0.328 DCLK1 0 −7.663 −16.465 −0.155 −0.109 PDCD1 −12.311 −19.612 −16.441 −4.73 −10.914 CD70 0 −11.464 −16.414 −0.688 −0.21 IL2RA 0 −12.37 −16.072 −0.42 0 SLC17A6 0 −3.633 −15.953 −0.111 0 LTA 0 −1.15 −15.777 −0.004 −0.024 2310001H17RIK 0 −0.006 −15.775 −1.097 −0.04 ARAP2 0 −0.177 −15.632 −0.022 −0.108 KLRC1 0 −22.062 −15.365 −0.951 −1.67 NDFIP1 −6.306 −9.414 −15.255 −1.111 −0.182 TMEM173 0 −11.951 −15.191 −4.45 −0.62 TMEM180 0 −14.371 −15.057 −1.516 −0.671 TIGIT −12.815 −21.13 −14.863 −2.042 −6.684 MRPS6 0 −10.613 −14.806 −8.826 −4.719 MS4A4C 0 0 −14.793 0 0 GABARAPL1 0 −17.973 −14.714 −6.467 −3.276 DUSP1 0 −0.715 −14.698 −0.091 −0.257 RABGAP1L 0 −20.528 −14.584 −6.418 −3.152 BCL2AID −0.653 −23.195 −14.247 −6.435 −3.423 SLC16A11 0 −38.005 −14.163 −4.89 −1.423 PTPRK 0 −2.189 −14.03 −1.059 −0.027 NR4A3 0 −10.379 −14.001 −1.716 −0.936 AXL 0 −5.289 −13.839 −1.299 −0.194 DUSP14 0 −16.063 −13.49 −1.658 −2.67 FAM162A 0 −12.924 −13.483 −9.985 −6.418 LANCL1 0 −5.749 −13.483 −4.907 −2.058 SCYL2 0 −8.356 −13.271 −4.874 −0.362 OSTF1 0 −16.818 −13.223 −2.754 −0.26 PLSCR1 0 −25.165 −13.217 −8.918 −1.544 EEA1 0 −25.035 −13.021 −4.131 −2.609 CALCOCO1 0 −2.727 −12.968 −0.014 0 KLRD1 0 −11.474 −12.835 −0.521 −0.002 SEMA4C 0 −12.592 −12.74 −1.81 −0.087 GM17745 0 −17.498 −12.714 −8.41 −0.208 HIF1A 0 −11.55 −12.65 −5.468 −3.819 ASNSD1 0 −10.228 −12.642 −8.015 −3.68 IL18R1 0 −11.684 −12.642 −0.356 0 SAT1 −0.246 −2.947 −12.499 −0.328 0 RAB37 0 0 −12.41 −0.254 0 SLAMF6 0 0 −12.355 −0.024 0 adj.pval.cluster adj.pval.cluster adj.pval.cluster adj.pval.cluster adj.pval.cluster 11 12 13 14 15 XCL1 −0.001 −15.948 0 0 −13.484 CD83 −0.001 −1.561 0 −11.426 −16.922 PLXDC2 −0.001 −0.224 0 −0.534 −13.298 BACE2 −0.001 0 0 0 −4.874 LAD1 −0.001 −3.17 0 −0.181 −8.383 GPM6B −0.001 −2.795 0 0 −3.772 CD81 −0.001 0 0 0 −12.714 AI836003 −0.001 −0.044 0 0 −3.175 SYNPO −0.001 −0.4 −0.09 0 −1.027 TNFSF11 −0.001 −1.526 0 −0.711 −21.519 NRN1 −0.001 −0.014 0 0 −5.958 TNFRSF4 −0.093 −5.661 0 0 −4.988 CD74 −0.001 0 0 −17.193 −7.211 CCR8 −0.001 −1.64 0 0 −2.288 RAMP3 −0.001 0 0 0 −1.282 CRTAM −0.001 −2.397 0 0 −9.187 SLC2A6 −0.001 0 0 −0.157 −4.533 TNFSF8 −0.001 0 0 0 −7.213 BHLHE40 −0.125 −4.679 0 0 −1.518 1700019D03RIK −0.001 −0.788 0 0 −9.608 NRP1 0 −2.099 0 −3.231 −3.686 SPRY2 −0.001 −0.701 0 0 −3.881 GUCY1A3 −0.001 −0.203 0 0 −4.883 CXXC5 −0.001 0 0 0 −2.097 CCR7 −0.001 −0.051 0 −3.52 −3.252 TBC1D4 −0.001 0 0 −18.345 −8.954 CD200 −0.001 −1.573 0 0 −7.798 PENK −0.001 −0.206 0 0 −0.432 BCL6 −0.001 −0.107 0 −18.827 −4.745 SDC4 −0.001 0 0 −0.044 −2.261 LAG3 −0.108 −4.982 0 0 −1.917 TNFRSF18 −0.001 −3.163 0 −0.591 −1.756 ITGB1 −0.001 0 0 −0.06 −5.316 TNFSF4 −0.001 −0.319 0 0 −6.935 CCL1 −0.001 −0.877 0 0 −1.692 DUSP4 −0.001 −9.348 0 0 −2.344 DAPL1 −0.001 0 0 −5.26 −10.394 KIT −0.001 −0.022 0 0 −0.121 FAM178B −0.001 0 0 0 −13.298 CD160 −0.923 −1.312 0 0 −1.156 CD82 −0.137 −8.247 0 0 −0.86 GRAMD1B −0.114 −4.058 0 0 −3.445 FAM46A −0.001 −1.282 0 0 −2.034 REL −0.001 −8.761 0 0 −2.751 KLRK1 −0.001 −0.49 0 −1.307 −3.329 PLK2 −0.001 0 0 0 −0.214 CD9 −0.001 −0.732 0 −0.374 −6.112 TNFSF14 −0.001 −15.183 0 0 −3.254 TRAF1 −0.246 −0.741 0 −0.181 −1.331 ZC3H12D −0.001 −1.307 0 −1.216 −3.317 SDF4 −0.001 −1.699 0 0 −1.163 PTPRS −0.001 −13.526 0 −1.475 −5.062 SH3BGRL −0.001 −0.25 0 0 −2.387 SSH1 −0.001 −0.067 0 0 −1.857 NRGN −0.001 0 −0.069 0 −3.422 NFKBIA −0.346 −11.345 0 −0.623 −2.116 NFAT5 −0.001 −1.66 −0.528 0 −2.986 CAPG −0.001 0 0 −0.408 −2.146 TSPAN32 −0.001 0 0 0 −6.298 DCLK1 −0.001 0 0 0 −4.026 PDCD1 −0.108 −0.747 0 0 −2.191 CD70 −0.001 −0.472 0 0 −8.022 IL2RA −0.001 −18.953 0 −4.167 −3.093 SLC17A6 −0.046 −1.909 0 0 −4.662 LTA −0.001 −0.611 0 0 −2.925 2310001H17RIK −0.127 −0.203 0 0 −8.022 ARAP2 −0.001 −4.204 0 0 −0.485 KLRC1 −0.001 −2.988 0 −0.825 −0.612 NDFIP1 −0.363 −8.984 0 0 −0.4 TMEM173 −0.108 −0.26 0 −2.827 −1.27 TMEM180 −0.001 −0.012 0 0 −2.691 TIGIT −0.001 −2.558 0 0 −1.039 MRPS6 −0.494 −4.025 0 0 −5.964 MS4A4C −0.142 0 0 −4.832 −2.582 GABARAPL1 −0.001 −0.237 0 0 −4.419 DUSP1 −0.001 0 0 −0.46 −0.704 RABGAP1L −0.001 −0.426 0 −0.038 −1.191 BCL2AID −0.159 −10.26 0 −0.06 −2.176 SLC16A11 −0.001 0 0 0 −1.047 PTPRK −0.001 −0.734 0 −0.269 −0.989 NR4A3 −0.001 −1.897 0 0 −1.576 AXL −0.001 −0.029 0 0 −2.65 DUSP14 −0.001 −0.159 0 0 −4.806 FAM162A −0.159 −4.136 0 −0.059 −1.398 LANCL1 −0.001 0 0 0 −2.346 SCYL2 −0.001 0 0 0 −0.504 OSTF1 −0.001 0 0 0 −1.322 PLSCR1 −0.08 −3.263 0 0 −2.864 EEA1 −0.001 −6.371 0 0 −1.547 CALCOCO1 −0.001 0 0 0 −1.929 KLRD1 −0.001 0 0 −1.221 −0.417 SEMA4C −0.001 −2.399 0 0 −1.003 GM17745 −0.001 0 0 0 −2.315 HIF1A −0.001 −3.236 0 0 −1.165 ASNSD1 −0.001 −1.692 0 0 −2.151 IL18R1 −0.001 −0.216 0 −0.458 −2.815 SAT1 −0.123 0 0 −0.577 −1.062 RAB37 −0.001 0 0 0 −0.829 SLAMF6 −0.001 0 0 −2.727 −5.477
TABLE-US-00012 TABLE 10 Cluster 9 Specific Gene Signature 0 7 8 10 rank_0 rank_7 rank_8 rank_10 mean_rank CCNB2 −179.56 −51.664 −44.528 −34.919 1 6 3 2 3 CDCA8 −158.625 −55.88 −45.215 −23.277 6 1 1 9 4.25 CDC20 −175.23 −51.349 −42.164 −29.065 3 8 6 3 5 CDCA3 −178.094 −52.286 −38.435 −26.01 2 5 11 6 6 KIF20A −154.631 −48.789 −39.127 −18.853 8 11 10 13 10.5 CKS1B −144.648 −43.681 −40.952 −23.893 17 16 7 8 12 CCNA2 −173.875 −54.064 −42.24 −12.412 4 3 5 36 12 PLK1 −166.042 −47.328 −33.924 −18.523 5 14 22 15 14 TACC3 −141.435 −47.916 −37.916 −18.853 19 13 12 14 14.5 MKI67 −147.761 −51.664 −39.364 −13.34 12 7 8 32 14.75 BIRC5 −95.888 −53.595 −44.432 −28.504 53 4 4 5 16.5 HMGB2 −83.804 −54.823 −45.213 −24.98 64 2 2 7 18.75 TPX2 −100.118 −50.085 −39.209 −18.489 44 9 9 16 19.5 UBE2C −103.176 −43.227 −37.295 −29.065 43 18 14 4 19.75 KIF22 −148.115 −48.136 −32.069 −13.443 11 12 27 31 20.25 FAM64A −154.576 −41.671 −32.052 −15.867 9 22 28 23 20.5 NEK2 −157.543 −39.398 −31.625 −16.275 7 29 29 22 21.75 CCNB1 −140.302 −39.431 −31.289 −19.096 20 28 30 12 22.5 CEP55 −144.648 −42.701 −30.625 −14.675 16 19 33 25 23.25 CENPA −98.818 −37.574 −35.626 −36.54 48 34 20 1 25.75 BUB1B −147.538 −36.302 −32.525 −13.874 13 39 25 29 26.5 RACGAP1 −71.392 −48.815 −37.5 −18.362 75 10 13 17 28.75 KNSTRN −122.541 −35.023 −31.096 −16.976 28 43 31 20 30.5 NUSAP1 −146.985 −41.727 −31.013 −9.861 15 21 32 54 30.5 TUBB4B −70.217 −39.693 −35.915 −22.291 77 26 19 10 33 CDKN3 −147.353 −30.413 −25.753 −16.819 14 56 47 21 34.5 HMGN2 −71.595 −41.762 −35.977 −14.236 74 20 17 27 34.5 KIF23 −121.029 −38.856 −28.209 −12.459 30 33 40 35 34.5 CKAP2L −148.887 −39.005 −28.955 −8.454 10 31 37 61 34.75 CENPE −129.908 −36.68 −25.386 −12.227 23 37 48 37 36.25 KIF2C −131.562 −35.795 −26.003 −11.967 22 41 45 39 36.75 CKS2 −76.204 −39.652 −27.946 −17.346 68 27 41 19 38.75 CKAP2 −123.937 −29.319 −27.238 −13.808 26 62 42 30 40 BUB1 −142.772 −40.064 −28.797 −5.397 18 25 38 86 41.75 H2AFZ −68.778 −43.399 −28.257 −11.967 79 17 39 38 43.25 TUBA1C −63.159 −34.361 −30.271 −20.656 90 46 34 11 45.25 KIF4 −128.784 −34.735 −24.757 −8.059 24 45 52 64 46.25 TUBA1B −64.686 −40.286 −37.163 −8.299 85 24 16 63 47 TUBB5 −53.949 −44.478 −35.92 −10.101 107 15 18 49 47.25 NCAPD2 −110.146 −34.779 −34.085 −5.006 36 44 21 92 48.25 SAPCD2 −120.02 −28.864 −23.363 −10.797 31 63 55 46 48.75 AURKB −135.847 −38.959 −26.877 −3.947 21 32 44 108 51.25 AURKA −99.39 −30.476 −20.601 −11.219 46 55 67 42 52.5 REEP4 −67.915 −33.507 −25.248 −12.858 80 48 51 34 53.25 GTSE1 −123.444 −31.905 −26.001 −5.322 27 51 46 89 53.25 ECT2 −105.291 −29.705 −23.123 −7.607 40 59 58 67 56 ASPM −121.198 −26.672 −19.798 −8.457 29 67 75 60 57.75 SKA1 −114.202 −30.339 −24.663 −5.397 34 57 53 87 57.75 CDK1 −105.176 −36.452 −29.529 −3.686 41 38 36 118 58.25 PARPBP −105.457 −28.232 −20.388 −8.597 39 65 71 59 58.5 MAD2L1 −115.359 −37.046 −32.437 −3.258 32 36 26 142 59 CDC25C −99.915 −25.925 −19.798 −10.315 45 69 76 48 59.5 H2AFV −48.503 −37.385 −20.591 −18.004 118 35 69 18 60 DEPDC1A −124.747 −29.772 −22.719 −4.302 25 58 61 102 61.5 MELK −112.089 −30.911 −23.29 −4.146 35 52 56 104 61.75 CENPF −56.405 −28.447 −25.284 −13.081 103 64 50 33 62.5 TROAP −108.467 −25.697 −17.046 −10.079 38 70 90 52 62.5 KIF11 −74.302 −33.049 −27.196 −5.089 70 50 43 90 63.25 SHCBP1 −109.76 −29.345 −22.73 −4.815 37 61 60 98 64 CDC25B −50.288 −33.801 −20.482 −13.883 112 47 70 28 64.25 NDC80 −90.692 −33.228 −25.29 −4.104 59 49 49 105 65.5 NUF2 −73.529 −35.179 −21.721 −4.98 71 42 62 94 67.25 SPAG5 −104.263 −26.243 −21.481 −4.847 42 68 64 97 67.75 ARHGAP19 −97.172 −23.112 −17.625 −9.41 51 79 86 56 68 HMGB1 −58.399 −36.091 −37.295 −3.463 99 40 15 127 70.25 1190002F15RIK −94.177 −22.019 −19.592 −6.909 54 81 79 68 70.5 H2AFX −59.392 −29.394 −20.373 −9.136 95 60 72 57 71 SPC25 −114.751 −30.777 −23.961 −3.109 33 54 54 146 71.75 PIF1 −98.927 −20.048 −14.463 −9.6 47 86 102 55 72.5 FOXM1 −91.42 −25.188 −17.754 −5.6 57 72 85 81 73.75 SPC24 −65.249 −39.398 −33.678 −2.755 83 30 23 167 75.75 HMMR −39.329 −24.63 −19.969 −14.675 130 75 74 26 76.25 DLGAP5 −51.509 −24.614 −23.264 −6.857 111 76 57 69 78.25 SGOL1 −98.207 −30.824 −21.481 −2.931 50 53 63 159 81.25 KPNA2 −63.979 −18.154 −20.6 −6.219 88 94 68 76 81.5 C330027C09RIK −90.854 −23.374 −19.705 −3.778 58 78 78 115 82.25 SKA2 −85.065 −24.456 −19.798 −3.895 63 77 77 113 82.5 PRC1 −58.811 −25.407 −20.996 −4.613 98 71 66 99 83.5 ESPL1 −86.403 −22.165 −17.536 −4.088 62 80 87 106 83.75 ARHGAP11A −87.862 −24.762 −21.088 −3.381 61 74 65 135 83.75 CKAP5 −54.057 −16.44 −17.31 −11.099 106 104 88 45 85.75 HMGB3 −96.663 −15.565 −14.816 −5.439 52 109 99 84 86 MIS18BP1 −91.908 −21.308 −16.521 −3.636 56 83 92 120 87.75 INCENP −75.685 −21.311 −19.586 −3.405 69 82 80 130 90.25 HIST1H2AO −92.506 −40.899 −33.536 −1.579 55 23 24 273 93.75 CEP89 −59.75 −13.438 −11.499 −11.197 93 119 121 43 94 MXD3 −83.12 −17.893 −13.103 −4.373 65 96 114 101 94 2700094K13RIK −52.648 −15.868 −18.948 −5.532 109 108 82 83 95.5 CENPW −90.096 −17.24 −20.059 −2.968 60 99 73 155 96.75 RAD21 −52.375 −15.188 −15.669 −6.326 110 110 95 75 97.5 GPSM2 −59.261 −16.018 −12.996 −5.798 96 106 116 79 99.25 TUBA1A −25.055 −18.888 −13.555 −15.531 182 90 109 24 101.25 ODF2 −55.174 −11.337 −10.685 −11.651 104 133 133 41 102.75 FAM83D −81.828 −19.462 −15.053 −2.777 66 87 97 165 103.75 TMPO −62.994 −17.441 −10.3 −4.408 91 98 134 100 105.75 NUCKS1 −44.767 −18.158 −12.544 −4.858 123 93 118 96 107.5 KIF20B −57.473 −16.967 −11.644 −3.688 101 101 119 117 109.5 ANP32E −40.347 −20.145 −17.306 −3.36 129 85 89 136 109.75 HN1 −23.019 −25.105 −10.937 −11.189 196 73 129 44 110.5 NEIL3 −98.245 −27.947 −19.277 −1.789 49 66 81 246 110.5 FZR1 −57.498 −10.914 −8.354 −10.101 100 137 155 51 110.75 ARL6IP1 −27.494 −12.621 −14.564 −9.973 170 124 100 53 111.75 SPDL1 −64.603 −14.996 −9.935 −3.94 86 111 141 109 111.75 NDE1 −42.082 −12.351 −11.332 −6.364 128 126 124 72 112.5 POC1A −73.514 −14.316 −13.474 −3.009 72 114 110 154 112.5 CALM3 −45.058 −9.314 −11.208 −8.454 121 148 128 62 114.75 CLIC1 −25.633 −19.151 −11.311 −6.364 179 89 126 73 116.75 ZWILCH −69.398 −21.092 −16.514 −2.025 78 84 93 213 117 KIF14 −48.505 −13.826 −9.062 −3.988 117 116 149 107 122.25 DDX39 −31.017 −10.898 −18.359 −3.702 151 138 84 116 122.25 LSM5 −47.57 −14.966 −11.481 −3.314 119 112 122 137 122.5 BUB3 −33.012 −14.96 −13.952 −3.538 147 113 105 126 122.75 HIST1H2BC −58.831 −7.843 −6.778 −8 97 159 175 65 124 2610318N02RIK −43.8 −9.318 −8.442 −6.506 127 147 154 71 124.75 C920025E04RIK −35.554 −6.841 −9.916 −10.101 141 169 142 50 125.5 1500009L16RIK −44.509 −7.953 −13.883 −3.581 124 158 107 124 128.25 BORA −48.966 −11.156 −11.397 −3.294 114 136 123 140 128.25 PLK4 −80.305 −16.181 −17 −1.78 67 105 91 250 128.25 CIT −71.676 −18.38 −15.037 −1.725 73 92 98 255 129.5 MIIP −24.876 −13.14 −6.786 −11.742 185 121 173 40 129.75 SEC11C −30.2 −6.343 −14.501 −5.388 156 179 101 88 131 CCNF −64.549 −18.524 −14.342 −1.741 87 91 104 254 134 PRR11 −20.159 −11.311 −11.292 −7.85 213 135 127 66 135.25 HIST1H2AB −61.483 −17.079 −13.438 −1.821 92 100 112 238 135.5 HJURP −56.727 −16.886 −13.441 −1.9 102 102 111 228 135.75 RANGAP1 −33.852 −11.828 −11.318 −3.057 143 127 125 150 136.25 RDM1 −48.712 −7.55 −5.33 −6.1 116 162 201 77 139 CALM2 −20.848 −14.029 −8.044 −5.803 209 115 156 78 139.5 GEN1 −65.12 −17.772 −13.072 −1.597 84 97 115 271 141.75 PFN1 −25.71 −10.358 −30.222 −1.998 178 141 35 216 142.5 HIST1H1C −31.197 −5.199 −9.801 −5.727 150 198 144 80 143 DBF4 −27.525 −11.682 −13.936 −2.707 169 128 106 169 143 CENPN −71.122 −19.191 −10.712 −1.543 76 88 132 283 144.75 CENPL −30.883 −13.439 −8.635 −2.919 152 118 152 160 145.5 TTK −66.79 −15.961 −14.463 −1.475 81 107 103 295 146.5 DSN1 −65.912 −17.963 −16.044 −1.359 82 95 94 319 147.5 CENPP −59.459 −12.482 −12.595 −1.677 94 125 117 259 148.75 SMTN −44.39 −6.511 −6.524 −3.611 125 175 180 122 150.5 DIAP3 −63.174 −13.019 −13.797 −1.497 89 122 108 293 153 EMP3 −25.041 −10.005 −7.301 −3.583 183 143 166 123 153.75 HIST1H2AG −46.006 −11.439 −8.498 −2.025 120 130 153 214 154.25 ARHGEF39 −27.823 −8.673 −5.839 −3.94 167 154 189 110 155 HP1BP3 −20.499 −12.715 −4.367 −8.72 212 123 229 58 155.5 UBE2S −43.857 −9.929 −15.508 −1.635 126 144 96 265 157.75 CMTM7 −38.507 −5.649 −22.958 −1.744 131 190 59 253 158.25 H2-T22 −22.185 −7.37 −10.002 −3.405 201 164 138 131 158.5 CENPT −36.817 −6.544 −9.492 −2.316 136 174 145 183 159.5 CDKN2D −14.34 −13.43 −4.766 −10.722 258 120 215 47 160 TMEM97 −52.986 −6.193 −10.182 −1.932 108 180 135 224 161.75 NUDCD2 −37.492 −3.326 −7.934 −3.87 135 243 158 114 162.5 IQGAP3 −36.412 −9.13 −5.307 −2.875 137 150 202 161 162.5 PIH1D1 −34.796 −6.563 −8.927 −2.164 142 173 151 193 164.75 LBR −14.413 −16.766 −18.92 −1.996 256 103 83 217 164.75 CEP72 −36.083 −10.604 −6.784 −2.04 139 139 174 210 165.5 UEVLD −32.049 −4.592 −6.423 −3.425 149 209 183 128 167.25 AP1M1 −15.611 −9.63 −7.941 −3.62 248 145 157 121 167.75 TRAIP −49.163 −13.754 −10.937 −1.329 113 117 130 321 170.25 SGOL2 −15.199 −11.435 −10.889 −2.536 252 132 131 174 172.25 SHC1 −25.063 −6.15 −6.577 −3.064 181 181 179 149 172.5 TNFAIP8L1 −17.116 −8.092 −5.008 −5.074 236 157 208 91 173 CARHSP1 −28.724 −8.146 −6.969 −2.094 164 156 169 203 173 OAT −35.699 −6.088 −9.138 −1.96 140 182 147 223 173 G2E3 −27.898 −7.416 −6.027 −2.482 166 163 188 176 173.25 1700097N02RIK −33.179 −5.269 −4.818 −3.313 146 197 214 138 173.75 HIST1H1B −44.804 −11.316 −9.967 −1.412 122 134 140 304 175 STK38 −9.11 −9.367 −6.383 −6.353 296 146 185 74 175.25 MNS1 −36.257 −10.296 −6.589 −1.789 138 142 178 247 176.25 KIFC1 −54.086 −11.438 −7.707 −1.383 105 131 161 312 177.25 CEP70 −37.856 −5.782 −4.427 −2.816 134 188 225 163 177.5 ACSL5 −30.6 −5.184 −6.033 −2.564 155 199 187 173 178.5 KIFC5B −33.355 −9.146 −6.928 −1.648 145 149 170 261 181.25 MTMR14 −22.063 −4.296 −5.167 −3.903 202 211 204 111 182 HMGN5 −48.906 −4.671 −7.466 −1.794 115 204 165 245 182.25 ANAPC5 −24.624 −8.999 −13.349 −1.548 186 152 113 279 182.5 0610010K14RIK −24.245 −7.769 −3.998 −3.226 187 160 241 143 182.75 MAPRE1 −19.935 −6.597 −10.009 −2.032 218 172 137 211 184.5 MED30 −28.753 −8.421 −9.889 −1.548 162 155 143 280 185 HIST1H1E −28.537 −10.481 −7.905 −1.532 165 140 159 284 187 LDLR −38.487 −1.54 −6.833 −3.296 132 308 172 139 187.75 PIK3CG −27.733 −2.481 −10.178 −2.333 168 266 136 181 187.75 BRD8 −20.853 −5.71 −4.252 −3.675 208 189 236 119 188 PSRC1 −30.878 −3.622 −5.154 −2.624 153 229 205 170 189.25 POC5 −21.709 −3.955 −5.458 −3.405 205 223 198 133 189.75 MRPL27 −24.168 −2.932 −7.629 −2.793 188 250 163 164 191.25 EFCAB11 −27.196 −6.407 −5.62 −1.93 173 178 196 226 193.25 PPP2R5D −29.558 −4.634 −4.404 −2.278 158 206 226 186 194 CCDC61 −24.093 −4.112 −4.349 −3.088 189 216 231 147 195.75 TRIM59 −23.902 −6.429 −5.836 −1.904 190 176 190 227 195.75 SNRPG −16.103 −8.946 −4.697 −2.618 246 153 217 171 196.75 TCEB2 −22.411 −6.642 −9.42 −1.597 200 171 146 272 197.25 SUN2 −8.493 −4.974 −5.52 −4.985 299 202 197 93 197.75 NUP37 −38.119 −4.61 −3.031 −2.26 133 208 264 189 198.5 SC5D −28.748 −1.802 −9.982 −2.124 163 293 139 199 198.5 PPP1CA −14.446 −6.904 −11.628 −1.722 255 168 120 256 199.75 C230052I12RIK −30.674 −2.911 −7.739 −1.808 154 252 160 241 201.75 CENPC1 −32.875 −5.415 −7.115 −1.45 148 194 167 298 201.75 NRF1 −19.141 −6.029 −9.129 −1.65 223 183 148 260 203.5 EVI2B −11.021 −3.529 −5.343 −4.302 281 233 200 103 204.25 PAGR1A −29.15 −5.944 −4.999 −1.643 161 185 209 263 204.5 KCTD20 −21.121 −2.065 −6.611 −2.934 207 280 177 158 205.5 TRIOBP −27.306 −3.49 −3.429 −2.76 171 235 253 166 206.25 ELOF1 −29.677 −4.003 −5.354 −1.787 157 221 199 248 206.25 APOBEC3 −19.039 −5.984 −2.162 −3.574 224 184 299 125 208 TRAF7 −19.947 −3.886 −4.326 −2.949 217 225 233 157 208 GNB2 −20.578 −2.483 −4.846 −3.19 211 265 213 144 208.25 RNF5 −26.006 −3.955 −7.662 −1.566 175 222 162 275 208.5 HIST2H4 −22.883 −7.738 −4.368 −1.78 197 161 228 251 209.25 CDC23 −27.167 −5.535 −6.407 −1.525 174 193 184 289 210 CDK2AP2 −4.208 −11.623 −1.586 −5.581 316 129 314 82 210.25 ADPRH −18.119 −3.339 −2.376 −5.425 228 239 291 85 210.75 H2-Q4 −2.515 −6.423 −2.652 −6.545 319 177 283 70 212.25 H3F3B −4.435 −7.047 −7.006 −2.117 314 167 168 200 212.25 PPP2R5C −9.913 −5.639 −4.129 −3.405 289 191 238 134 213 RHNO1 −14.395 −5.568 −4.867 −2.144 257 192 212 196 214.25 PSMC1 −21.901 −4.119 −4.976 −1.834 203 215 210 236 216 DAP −18.089 −2.2 −2.99 −4.865 229 275 268 95 216.75 CNIH4 −27.26 −2.4 −3.709 −2.406 172 270 247 179 217 SETD8 −33.467 −3.886 −2.885 −1.894 144 224 274 229 217.75 CCDC77 −24.941 −5.408 −3.197 −1.852 184 195 258 234 217.75 PSMB9 −18.089 −7.202 −2.509 −2.274 230 166 289 187 218 HIST1H3B −25.75 −6.838 −4.27 −1.507 177 170 235 291 218.25 SDCBP −5.81 −4.291 −7.543 −2.157 309 212 164 194 219.75 HIST3H2A −10.108 −2.439 −5.774 −3.405 287 268 193 132 220 ATL2 −12.253 −4.452 −6.425 −1.93 272 210 182 225 222.25 CCDC163 −21.293 −2.88 −3.116 −2.613 206 253 261 172 223 IFT46 −22.614 −2.264 −1.608 −3.903 198 273 313 112 224 TMEM194 −20.035 −7.283 −5.202 −1.377 216 165 203 313 224.25 GM14005 −5.611 −4.101 −5.775 −2.397 310 218 192 180 225 CNEP1R1 −23.411 −2.568 −3.017 −2.283 193 261 266 185 226.25 MTMR12 −13.416 −3.328 −3.349 −3.151 264 242 257 145 227 DERL2 −25.844 −3.556 −6.445 −1.313 176 231 181 323 227.75 SSNA1 −25.53 −3.331 −6.755 −1.365 180 240 176 317 228.25 RSPH3A −23.253 −3.328 −1.393 −2.847 194 241 320 162 229.25 DYNLL1 −19.811 −2.761 −4.14 −2.084 219 256 237 205 229.25 NGDN −9.815 −2.665 −8.993 −1.986 291 258 150 220 229.75 H2-T10 −9.785 −5.871 −4.605 −1.963 292 187 220 221 230 TAP1 −10.041 −4.205 −4.587 −2.117 288 214 222 201 231.25 ALDH16A1 −23.685 −3.738 −4.078 −1.602 192 226 240 269 231.75 ANAPC16 −16.673 −3.018 −2.293 −3.08 239 249 293 148 232.25 ING1 −19.615 −4.614 −5.781 −1.372 221 207 191 315 233.5 CNTROB −16.429 −2.773 −6.902 −1.572 241 255 171 274 235.25 2210039B01RIK −2.28 −9.036 −1.363 −3.057 320 151 321 151 235.75 STAT2 −9.41 −3.649 −3.855 −2.431 294 228 244 178 236 HIST1H2BK −29.32 −3.373 −3.946 −1.4 160 237 242 305 236 GM2382 −16.148 −3.622 −3.417 −1.961 245 230 255 222 238 SH3BP2 −23.159 −1.423 −1.557 −3.414 195 315 315 129 238.5 MND1 −17.959 −3.37 −3.695 −1.829 231 238 248 237 238.5 CDK19 −11.233 −5.355 −4.905 −1.598 278 196 211 270 238.75 BBIP1 −11.041 −3.679 −3.722 −2.047 280 227 246 209 240.5 ERCC1 −16.89 −1.322 −4.72 −2.251 237 321 216 190 241 CYBASC3 −14.311 −1.442 −5.026 −2.196 259 312 207 191 242.25 CHKB −12.206 −4.237 −2.603 −2.142 273 213 287 197 242.5 DDX52 −20.098 −1.39 −4.326 −2.091 214 318 234 204 242.5 SERINC3 −17.435 −3.224 −5.71 −1.462 235 245 194 296 242.5 VBP1 −20.79 −1.859 −3.533 −1.996 210 291 252 218 242.75 INO80C −19.809 −2.532 −2.052 −2.266 220 264 301 188 243.25 CEP57L1 −15.391 −4.073 −2.889 −1.869 250 219 273 232 243.5 2310036022RIK −17.772 −1.828 −6.341 −1.648 234 292 186 262 243.5 MDM1 −22.593 −5.9 −2.837 −1.377 199 186 275 314 243.5 GMPR2 −17.82 −1.979 −2.78 −2.441 232 287 279 177 243.75 C2CD5 −23.822 −3.535 −3.361 −1.44 191 232 256 299 244.5 CARS −21.836 −1.56 −4.36 −1.803 204 304 230 243 245.25 NDUFA2 −15.15 −2.063 −2.213 −3.055 253 281 296 152 245.5 GM6682 −12.649 −5.151 −2.105 −2.017 267 201 300 215 245.75 COG6 −18.949 −1.704 −2.541 −2.535 225 297 288 175 246.25 STAP1 −29.431 −1.441 −2.049 −2.026 159 313 303 212 246.75 OPA3 −12.353 −2.241 −5.133 −1.819 271 274 206 239 247.5 DNAHC8 −3.074 −3.437 −2.186 −3.286 318 236 297 141 248 CPT1A −16.502 −3.294 −3.779 −1.614 240 244 245 267 249 NLRC3 −10.326 −2.004 −2.802 −3.021 286 286 277 153 250.5 HYLS1 −9.636 −4.103 −2.614 −2.049 293 217 285 208 250.75 IRF9 −3.594 −2.652 −3.182 −2.755 317 259 260 168 251 EMC9 −8.181 −3.116 −2.89 −2.302 300 248 272 184 251 TMUB1 −10.895 −2.313 −3.422 −2.149 284 272 254 195 251.25 FAM126A −12.79 −1.517 −4.471 −2.052 266 310 224 207 251.75 CEP19 −18.743 −1.433 −1.434 −2.962 226 314 317 156 253.25 FBXL8 −12.094 −3.516 −2.92 −1.808 275 234 271 242 255.5 NFYC −14.802 −2.562 −2.83 −1.882 254 262 276 231 255.75 PAPOLA −16.383 −1.628 −4.593 −1.682 242 302 221 258 255.75 2810428I15RIK −17.78 −2.146 −4.328 −1.548 233 278 232 281 256 PLEKHG3 −12.062 −4.638 −2.987 −1.532 276 205 269 287 259.25 MPP1 −13.843 −3.197 −2.608 −1.797 262 246 286 244 259.5 BUD31 −16.752 −2.78 −3.029 −1.532 238 254 265 286 260.75 PEA15A −7.438 −1.54 −3.549 −2.319 302 309 251 182 261 SLC25A38 −12.994 −1.306 −3.593 −2.072 265 324 249 206 261 OAZ1-PS −8.51 −4.004 −4.496 −1.394 298 220 223 310 262.75 PEX7 −20.088 −1.621 −4.08 −1.397 215 303 239 307 266 STK19 −16.312 −1.93 −2.051 −1.863 243 289 302 233 266.75 ATG4D −12.381 −1.693 −2.996 −1.835 270 298 267 235 267.5 CD48 −11.349 −2.453 −2.791 −1.778 277 267 278 252 268.5 PNRC2 −13.929 −1.751 −2.673 −1.819 261 295 282 240 269.5 SAP130 −12.496 −2.912 −3.55 −1.396 269 251 250 309 269.75 MVD −14.252 −1.309 −5.641 −1.414 260 323 195 303 270.25 4921524J17RIK −18.695 −2.313 −2.177 −1.532 227 271 298 288 271 EHMT2 −16.296 −1.472 −4.651 −1.392 244 311 219 311 271.25 2610044015RIK8 −6.656 −2.152 −4.376 −1.557 306 277 227 277 271.75 SEPT7 −15.362 −1.708 −4.669 −1.319 251 296 218 322 271.75 USF1 −10.99 −1.553 −1.876 −2.178 282 306 308 192 272 PXMP4 −6.837 −1.316 −2.684 −2.129 304 322 281 198 276.25 RPPH1 −13.43 −2.046 −2.24 −1.635 263 282 295 266 276.5 ANKRD50 −11.228 −2.734 −1.357 −1.787 279 257 322 249 276.75 GM5860 −1.615 −4.941 −1.878 −1.553 323 203 307 278 277.75 ARID3B −1.333 −2.583 −3.082 −1.614 324 260 262 268 278.5 PPP1R10 −15.738 −1.56 −2.953 −1.505 247 305 270 292 278.5 R3HCC1L −8.716 −2.026 −1.548 −1.996 297 283 316 219 278.75 PRR14 −10.956 −2.56 −1.417 −1.717 283 263 318 257 280.25 ZFP414 −19.25 −1.421 −1.402 −1.639 222 316 319 264 280.25 EAPP −12.114 −1.657 −3.057 −1.532 274 301 263 285 280.75 CTDSP2 −5.463 −5.159 −1.356 −1.525 311 200 323 290 281 UGDH −12.59 −1.769 −2.389 −1.559 268 294 290 276 282 IGTP −1.624 −2.007 −1.336 −2.101 322 285 324 202 283.25 SPSB3 −9.113 −3.123 −2.259 −1.459 295 247 294 297 283.25 STARD3 −15.429 −2.152 −1.799 −1.362 249 276 309 318 288 VRK3 −4.857 −2.084 −2.708 −1.548 312 279 280 282 288.25 RBBP6 −9.841 −1.667 −3.193 −1.4 290 300 259 306 288.75 RGS14 −6.176 −1.546 −1.688 −1.884 307 307 312 230 289 CHTOP −6.782 −1.406 −3.913 −1.371 305 317 243 316 295.25 ATF7IP −4.24 −2.434 −1.984 −1.415 315 269 305 302 297.75 ARRDC3 −6.058 −1.685 −2.322 −1.476 308 299 292 294 298.25 ZFP748 −7.427 −1.932 −1.713 −1.44 303 288 311 300 300.5 SERTAD3 −7.733 −1.906 −1.736 −1.427 301 290 310 301 300.5 PCIF1 −10.478 −1.326 −2.637 −1.336 285 320 284 320 302.25 TAGAP1 −4.681 −2.007 −1.903 −1.397 313 284 306 308 302.75 CRLF3 −2.123 −1.36 −2.035 −1.306 321 319 304 324 317
TABLE-US-00013 TABLE 11 Ranked top transcription factors differentially expressed in cluster 9 rank_hy- Gene TP TN thresh_mhg hyper_pval hyper_qval gen_qval per_qval rank_gen_qval mean_rank HMGB2 0.921568627 0.926502146 9.084 6.23E−122 2.69E−119 −83.608 1 3 2 FOXM1 0.477124183 0.969420601 2.57 1.94E−54 2.09E−52 −96.119 4 1 2.5 HMGB3 0.849673203 0.792381974 2.087 1.15E−58 2.48E−56 −67.08 2 4 3 MXD3 0.366013072 0.986051502 4.405 1.75E−47 1.26E−45 −84.852 6 2 4 HMGB1 0.888888889 0.749463519 9.01 4.20E−57 6.03E−55 −55.462 3 5 4 PMF1 0.843137255 0.763948498 2.878 1.36E−51 1.17E−49 −55.018 5 6 5.5 RAD54B 0.450980392 0.931330472 0.227 8.98E−34 4.30E−32 −51.036 9 7 8 PTMA 0.816993464 0.755901288 11.115 9.50E−46 5.85E−44 −42.495 7 9 8 TRIP13 0.437908497 0.932939914 0.556 1.61E−32 6.94E−31 −48.63 10 8 9 UHRF1 0.68627451 0.803648069 2.42 1.41E−35 7.59E−34 −35.788 8 10 9 WHSC1 0.705882353 0.724248927 0.214 5.75E−26 1.91E−24 −26.048 13 11 12 MED30 0.810457516 0.675429185 2.718 2.41E−32 9.45E−31 −23.986 11 13 12 ILF2 0.764705882 0.690450644 0.299 1.76E−28 6.33E−27 −22.543 12 14 13 TCF19 0.464052288 0.875 0.757 2.86E−22 4.74E−21 −24.957 26 12 19 NFYB 0.673202614 0.738197425 2.763 3.55E−24 8.06E−23 −19.398 19 20 19.5 RNF5 0.633986928 0.759120172 1.091 9.84E−23 1.70E−21 −20.356 25 17 21 PHF5A 0.816993464 0.614806867 1.043 7.77E−26 2.39E−24 −17.113 14 29 21.5 DEK 0.908496732 0.474785408 3.866 3.39E−23 6.36E−22 −19.216 23 21 22 CDCA4 0.68627451 0.720493562 4.167 2.25E−23 4.41E−22 −18.414 22 23 22.5 GTF2F1 0.830065359 0.593347639 1.623 4.36E−25 1.25E−23 −16.908 15 30 22.5 GTF2H5 0.751633987 0.657188841 3.38 4.70E−23 8.44E−22 −17.751 24 25 24.5 HCFC1 0.862745098 0.549356223 0.111 1.55E−24 3.93E−23 −15.818 17 34 25.5 RBBP8 0.535947712 0.807403433 0.287 2.66E−19 3.02E−18 −20.872 38 15 26.5 BRD8 0.607843137 0.774141631 2.969 5.28E−22 8.43E−21 −17.417 27 26 26.5 HDAC1 0.85620915 0.558476395 6.419 1.19E−24 3.22E−23 −15.235 16 38 27 EZH2 0.549019608 0.799356223 0.299 1.68E−19 1.95E−18 −19.409 37 19 28 ERH 0.973856209 0.376609442 3.926 2.66E−24 6.38E−23 −14.092 18 44 31 COMMD3 0.823529412 0.591201717 1.485 4.44E−24 9.58E−23 −14.081 20 45 32.5 DNMT1 0.732026144 0.660407725 3.834 2.42E−21 3.48E−20 −15.63 30 37 33.5 CBX3 0.973856209 0.316523605 3.941 5.57E−19 5.71E−18 −17.185 42 27 34.5 ANAPC11 0.803921569 0.591201717 0.202 7.56E−22 1.16E−20 −14.436 28 41 34.5 RBL1 0.45751634 0.85193133 1.722 5.76E−18 4.51E−17 −20.453 55 16 35.5 TERF1 0.496732026 0.82832618 0.566 2.24E−18 1.97E−17 −18.837 49 22 35.5 NRF1 0.647058824 0.715665236 0.322 6.09E−19 6.11E−18 −17.123 43 28 35.5 LITAF 0.901960784 0.487660944 3.522 1.54E−23 3.16E−22 −13.046 21 50 35.5 CHAF1A 0.424836601 0.872854077 0.526 5.74E−18 4.51E−17 −20.331 54 18 36 ING1 0.503267974 0.822961373 2.832 2.84E−18 2.45E−17 −16.453 50 31 40.5 POLE3 0.470588235 0.840128755 2.797 1.52E−17 1.13E−16 −18.041 58 24 41 PFDN1 0.705882353 0.677038627 1.098 1.80E−20 2.28E−19 −13.57 34 48 41 BUD31 0.797385621 0.590665236 1.748 4.37E−21 6.08E−20 −12.817 31 51 41 MAZ 0.640522876 0.711909871 0.401 6.01E−18 4.62E−17 −15.683 56 36 46 SSRP1 0.849673203 0.509656652 0.848 3.23E−19 3.57E−18 −12.57 39 54 46.5 RUVBL2 0.62745098 0.731223176 1.014 8.35E−19 8.12E−18 −13.378 45 49 47 YAF2 0.450980392 0.848175966 0.614 7.66E−17 5.08E−16 −16.148 65 32 48.5 RUVBL1 0.633986928 0.728540773 4.359 4.06E−19 4.37E−18 −12.325 40 57 48.5 HSBP1 0.797385621 0.59388412 2.943 2.11E−21 3.13E−20 −11.512 29 69 49 AIP 0.843137255 0.537017167 0.411 5.56E−21 7.48E−20 −11.643 32 67 49.5 MYEF2 0.620915033 0.714592275 0.454 1.72E−16 1.09E−15 −15.858 68 33 50.5 TFDP1 0.588235294 0.748927039 1.401 3.47E−17 2.34E−16 −14.454 64 40 52 IRF8 0.751633987 0.625536481 0.367 8.92E−20 1.10E−18 −11.165 35 73 54 ELK3 0.640522876 0.700107296 0.31 9.24E−17 6.04E−16 −14.175 66 43 54.5 LZTR1 0.490196078 0.818133047 1.696 1.75E−16 1.10E−15 −13.717 69 47 58 COPS5 0.633986928 0.710300429 3.206 3.36E−17 2.30E−16 −12.421 62 56 59 CTCF 0.535947712 0.780579399 0.227 4.27E−16 2.52E−15 −13.872 73 46 59.5 PNRC2 0.732026144 0.635193133 1.118 8.48E−19 8.12E−18 −10.78 44 77 60.5 PSMC3 0.895424837 0.455472103 4.378 9.68E−20 1.16E−18 −9.774 36 88 62 CDC5L 0.673202614 0.675965665 2.759 2.71E−17 1.95E−16 −11.644 60 66 63 ZNHIT3 0.379084967 0.881437768 3.543 5.18E−15 2.55E−14 −14.798 88 39 63.5 MTA1 0.437908497 0.839055794 0.356 1.55E−14 7.36E−14 −14.27 91 42 66.5 CBY1 0.307189542 0.915236052 1.526 1.12E−13 4.77E−13 −15.751 101 35 68 NFYC 0.647058824 0.686158798 0.807 5.49E−16 3.20E−15 −11.683 74 65 69.5 C1D 0.653594771 0.688304721 1.664 9.40E−17 6.04E−16 −11.201 67 72 69.5 CCNH 0.620915033 0.707081545 1.963 9.26E−16 5.11E−15 −11.828 78 63 70.5 UBE2K 0.758169935 0.599785408 0.202 5.54E−18 4.51E−17 −9.673 53 90 71.5 SMARCB1 0.692810458 0.64860515 0.585 1.83E−16 1.13E−15 −11.076 70 74 72 E2F4 0.549019608 0.751072961 0.465 3.94E−14 1.77E−13 −12.771 95 52 73.5 RBBP4 0.882352941 0.433476395 0.367 2.19E−16 1.33E−15 −10.972 71 76 73.5 YBX1 0.712418301 0.638412017 3.768 2.83E−17 2.00E−16 −9.802 61 87 74 PTTG1 0.803921569 0.556866953 1.828 1.34E−18 1.23E−17 −9.135 47 102 74.5 GABPA 0.555555556 0.745708155 0.227 3.92E−14 1.77E−13 −12.452 96 55 75.5 TOX 0.849673203 0.50751073 3.831 5.00E−19 5.26E−18 −8.559 41 111 76 SMARCE1 0.823529412 0.503218884 0.465 5.60E−16 3.22E−15 −10.63 75 79 77 KEAP1 0.516339869 0.778969957 1.714 2.66E−14 1.23E−13 −11.749 93 64 78.5 RBX1 0.875816993 0.462982833 2.485 4.37E−18 3.62E−17 −8.985 52 105 78.5 CBFB 0.496732026 0.791309013 0.516 5.24E−14 2.30E−13 −12.07 98 60 79 YEATS4 0.575163399 0.737124464 4.142 7.07E−15 3.42E−14 −11.348 89 71 80 ILF3 0.803921569 0.518240343 1.316 2.46E−15 1.26E−14 −10.497 83 81 82 GTF3C5 0.411764706 0.845493562 0.678 3.78E−13 1.51E−12 −12.296 108 58 83 ASXL1 0.411764706 0.845493562 3.118 3.78E−13 1.51E−12 −12.184 107 59 83 PQBP1 0.666666667 0.669527897 2.805 4.09E−16 2.45E−15 −9.361 72 95 83.5 GTF3C2 0.660130719 0.665236052 1.322 3.55E−15 1.80E−14 −10.33 85 84 84.5 MED21 0.418300654 0.837982833 1.104 8.16E−13 2.96E−12 −12.576 119 53 86 CTNNB1 0.464052288 0.80472103 0.623 7.88E−13 2.90E−12 −11.935 117 61 89 TARDBP 0.745098039 0.587982833 0.176 9.49E−16 5.18E−15 −9.188 79 100 89.5 METTL14 0.450980392 0.814377682 0.475 8.08E−13 2.95E−12 −11.878 118 62 90 MED4 0.39869281 0.853004292 4.53 5.64E−13 2.15E−12 −11.537 113 68 90.5 ATF1 0.470588235 0.807403433 4.658 1.28E−13 5.40E−13 −10.525 102 80 91 CNOT8 0.647058824 0.684012876 3.377 8.70E−16 4.87E−15 −8.976 77 106 91.5 CCNC 0.444444444 0.82027897 1.546 6.20E−13 2.32E−12 −11.51 115 70 92.5 NONO 0.993464052 0.290236052 3.702 1.07E−20 1.40E−19 −6.768 33 153 93 NRBF2 0.437908497 0.826180258 3.438 4.66E−13 1.79E−12 −10.992 112 75 93.5 CHD4 0.882352941 0.454399142 0.202 4.20E−18 3.55E−17 −7.391 51 136 93.5 GABPB2 0.535947712 0.760193133 1.433 5.53E−14 2.41E−13 −9.745 99 89 94 GABPB1 0.535947712 0.748390558 0.888 7.16E−13 2.66E−12 −10.664 116 78 97 AEBP2 0.607843137 0.689377682 0.111 3.99E−13 1.57E−12 −10.148 109 85 97 VPS72 0.633986928 0.681866953 0.791 1.62E−14 7.60E−14 −8.934 92 107 99.5 RNPS1 0.843137255 0.478004292 1.245 7.14E−16 4.05E−15 −8.096 76 124 100 BATF 0.712418301 0.596566524 4.673 1.06E−13 4.57E−13 −9.042 100 103 101.5 NAB2 0.366013072 0.869635193 2.573 2.45E−12 8.30E−12 −10.417 127 83 105 SREBF2 0.712418301 0.583690987 0.138 1.04E−12 3.72E−12 −9.627 120 92 106 MED7 0.444444444 0.814377682 3.82 2.56E−12 8.62E−12 −9.832 128 86 107 ZNRD1 0.555555556 0.73444206 1.941 4.34E−13 1.68E−12 −9.04 111 104 107.5 CIR1 0.529411765 0.748927039 0.856 1.96E−12 6.77E−12 −9.291 125 98 111.5 FLII 0.758169935 0.573497854 2.257 1.08E−15 5.81E−15 −6.924 80 148 114 MORF4L2 0.614379085 0.683476395 5.566 4.00E−13 1.57E−12 −8.242 110 119 114.5 MSL3 0.437908497 0.805257511 0.791 5.98E−11 1.70E−10 −10.452 152 82 117 MTA2 0.91503268 0.411480687 2.58 2.10E−18 1.88E−17 −5.789 48 186 117 TBX21 0.745098039 0.580472103 0.642 4.00E−15 2.00E−14 −6.857 86 149 117.5 TBP 0.464052288 0.788090129 0.642 3.15E−11 9.42E−11 −9.437 144 93 118.5 SARNP 0.849673203 0.488733906 2.753 2.05E−17 1.50E−16 −6.082 59 178 118.5 THRAP3 0.869281046 0.4222103 0.872 3.66E−14 1.68E−13 −6.984 94 144 119 KDM2B 0.640522876 0.637875536 0.287 1.89E−11 5.85E−11 −9.179 139 101 120 ELF4 0.568627451 0.711373391 0.251 4.58E−12 1.52E−11 −8.536 130 112 121 EOMES 0.464052288 0.787017167 0.888 3.93E−11 1.16E−10 −9.255 146 99 122.5 TBL1XR1 0.614379085 0.667918455 0.454 7.20E−12 2.37E−11 −8.352 131 115 123 SUZ12 0.392156863 0.837446352 1.05 8.87E−11 2.45E−10 −9.66 156 91 123.5 SPOP 0.718954248 0.609978541 2.248 2.45E−15 1.26E−14 −6.408 84 163 123.5 PWP1 0.450980392 0.804184549 4.676 8.58E−12 2.80E−11 −8.347 132 116 124 MLX 0.562091503 0.720493562 0.722 2.34E−12 8.02E−12 −8.13 126 122 124 NR4A2 0.738562092 0.55472103 3.667 1.37E−12 4.83E−12 −8.09 122 126 124 NFKBIB 0.77124183 0.550965665 0.642 5.20E−15 2.55E−14 −6.475 87 161 124 TSG101 0.68627451 0.619635193 0.766 1.87E−13 7.76E−13 −6.927 104 146 125 MED8 0.477124183 0.78111588 1.918 1.58E−11 4.97E−11 −8.363 137 114 125.5 GTF2F2 0.549019608 0.719957082 0.993 2.24E−11 6.88E−11 −8.467 140 113 126.5 CENPB 0.385620915 0.841201717 0.556 1.10E−10 2.97E−10 −9.332 160 96 128 ZC3H15 0.732026144 0.572424893 4.849 2.13E−13 8.73E−13 −6.789 105 152 128.5 HDAC3 0.562091503 0.712446352 3.541 1.10E−11 3.50E−11 −7.989 135 127 131 PA2G4 0.823529412 0.495708155 2.114 2.23E−15 1.17E−14 −5.901 82 182 132 ZMIZ1 0.60130719 0.674892704 1.485 1.76E−11 5.49E−11 −7.885 138 128 133 RNF4 0.777777778 0.525214592 3.988 1.42E−13 5.93E−13 −6.338 103 165 134 NMI 0.725490196 0.573497854 0.864 5.82E−13 2.20E−12 −6.612 114 156 135 USF1 0.352941176 0.863733906 3.491 1.21E−10 3.21E−10 −8.917 162 109 135.5 COPS2 0.535947712 0.730686695 0.299 2.44E−11 7.45E−11 −7.668 141 131 136 ZFYVE19 0.333333333 0.870171674 1.293 6.77E−10 1.66E−09 −9.316 176 97 136.5 BAZ1B 0.594771242 0.677575107 0.163 3.13E−11 9.42E−11 −7.735 143 130 136.5 STAT2 0.352941176 0.855150215 0.411 9.50E−10 2.26E−09 −9.432 181 94 137.5 ZFP91 0.437908497 0.799892704 0.214 1.85E−10 4.82E−10 −8.842 165 110 137.5 HNRNPD 0.653594771 0.629291845 0.189 9.58E−12 3.08E−11 −7.114 133 142 137.5 PREB 0.620915033 0.67167382 2.345 1.21E−12 4.31E−12 −6.63 121 155 138 TAF11 0.385620915 0.83583691 0.714 3.74E−10 9.54E−10 −8.933 169 108 138.5 EED 0.431372549 0.807403433 3.645 1.10E−10 2.97E−10 −8.254 159 118 138.5 HDAC7 0.777777778 0.493025751 0.263 2.75E−11 8.36E−11 −7.4 142 135 138.5 GTF2E2 0.496732026 0.75751073 2.025 7.57E−11 2.12E−10 −8.096 154 125 139.5 SF1 0.732026144 0.549892704 4.441 9.58E−12 3.08E−11 −6.964 134 145 139.5 HIF1A 0.843137255 0.464592275 2.198 7.99E−15 3.82E−14 −5.468 90 196 143 CALR 0.91503268 0.375536481 3.187 1.65E−15 8.79E−15 −5.326 81 205 143 SMARCD2 0.437908497 0.801502146 1.157 1.32E−10 3.50E−10 −7.852 163 129 146 PML 0.522875817 0.736051502 0.163 7.13E−11 2.01E−10 −7.14 153 141 147 EDF1 0.967320261 0.317060086 2.496 6.36E−18 4.81E−17 −4.552 57 238 147.5 SREBF1 0.568627451 0.692596567 0.227 1.38E−10 3.63E−10 −7.438 164 134 149 CCDC71 0.326797386 0.872317597 1.731 1.19E−09 2.79E−09 −8.289 184 117 150.5 GTF2B 0.62745098 0.651287554 3.622 1.58E−11 4.97E−11 −6.284 136 169 152.5 MNDA 0.339869281 0.862660944 2.674 1.39E−09 3.24E−09 −8.14 185 121 153 PKNOX1 0.405228758 0.814914163 0.333 1.43E−09 3.29E−09 −8.163 187 120 153.5 RNF14 0.503267974 0.745171674 0.465 2.78E−10 7.17E−10 −7.199 167 140 153.5 GATA3 0.679738562 0.593347639 0.379 5.20E−11 1.51E−10 −6.599 149 158 153.5 PRDM1 0.424836601 0.799892704 0.214 1.41E−09 3.26E−09 −8.122 186 123 154.5 BHLHE40 0.954248366 0.35139485 4.789 9.84E−19 9.22E−18 −4.262 46 263 154.5 HTATIP2 0.490196078 0.75751073 4.108 2.11E−10 5.47E−10 −6.926 166 147 156.5 GTF2A1 0.522875817 0.722103004 0.176 8.64E−10 2.09E−09 −7.247 178 139 158.5 ID2 0.973856209 0.295064378 3.079 3.31E−17 2.30E−16 −4.316 63 255 159 FUBP1 0.68627451 0.586373391 0.151 5.54E−11 1.58E−10 −6.3 151 168 159.5 AES 0.705882353 0.582081545 2.263 4.26E−12 1.42E−11 −5.718 129 191 160 RBM38 0.823529412 0.456545064 0.911 1.84E−12 6.40E−12 −5.384 124 200 162 HDAC5 0.326797386 0.869098712 1.852 2.57E−09 5.75E−09 −7.652 193 132 162.5 PBRM1 0.470588235 0.761802575 0.138 1.85E−09 4.20E−09 −7.354 190 137 163.5 XBP1 0.575163399 0.692060086 2.278 5.48E−11 1.58E−10 −5.972 150 180 165 CIZ1 0.522875817 0.720493562 0.239 1.14E−09 2.68E−09 −6.807 183 150 166.5 TARBP2 0.411764706 0.802038627 0.941 6.58E−09 1.40E−08 −7.528 203 133 168 CTBP1 0.483660131 0.747854077 0.506 3.19E−09 6.92E−09 −7.317 199 138 168.5 BLOC1S1 0.529411765 0.719420601 2.138 5.18E−10 1.31E−09 −6.211 171 173 172 TCERG1 0.594771242 0.659871245 0.287 6.11E−10 1.52E−09 −6.224 173 172 172.5 PLRG1 0.431372549 0.789699571 0.848 3.69E−09 7.95E−09 −6.805 200 151 175.5 TCF3 0.437908497 0.785407725 1.628 3.12E−09 6.79E−09 −6.759 198 154 176 SNW1 0.679738562 0.595493562 3.37 3.68E−11 1.09E−10 −5.09 145 212 178.5 UHRF2 0.444444444 0.771995708 0.379 1.33E−08 2.61E−08 −7.039 220 143 181.5 RBL2 0.745098039 0.520386266 1 1.08E−10 2.95E−10 −5.267 158 208 183 CNOT7 0.529411765 0.71083691 1.379 2.21E−09 4.99E−09 −6.101 191 176 183.5 CNOT1 0.614379085 0.630901288 0.722 3.11E−09 6.79E−09 −6.152 197 174 185.5 ECD 0.490196078 0.749463519 2.333 9.22E−10 2.22E−09 −5.608 179 192 185.5 ATF2 0.418300654 0.794527897 2.993 1.02E−08 2.05E−08 −6.509 214 159 186.5 GATAD1 0.503267974 0.725858369 0.485 7.78E−09 1.62E−08 −6.336 207 166 186.5 TRIM28 0.437908497 0.783261803 3.336 4.62E−09 9.92E−09 −6.102 201 175 188 CBX4 0.45751634 0.762339056 0.138 1.11E−08 2.21E−08 −6.426 216 162 189 REXO4 0.418300654 0.795064378 4.815 9.25E−09 1.89E−08 −6.262 211 170 190.5 ATF6B 0.503267974 0.72639485 0.299 7.13E−09 1.49E−08 −6.023 206 179 192.5 MEN1 0.392156863 0.811158798 0.526 2.06E−08 3.88E−08 −6.605 229 157 193 RFC1 0.392156863 0.811695279 2.251 1.87E−08 3.56E−08 −6.503 226 160 193 NFKB2 0.764705882 0.501072961 0.275 7.64E−11 2.12E−10 −4.63 155 234 194.5 RBPJ 0.666666667 0.583690987 2.154 1.73E−09 3.93E−09 −5.337 189 204 196.5 GTF3A 0.60130719 0.653969957 2.86 5.93E−10 1.49E−09 −4.904 172 224 198 DEAF1 0.333333333 0.853004292 1.551 3.22E−08 5.90E−08 −6.408 235 164 199.5 NDUFA13 0.947712418 0.283798283 4.374 1.38E−12 4.84E−12 −3.99 123 276 199.5 DAXX 0.516339869 0.712982833 0.546 9.92E−09 2.01E−08 −5.724 213 190 201.5 NT5C 0.790849673 0.468347639 1.852 1.20E−10 3.21E−10 −4.522 161 242 201.5 VEZF1 0.411764706 0.798283262 0.832 1.32E−08 2.59E−08 −5.798 219 185 202 NOTCH1 0.732026144 0.527896996 0.07 2.92E−10 7.50E−10 −4.574 168 237 202.5 HTATSF1 0.37254902 0.826716738 3.346 1.86E−08 3.56E−08 −5.735 225 188 206.5 PHF6 0.418300654 0.802038627 3.586 2.49E−09 5.60E−09 −4.94 192 222 207 CREB1 0.444444444 0.763412017 0.124 5.61E−08 1.01E−07 −6.1 239 177 208 HLTF 0.359477124 0.837982833 2.362 1.39E−08 2.69E−08 −5.558 222 194 208 TSC22D4 0.699346405 0.5472103 1.967 2.69E−09 5.94E−09 −4.971 195 221 208 SUB1 0.967320261 0.22639485 5.41 4.98E−11 1.45E−10 −4.099 148 271 209.5 MED28 0.790849673 0.505364807 2.807 3.36E−13 1.37E−12 −3.125 106 315 210.5 SMARCA5 0.437908497 0.762339056 0.275 1.58E−07 2.64E−07 −6.257 258 171 214.5 HMG20B 0.516339869 0.700107296 0.687 7.05E−08 1.25E−07 −5.775 243 187 215 TWISTNB 0.450980392 0.764484979 3.623 1.92E−08 3.65E−08 −5.347 227 203 215 MED24 0.405228758 0.7972103 2.611 4.02E−08 7.34E−08 −5.476 236 195 215.5 TAF1B 0.45751634 0.75751073 1.362 2.49E−08 4.61E−08 −5.415 233 198 215.5 BOLA2 0.516339869 0.709763948 4.932 1.64E−08 3.18E−08 −5.26 223 209 216 ZRANB2 0.450980392 0.766630901 3.018 1.34E−08 2.61E−08 −5.078 221 214 217.5 GTF2A2 0.483660131 0.739806867 5.343 1.23E−08 2.44E−08 −5.036 218 217 217.5 HES6 0.352941176 0.831008584 0.66 1.36E−07 2.31E−07 −5.822 254 183 218.5 PIAS4 0.333333333 0.839592275 0.687 4.25E−07 6.61E−07 −6.325 277 167 222 MTA3 0.535947712 0.69527897 4.553 1.05E−08 2.11E−08 −4.665 215 231 223 MED27 0.411764706 0.785944206 2.521 1.12E−07 1.94E−07 −5.42 250 197 223.5 FUS 0.777777778 0.447961373 0.566 1.74E−08 3.35E−08 −4.915 224 223 223.5 RELA 0.692810458 0.563841202 1.39 6.39E−10 1.57E−09 −4.087 175 272 223.5 MTF2 0.424836601 0.772532189 0.322 1.75E−07 2.91E−07 −5.588 259 193 226 BRD1 0.470588235 0.731223176 0.299 2.63E−07 4.25E−07 −5.734 266 189 227.5 SND1 0.673202614 0.565987124 0.475 8.43E−09 1.74E−08 −4.416 209 248 228.5 RLIM 0.758169935 0.490343348 0.138 1.08E−09 2.57E−09 −3.978 182 277 229.5 AIM2 0.633986928 0.575643777 0.516 4.24E−07 6.61E−07 −5.809 276 184 230 TOX4 0.68627451 0.546137339 0.043 2.03E−08 3.85E−08 −4.63 228 235 231.5 ATF7IP 0.718954248 0.519849785 0.275 6.84E−09 1.44E−08 −4.278 204 260 232 PNN 0.679738562 0.567596567 0.287 2.62E−09 5.81E−09 −4.14 194 270 232 PLAGL2 0.346405229 0.833154506 2.82 2.27E−07 3.72E−07 −5.348 263 202 232.5 RELB 0.477124183 0.735515021 3.689 5.92E−08 1.06E−07 −4.901 241 225 233 AGGF1 0.307189542 0.862660944 3.372 2.10E−07 3.46E−07 −5.271 261 207 234 PHRF1 0.529411765 0.688841202 0.485 6.62E−08 1.18E−07 −4.817 242 226 234 L3MBTL2 0.346405229 0.825643777 0.356 8.41E−07 1.25E−06 −5.943 291 181 236 TCEA1 0.725490196 0.528433476 3.658 7.58E−10 1.85E−09 −3.551 177 297 237 SMARCC2 0.575163399 0.64055794 1.328 1.55E−07 2.60E−07 −5.02 257 218 237.5 TBPL1 0.470588235 0.739270386 2.687 7.86E−08 1.38E−07 −4.667 245 230 237.5 CREM 0.594771242 0.642703863 2.753 8.54E−09 1.75E−08 −4.217 210 265 237.5 GTF3C1 0.549019608 0.663626609 0.098 1.85E−07 3.07E−07 −5.042 260 216 238 IRF3 0.562091503 0.658261803 0.696 7.32E−08 1.29E−07 −4.663 244 232 238 ING4 0.522875817 0.702253219 2.57 2.15E−08 4.02E−08 −4.453 230 246 238 RUNX2 0.705882353 0.550429185 1.118 6.27E−10 1.55E−09 −3.467 174 303 238.5 IRF4 0.424836601 0.769313305 0.299 2.89E−07 4.67E−07 −5.053 267 215 241 THOC2 0.535947712 0.670600858 0.138 3.66E−07 5.78E−07 −5.244 273 210 241.5 ZMAT2 0.653594771 0.576716738 0.367 2.93E−08 5.39E−08 −4.382 234 250 242 NFATC1 0.830065359 0.393776824 1.59 6.20E−09 1.32E−08 −3.773 202 282 242 STAT6 0.712418301 0.545064378 1.618 5.04E−10 1.28E−09 −3.188 170 314 242 OVCA2 0.359477124 0.817596567 0.516 5.87E−07 8.97E−07 −5.309 282 206 244 NCOR2 0.555555556 0.660944206 0.124 1.17E−07 1.99E−07 −4.587 253 236 244.5 TRIM27 0.359477124 0.8277897 3.365 9.86E−08 1.71E−07 −4.533 248 241 244.5 HCLS1 0.947712418 0.303648069 0.496 4.88E−14 2.17E−13 −1.096 97 393 245 CNOT2 0.60130719 0.623390558 0.651 5.47E−08 9.91E−08 −4.32 238 253 245.5 LRRFIP1 0.882352941 0.359978541 3.089 4.88E−11 1.43E−10 −2.185 147 349 248 SBDS 0.588235294 0.625 0.722 2.35E−07 3.83E−07 −4.634 264 233 248.5 CSDA 0.509803922 0.689377682 0.696 7.14E−07 1.07E−06 −5.197 288 211 249.5 CNOT3 0.509803922 0.692060086 0.39 4.98E−07 7.67E−07 −4.985 280 219 249.5 GTF2H1 0.359477124 0.820815451 1.996 3.40E−07 5.41E−07 −4.793 271 228 249.5 EYA3 0.366013072 0.804184549 0.275 2.19E−06 3.11E−06 −5.393 302 199 250.5 PHB2 0.758169935 0.506974249 6.564 9.39E−11 2.58E−10 −2.142 157 351 254 SMARCA4 0.633986928 0.579935622 1.208 2.48E−07 4.04E−07 −4.511 265 244 254.5 FLI1 0.790849673 0.439914163 0.275 6.82E−09 1.44E−08 −3.426 205 307 256 ZFPL1 0.333333333 0.831008584 2.305 1.86E−06 2.66E−06 −5.09 301 213 257 IKZF3 0.705882353 0.525214592 3.372 2.16E−08 4.03E−08 −3.773 231 283 257 GON4L 0.516339869 0.688304721 0.057 3.73E−07 5.87E−07 −4.512 274 243 258.5 MORF4L1 0.758169935 0.483369099 5.498 2.89E−09 6.36E−09 −2.892 196 322 259 TRIP12 0.522875817 0.681330472 1.531 4.30E−07 6.65E−07 −4.534 279 240 259.5 UTP6 0.37254902 0.794527897 0.202 4.19E−06 5.65E−06 −5.354 320 201 260.5 IFI35 0.60130719 0.634120172 1.761 1.21E−08 2.40E−08 −3.457 217 305 261 PURB 0.555555556 0.65611588 0.422 2.25E−07 3.71E−07 −4.21 262 267 264.5 BAZ1A 0.496732026 0.689377682 0.202 3.27E−06 4.48E−06 −4.974 313 220 266.5 DDX54 0.549019608 0.667918455 3.557 1.03E−07 1.77E−07 −3.737 249 285 267 NFX1 0.45751634 0.736051502 3.637 6.64E−07 1.00E−06 −4.317 286 254 270 NCOA2 0.535947712 0.67167382 0.31 3.17E−07 5.08E−07 −4.049 269 273 271 SIN3A 0.450980392 0.738733906 0.202 1.01E−06 1.47E−06 −4.44 296 247 271.5 PIAS1 0.470588235 0.724248927 0.322 7.09E−07 1.06E−06 −4.288 287 257 272 NAB1 0.385620915 0.785407725 0.202 3.32E−06 4.53E−06 −4.73 316 229 272.5 IRF9 0.444444444 0.747854077 2.536 6.10E−07 9.25E−07 −4.273 284 262 273 ATF4 0.895424837 0.321888412 0.526 9.39E−10 2.25E−09 −1.756 180 368 274 GNPTAB 0.418300654 0.758583691 0.275 3.09E−06 4.27E−06 −4.551 312 239 275.5 JUND 0.516339869 0.677038627 0.227 1.64E−06 2.36E−06 −4.342 299 252 275.5 ARNT 0.418300654 0.754828326 0.239 5.15E−06 6.81E−06 −4.803 326 227 276.5 UBXN4 0.581699346 0.642167382 3.297 5.36E−08 9.76E−08 −3.023 237 318 277.5 IKZF2 0.483660131 0.701180258 0.084 3.26E−06 4.48E−06 −4.472 314 245 279.5 TFAM 0.366013072 0.804184549 3.072 2.19E−06 3.11E−06 −4.287 303 258 280.5 SP3 0.437908497 0.751072961 1.417 8.55E−07 1.26E−06 −4.159 292 269 280.5 STAT3 0.941176471 0.25 0.31 1.52E−09 3.48E−09 −1.639 188 373 280.5 STAT5A 0.607843137 0.598712446 0.322 5.95E−07 9.06E−07 −3.78 283 281 282 BPTF 0.575163399 0.625536481 0.084 1.07E−06 1.55E−06 −4.183 297 268 282.5 MIER1 0.712418301 0.503755365 0.287 1.40E−07 2.37E−07 −3.226 255 313 284 EGR1 0.614379085 0.597103004 1.227 3.27E−07 5.22E−07 −3.484 270 301 285.5 CCNT1 0.424836601 0.761802575 3.671 8.95E−07 1.32E−06 −3.844 293 280 286.5 NR1H2 0.679738562 0.545064378 0.575 5.73E−08 1.03E−07 −2.644 240 333 286.5 XRCC6 0.346405229 0.814377682 0.604 5.06E−06 6.71E−06 −4.402 325 249 287 NFIL3 0.326797386 0.830472103 4.118 4.61E−06 6.17E−06 −4.311 322 256 289 CHURC1 0.522875817 0.693133047 5.643 8.31E−08 1.46E−07 −2.647 246 332 289 MLLT6 0.503267974 0.691523605 0.748 1.17E−06 1.69E−06 −3.731 298 286 292 VAV1 0.725490196 0.503755365 2.639 2.32E−08 4.31E−08 −2.11 232 354 293 ELF1 0.843137255 0.374463519 1.941 9.39E−09 1.91E−08 −1.628 212 374 293 PHB 0.705882353 0.532725322 4.066 7.82E−09 1.62E−08 −1.5 208 378 293 NCOA4 0.496732026 0.700643777 1.275 7.60E−07 1.13E−06 −3.541 289 298 293.5 CAND1 0.392156863 0.774678112 1.35 6.99E−06 9.16E−06 −4.276 329 261 295 MED14 0.424836601 0.743562232 0.379 1.07E−05 1.39E−05 −4.284 334 259 296.5 MED1 0.62745098 0.564914163 0.227 3.27E−06 4.48E−06 −3.978 315 278 296.5 IRF2 0.633986928 0.560622318 0.356 2.53E−06 3.53E−06 −3.742 309 284 296.5 ZBTB32 0.339869281 0.816523605 0.941 8.02E−06 1.05E−05 −4.226 330 264 297 MED17 0.385620915 0.771995708 0.163 2.07E−05 2.57E−05 −4.36 347 251 299 TMF1 0.614379085 0.580472103 0.263 2.44E−06 3.42E−06 −3.65 308 291 299.5 VAMP7 0.385620915 0.782188841 0.444 5.25E−06 6.92E−06 −4.036 327 275 301 TRPS1 0.379084967 0.788090129 0.454 4.90E−06 6.51E−06 −3.934 324 279 301.5 NFRKB 0.37254902 0.784871245 0.299 1.61E−05 2.04E−05 −4.214 340 266 303 NR4A1 0.732026144 0.467811159 4.142 8.31E−07 1.24E−06 −3.002 290 319 304.5 MMS19 0.385620915 0.776287554 0.356 1.18E−05 1.51E−05 −4.042 336 274 305 IKZF1 0.732026144 0.485515021 4.707 9.77E−08 1.70E−07 −1.98 247 363 305 DR1 0.411764706 0.761266094 3.046 4.58E−06 6.14E−06 −3.671 321 290 305.5 NFATC2 0.424836601 0.747317597 0.214 6.63E−06 8.71E−06 −3.644 328 292 310 PPIE 0.503267974 0.686158798 1.144 2.33E−06 3.29E−06 −3.065 305 316 310.5 CAMTA2 0.411764706 0.753755365 0.239 1.23E−05 1.58E−05 −3.675 337 289 313 MLXIP 0.581699346 0.599785408 0.202 1.03E−05 1.33E−05 −3.638 333 293 313 NCOA3 0.718954248 0.490343348 0.433 3.08E−07 4.95E−07 −2.073 268 358 313 RPL7L1 0.490196078 0.704935622 4.299 9.35E−07 1.37E−06 −2.584 294 335 314.5 KAT5 0.37254902 0.783798283 0.379 1.86E−05 2.34E−05 −3.695 343 288 315.5 EP300 0.483660131 0.692060086 0.098 9.99E−06 1.30E−05 −3.513 332 299 315.5 XAB2 0.496732026 0.689914163 0.696 3.06E−06 4.24E−06 −2.996 311 320 315.5 FOXN3 0.418300654 0.74195279 2.053 2.65E−05 3.27E−05 −3.702 349 287 318 CBFA2T2 0.339869281 0.832081545 1.651 6.63E−07 1.00E−06 −2.132 285 352 318.5 TCF20 0.712418301 0.480150215 0.084 2.29E−06 3.24E−06 −2.642 304 334 319 DPF2 0.594771242 0.607296137 0.299 9.89E−07 1.45E−06 −2.36 295 345 320 RNF2 0.37254902 0.787553648 2.488 1.12E−05 1.44E−05 −3.313 335 309 322 PHF20L1 0.516339869 0.65611588 0.151 1.97E−05 2.46E−05 −3.511 345 300 322.5 CEBPZ 0.444444444 0.724248927 0.401 1.41E−05 1.79E−05 −3.452 339 306 322.5 CDK7 0.392156863 0.778433476 2.299 4.15E−06 5.61E−06 −2.753 319 328 323.5 SCAP 0.352941176 0.793454936 0.151 4.45E−05 5.42E−05 −3.628 354 294 324 LIMD1 0.503267974 0.668454936 0.176 1.92E−05 2.41E−05 −3.328 344 308 326 BCLAF1 0.660130719 0.521995708 0.189 9.52E−06 1.24E−05 −2.833 331 324 327.5 ZFX 0.339869281 0.810085837 2.667 2.03E−05 2.52E−05 −3.313 346 310 328 UIMC1 0.45751634 0.700107296 0.516 5.92E−05 7.07E−05 −3.6 361 296 328.5 TBC1D2B 0.379084967 0.770922747 0.239 4.75E−05 5.77E−05 −3.48 355 302 328.5 MAF1 0.823529412 0.379291845 1.718 1.16E−07 1.98E−07 −0.705 252 406 329 HIVEP1 0.450980392 0.704399142 0.151 7.06E−05 8.36E−05 −3.612 364 295 329.5 ING3 0.450980392 0.707081545 0.322 5.26E−05 6.36E−05 −3.466 357 304 330.5 TCF25 0.758169935 0.446351931 6.119 3.46E−07 5.48E−07 −1.135 272 390 331 STAT1 0.758169935 0.44527897 4.683 3.93E−07 6.17E−07 −1.189 275 389 332 RNF166 0.607843137 0.581008584 0.356 4.80E−06 6.41E−06 −2.168 323 350 336.5 PFDN5 0.928104575 0.239806867 2.205 1.15E−07 1.98E−07 −0.068 251 424 337.5 RNF114 0.712418301 0.493025751 2.947 5.17E−07 7.94E−07 −1.06 281 395 338 EIF3H 0.973856209 0.154506438 8.085 4.27E−07 6.63E−07 −0.973 278 398 338 UBN1 0.411764706 0.738197425 0.098 8.01E−05 9.45E−05 −3.249 365 312 338.5 PHF14 0.31372549 0.827253219 2.021 3.50E−05 4.28E−05 −2.776 352 327 339.5 PHF15 0.405228758 0.740343348 0.151 0.000119637 0.000139361 −3.297 370 311 340.5 BTF3 0.980392157 0.149141631 8.357 1.45E−07 2.44E−07 −0.021 256 425 340.5 DMTF1 0.359477124 0.786480687 1.275 5.39E−05 6.47E−05 −2.858 359 323 341 CCNL2 0.751633987 0.439377682 1.465 1.82E−06 2.61E−06 −1.259 300 386 343 MYC 0.483660131 0.683476395 0.333 2.69E−05 3.31E−05 −2.364 350 344 347 GTF2H2 0.326797386 0.803111588 0.848 0.000200549 0.000228065 −3.026 379 317 348 KDM5C 0.522875817 0.627682403 0.189 0.000193485 0.000221787 −2.924 376 321 348.5 SERTAD1 0.418300654 0.731759657 0.791 8.64E−05 0.000101409 −2.693 367 330 348.5 CXXC1 0.496732026 0.665236052 0.506 5.28E−05 6.36E−05 −2.458 356 341 348.5 MBD2 0.424836601 0.724248927 0.824 0.000104235 0.000121749 −2.688 369 331 350 NSD1 0.640522876 0.533261803 0.556 2.38E−05 2.95E−05 −2.129 348 353 350.5 IRF1 0.745098039 0.444206009 1.884 2.38E−06 3.36E−06 −0.922 306 399 352.5 RNF19A 0.496732026 0.665236052 0.239 5.28E−05 6.36E−05 −2.268 358 348 353 RUNX3 0.692810458 0.495708155 2.269 4.11E−06 5.57E−06 −1.195 318 388 353 RNF44 0.660130719 0.504828326 0.227 5.44E−05 6.51E−05 −2.316 360 347 353.5 CCNL1 0.751633987 0.432403433 0.475 3.94E−06 5.36E−06 −1.103 317 392 354.5 ZBTB1 0.339869281 0.787017167 0.367 0.000358696 0.000401553 −2.808 385 325 355 STAT5B 0.555555556 0.600321888 0.07 0.000131324 0.000151339 −2.564 374 336 355 TLE3 0.54248366 0.613197425 0.176 0.000128277 0.000148223 −2.501 373 338 355.5 ZBTB17 0.346405229 0.782725322 0.516 0.00031086 0.000349819 −2.741 383 329 356 HIVEP2 0.392156863 0.737124464 0.111 0.000560128 0.000620604 −2.787 389 326 357.5 MED15 0.581699346 0.588519313 1.59 3.39E−05 4.16E−05 −1.855 351 365 358 MLLT3 0.503267974 0.646995708 0.163 0.00018045 0.000207397 −2.381 375 342 358.5 DNM2 0.732026144 0.442060086 0.275 1.40E−05 1.79E−05 −1.493 338 379 358.5 ABT1 0.254901961 0.860515021 4.262 0.000222909 0.000252825 −2.496 380 339 359.5 RNF125 0.568627451 0.599785408 0.585 3.95E−05 4.82E−05 −1.844 353 366 359.5 MKI67IP 0.39869281 0.741416309 0.566 0.000198924 0.000226816 −2.375 378 343 360.5 CREBBP 0.483660131 0.672746781 0.74 8.55E−05 0.000100724 −2.104 366 356 361 SP100 0.895424837 0.262339056 1.664 2.41E−06 3.38E−06 −0.386 307 416 361.5 NFAT5 0.483660131 0.657188841 0.057 0.000393066 0.000437755 −2.562 387 337 362 REL 0.522875817 0.631974249 0.367 0.000128003 0.000148223 −1.999 372 362 367 NFKBIE 0.339869281 0.774678112 0.506 0.001295403 0.001411775 −2.471 396 340 368 MAX 0.45751634 0.684012876 0.506 0.000309565 0.000349274 −2.109 382 355 368.5 NACA 1 0.083154506 7.483 2.93E−06 4.07E−06 −0.001 310 427 368.5 CREB3 0.320261438 0.792918455 0.39 0.001142898 0.001253407 −2.325 392 346 369 ARID5B 0.424836601 0.705472103 0.214 0.000691156 0.000763816 −2.098 390 357 373.5 KDM5A 0.496732026 0.645922747 2.014 0.0003574 0.000401144 −1.727 384 369 376.5 SCAND1 0.333333333 0.781652361 1.036 0.001140785 0.001253407 −2.006 393 361 377 ARID1A 0.718954248 0.43776824 1.091 8.67E−05 0.000101559 −1.245 368 387 377.5 HSF1 0.424836601 0.696888412 0.536 0.001491896 0.001615596 −2.054 398 359 378.5 ATRX 0.555555556 0.588519313 0.07 0.00038822 0.000433479 −1.644 386 372 379 ZBTB7A 0.470588235 0.652360515 0.163 0.001743754 0.001874209 −2.01 401 360 380.5 VGLL4 0.575163399 0.572961373 0.705 0.000279845 0.00031657 −1.462 381 380 380.5 FOSB 0.444444444 0.680793991 0.214 0.001252232 0.001369827 −1.657 394 371 382.5 SERTAD2 0.424836601 0.694742489 0.202 0.001792375 0.001916907 −1.914 403 364 383.5 BCL11B 0.470588235 0.652360515 0.111 0.001743754 0.001874209 −1.777 400 367 383.5 STAT4 0.77124183 0.38304721 1.803 6.56E−05 7.79E−05 −0.734 363 404 383.5 MKL1 0.54248366 0.589592275 0.176 0.001048303 0.001155546 −1.503 391 377 384 MLL5 0.751633987 0.405579399 0.516 6.18E−05 7.36E−05 −0.666 362 407 384.5 NPM1 0.980392157 0.116416309 8.269 1.61E−05 2.04E−05 0 341 428 384.5 SQSTM1 0.941176471 0.181330472 3.383 1.64E−05 2.06E−05 0 342 429 385.5 NR3C1 0.405228758 0.709763948 0.138 0.002309675 0.002457951 −1.615 405 375 390 NCOR1 0.640522876 0.511266094 2.467 0.000196195 0.000224297 −0.744 377 403 390 NR4A3 0.437908497 0.660944206 0.604 0.009325689 0.009732135 −1.716 413 370 391.5 SMYD3 0.37254902 0.729077253 0.163 0.005458298 0.005751899 −1.605 409 376 392.5 IRF7 0.346405229 0.753755365 0.356 0.00503697 0.005320917 −1.424 408 381 394.5 MYSM1 0.614379085 0.498390558 0.043 0.004550735 0.004819083 −1.297 407 383 395 KLF6 0.803921569 0.339055794 2.618 0.000123318 0.000143261 −0.074 371 423 397 DENND4A 0.640522876 0.488733906 2.425 0.00129713 0.001411775 −0.866 395 400 397.5 NFKB1 0.424836601 0.672746781 0.151 0.009688986 0.010062537 −1.304 415 382 398.5 MED12 0.496732026 0.604077253 0.124 0.009598852 0.009993008 −1.279 414 385 399.5 PNRC1 0.575163399 0.552038627 0.526 0.001606225 0.001735045 −0.726 399 405 402 CCNT2 0.37254902 0.704935622 0.31 0.02915911 0.029780987 −1.296 422 384 403 NFATC3 0.535947712 0.572961373 0.111 0.005918713 0.006206728 −1.035 411 396 403.5 CHD2 0.477124183 0.620708155 0.07 0.0111921 0.011567854 −1.108 417 391 404 UBTF 0.516339869 0.597103004 0.275 0.004173597 0.004430592 −0.745 406 402 404 RNF7 0.620915033 0.501609442 5.687 0.002240673 0.002390421 −0.521 404 408 406 ZFP36L2 0.660130719 0.466738197 2.348 0.00148367 0.001610735 −0.395 397 415 406 LDB1 0.450980392 0.637875536 0.516 0.018555368 0.019041342 −1.075 420 394 407 CHD3 0.464052288 0.626609442 0.176 0.017116817 0.017607036 −1.007 419 397 408 MXD1 0.490196078 0.608369099 0.189 0.01097318 0.011368847 −0.756 416 401 408.5 ETS1 0.941176471 0.153433476 5.962 0.000406242 0.000451263 0 388 430 409 BTG2 0.745098039 0.373927039 0.595 0.001782086 0.001910645 −0.002 402 426 414 SKIL 0.732026144 0.371781116 0.202 0.00584294 0.006142213 −0.298 410 420 415 PER1 0.640522876 0.461909871 0.227 0.008718086 0.009120133 −0.335 412 419 415.5 SMAD7 0.444444444 0.635729614 0.239 0.030500087 0.031076921 −0.459 423 410 416.5 NOTCH2 0.588235294 0.475321888 0.138 0.076060047 0.077133836 −0.509 425 409 417 MYBBP1A 0.496732026 0.589055794 0.299 0.024162196 0.02473612 −0.421 421 413 417 TGIF1 0.575163399 0.522532189 0.585 0.01249321 0.012881755 −0.373 418 417 417.5 DTX3L 0.607843137 0.438304721 0.163 0.15332471 0.154039511 −0.437 429 411 420 HBP1 0.437908497 0.608369099 0.227 0.149341221 0.150388005 −0.436 428 412 420 JMJD1C 0.424836601 0.630901288 0.151 0.100304434 0.101481716 −0.42 426 414 420 PYHIN1 0.450980392 0.604613734 0.333 0.103601863 0.104572372 −0.369 427 418 422.5 PBXIP1 0.555555556 0.511802575 0.189 0.064451529 0.065515587 −0.121 424 422 423 MAML2 0.39869281 0.614806867 0.098 0.401887503 0.402822125 −0.169 430 421 425.5 SP110 0.673202614 0.325107296 0.214 0.556195696 0.556195696 0 431 431 431
TABLE-US-00014 TABLE 12 Ranked top surface cytokines differentially expressed in cluster 9 rank_hy- Gene TP TN thresh_mhg hyper_pval hyper_qval gen_qval per_qval rank_gen_qval mean_rank REEP4 0.784313725 0.833690987 4.746 1.02E−56 6.73E−55 −69.638 3 1 2 HMGB1 0.888888889 0.749463519 9.01 4.20E−57 4.14E−55 −55.462 2 2 2 HMMR 0.614379085 0.969420601 3.732 9.80E−80 1.93E−77 −39.839 1 3 2 CMTM7 0.888888889 0.586909871 7.429 2.70E−32 1.33E−30 −30.936 4 4 4 ATPIF1 0.803921569 0.658261803 4.569 2.70E−29 7.60E−28 −22.452 6 6 6 ENTPD1 0.777777778 0.684549356 0.263 2.51E−29 7.60E−28 −21.068 7 7 7 LGALS1 1 0.389484979 9.413 7.01E−32 2.76E−30 −19.396 5 9 7 LDLR 0.352941176 0.93776824 3.8 3.33E−23 5.96E−22 −25.975 11 5 8 CLIC4 0.653594771 0.735515021 0.263 8.13E−22 1.23E−20 −20.97 13 8 10.5 HAVCR2 0.77124183 0.641094421 0.322 1.95E−23 3.84E−22 −16.568 10 11 10.5 PGLYRP1 0.908496732 0.519313305 4.99 1.20E−27 2.95E−26 −13.116 8 20 14 HNRNPU 0.869281046 0.482296137 0.516 5.29E−19 5.79E−18 −13.845 18 16 17 CCRL2 0.568627451 0.768776824 3.306 1.24E−17 1.11E−16 −14.77 22 13 17.5 ADAM8 0.660130719 0.706008584 1.722 3.90E−19 4.52E−18 −13.585 17 18 17.5 PGP 0.385620915 0.886802575 1.485 2.06E−16 1.45E−15 −18.956 28 10 19 CD2BP2 0.745098039 0.629828326 2.842 1.51E−19 1.86E−18 −11.644 16 23 19.5 PGRMC1 0.653594771 0.704399142 3.269 2.32E−18 2.29E−17 −12.887 20 21 20.5 TFRC 0.562091503 0.766630901 2.325 8.10E−17 6.14E−16 −13.808 26 17 21.5 GDI2 0.993464052 0.307939914 6.483 3.01E−22 4.94E−21 −10.08 12 33 22.5 CD48 0.973856209 0.384656652 6.166 4.69E−25 1.03E−23 −9.295 9 36 22.5 CD200R1 0.405228758 0.869635193 2.832 1.13E−15 6.52E−15 −14.696 34 14 24 NUP85 0.555555556 0.765021459 2.82 4.41E−16 2.90E−15 −13.391 30 19 24.5 SMPD1 0.522875817 0.785407725 0.632 1.62E−15 9.04E−15 −14.049 36 15 25.5 SIVA1 0.60130719 0.730150215 2.032 2.29E−16 1.56E−15 −11.903 29 22 25.5 ULBP1 0.385620915 0.878218884 0.926 3.90E−15 1.92E−14 −16.339 41 12 26.5 CAST 0.810457516 0.553648069 2.934 5.58E−19 5.79E−18 −9.419 19 35 27 GPR65 0.725490196 0.625536481 1.66 2.79E−17 2.20E−16 −10.338 25 30 27.5 IFNG 0.594771242 0.723175966 1.345 3.93E−15 1.92E−14 −10.799 40 27 33.5 TNFRSF9 0.784313725 0.548819742 0.454 5.19E−16 3.20E−15 −9.018 32 38 35 BSG 0.954248366 0.377145923 5.178 6.04E−21 8.50E−20 −6.558 14 59 36.5 H2-M3 0.647058824 0.67167382 0.678 1.13E−14 4.84E−14 −10.397 46 29 37.5 CKLF 0.405228758 0.85139485 3.815 2.59E−13 9.09E−13 −11.349 56 24 40 CX3CR1 0.418300654 0.84388412 4.682 1.72E−13 6.18E−13 −11.074 55 25 40 USP14 0.568627451 0.737124464 0.84 2.37E−14 9.72E−14 −10.133 48 32 40 MIF 0.947712418 0.311695279 6.893 1.21E−14 5.08E−14 −9.936 47 34 40.5 EZR 0.934640523 0.356759657 4.227 1.94E−16 1.41E−15 −6.892 27 56 41.5 CD96 0.745098039 0.591201717 4.496 5.07E−16 3.20E−15 −7.582 31 54 42.5 ERP29 0.666666667 0.653433476 3.668 1.11E−14 4.84E−14 −8.397 45 43 44 PDIA3 0.973856209 0.305257511 5.897 4.84E−18 4.54E−17 −6.206 21 68 44.5 SPN 0.816993464 0.501609442 1.705 3.14E−15 1.63E−14 −7.667 38 52 45 CORO1A 0.973856209 0.251609442 10.66 8.36E−14 3.17E−13 −8.653 52 41 46.5 P4HB 0.901960784 0.400751073 4.749 5.68E−16 3.39E−15 −6.485 33 62 47.5 PDLIM2 0.588235294 0.708690987 2.918 2.72E−13 9.39E−13 −8.398 57 42 49.5 RPS6KB1 0.60130719 0.693669528 1.428 5.40E−13 1.73E−12 −8.895 62 39 50.5 PDIA4 0.607843137 0.699034335 4.39 5.85E−14 2.26E−13 −7.88 51 50 50.5 GOLPH3 0.418300654 0.8277897 0.401 1.01E−11 2.56E−11 −11.004 78 26 52 PSEN1 0.614379085 0.682939914 1.566 4.43E−13 1.48E−12 −8.171 59 45 52 ERP44 0.823529412 0.49248927 0.475 3.99E−15 1.92E−14 −6.424 39 65 52 PDCD1 0.928104575 0.379291845 0.669 2.08E−17 1.71E−16 −4.73 24 82 53 CAP1 0.823529412 0.474248927 0.401 9.75E−14 3.56E−13 −7.64 54 53 53.5 CD244 0.392156863 0.844420601 0.444 1.68E−11 4.05E−11 −10.792 81 28 54.5 CALR 0.91503268 0.375536481 3.187 1.65E−15 9.04E−15 −5.326 35 75 55 LAG3 0.882352941 0.478540773 2.746 3.39E−20 4.45E−19 −4.285 15 95 55 SERPINE2 0.405228758 0.835300429 1.131 1.60E−11 3.95E−11 −10.282 80 31 55.5 NR4A2 0.738562092 0.55472103 3.667 1.37E−12 4.02E−12 −8.09 67 47 57 PSTPIP1 0.85620915 0.449570815 1.696 6.09E−15 2.82E−14 −5.554 42 72 57 CCR5 0.607843137 0.68776824 2.575 5.45E−13 1.73E−12 −7.453 60 55 57.5 CR1L 0.673202614 0.621781116 2.748 1.28E−12 3.83E−12 −6.612 66 57 61.5 ITGAV 0.620915033 0.654506438 0.678 2.61E−11 6.12E−11 −8.788 84 40 62 TMX3 0.509803922 0.741416309 0.227 2.03E−10 4.39E−10 −9.051 91 37 64 LAMP2 0.549019608 0.716738197 0.585 4.06E−11 9.27E−11 −8.157 87 46 66.5 CD9 0.509803922 0.752145923 1.48 2.65E−11 6.15E−11 −8.001 85 48 66.5 ATP5B 0.934640523 0.2972103 9.253 5.31E−12 1.39E−11 −6.592 75 58 66.5 PTPRCAP 0.954248366 0.295064378 8.586 2.96E−14 1.17E−13 −4.66 50 86 68 CCL3 0.516339869 0.743562232 3.02 4.88E−11 1.09E−10 −7.774 88 51 69.5 IL10RA 0.751633987 0.538626609 1.305 1.92E−12 5.30E−12 −6.242 72 67 69.5 SEPT2 0.934640523 0.337446352 1.257 6.15E−15 2.82E−14 −4.275 43 96 69.5 CTSB 0.941176471 0.358369099 4.926 1.95E−17 1.67E−16 −2.912 23 117 70 ANXA5 0.725490196 0.568133047 2.568 1.46E−12 4.23E−12 −5.509 68 74 71 RAC1 0.849673203 0.434012876 3.898 3.64E−13 1.24E−12 −4.661 58 85 71.5 GPR56 0.470588235 0.772532189 0.433 2.52E−10 5.23E−10 −7.91 95 49 72 HSP90AA1 0.888888889 0.377682403 2.609 7.27E−13 2.24E−12 −4.743 64 80 72 TRPV2 0.732026144 0.553648069 0.585 5.19E−12 1.38E−11 −5.671 74 71 72.5 FLOT2 0.45751634 0.77306867 0.475 1.66E−09 3.15E−09 −8.368 104 44 74 NCKAP1L 0.810457516 0.472639485 0.506 1.72E−12 4.92E−12 −4.73 69 83 76 CTLA4 0.888888889 0.39055794 2.101 8.59E−14 3.19E−13 −3.965 53 102 77.5 TLN1 0.960784314 0.290236052 1.202 8.55E−15 3.83E−14 −3.502 44 111 77.5 TNFRSF4 0.562091503 0.695815451 4.457 2.16E−10 4.59E−10 −6.475 93 63 78 PDE4D 0.588235294 0.667381974 0.239 4.81E−10 9.67E−10 −6.555 98 60 79 CD44 0.758169935 0.53111588 2.687 2.05E−12 5.53E−12 −4.415 73 92 82.5 CLPTM1 0.444444444 0.775751073 0.848 6.92E−09 1.24E−08 −6.519 110 61 85.5 PEBP1 0.85620915 0.418991416 0.956 1.08E−12 3.28E−12 −3.796 65 106 85.5 GABARAPL1 0.490196078 0.738197425 1.74 6.44E−09 1.16E−08 −6.467 109 64 86.5 TIGIT 0.934640523 0.344420601 5.588 1.79E−15 9.55E−15 −2.042 37 137 87 AIMP1 0.660130719 0.614270386 2.362 4.09E−11 9.27E−11 −4.412 86 93 89.5 CXCR6 0.888888889 0.396995708 4.511 2.88E−14 1.16E−13 −2.242 49 131 90 HSPD1 0.836601307 0.447424893 1.74 5.97E−13 1.87E−12 −2.737 63 121 92 CCL4 0.594771242 0.647532189 4.132 4.16E−09 7.73E−09 −4.809 106 79 92.5 ADAM17 0.516339869 0.707081545 0.251 2.48E−08 4.15E−08 −5.713 118 69 93.5 SLAMF1 0.405228758 0.792918455 0.444 8.43E−08 1.36E−07 −6.327 122 66 94 NOTCH1 0.732026144 0.527896996 0.07 2.92E−10 5.94E−10 −4.574 97 91 94 THY1 0.947712418 0.282188841 4.979 1.80E−12 5.07E−12 −2.795 70 120 95 LY6E 0.980392157 0.206545064 7.954 1.68E−11 4.05E−11 −3.592 82 109 95.5 AAMP 0.803921569 0.463519313 0.824 2.47E−11 5.87E−11 −3.319 83 112 97.5 CTSD 0.993464052 0.19527897 7.378 5.39E−13 1.73E−12 −2.064 61 136 98.5 FLT3L 0.437908497 0.769313305 3.761 5.17E−08 8.42E−08 −4.876 121 78 99.5 PTPN11 0.379084967 0.800965665 0.151 7.02E−07 1.05E−06 −5.679 132 70 101 PTGER2 0.37254902 0.809549356 0.782 4.05E−07 6.18E−07 −5.531 129 73 101 LY75 0.424836601 0.769849785 0.475 2.66E−07 4.13E−07 −4.981 127 77 102 F2R 0.575163399 0.658261803 0.444 1.29E−08 2.20E−08 −4.588 115 89 102 RALA 0.37254902 0.809012876 3.905 4.43E−07 6.71E−07 −5.317 130 76 103 M6PR 0.862745098 0.365343348 0.566 1.03E−09 2.00E−09 −3.788 102 107 104.5 NCOR2 0.555555556 0.660944206 0.124 1.17E−07 1.87E−07 −4.587 123 90 106.5 SBDS 0.588235294 0.625 0.722 2.35E−07 3.67E−07 −4.634 126 88 107 SEMA4D 0.875816993 0.358905579 3.009 2.15E−10 4.59E−10 −2.452 92 125 108.5 GPI1 0.960784314 0.229077253 6.568 2.24E−10 4.68E−10 −2.529 94 124 109 ITGB2 0.960784314 0.248390558 6.447 1.03E−11 2.56E−11 −1.824 79 141 110 LY6A 0.633986928 0.59388412 6.556 4.02E−08 6.59E−08 −3.987 120 101 110.5 IL12RB1 0.339869281 0.825643777 1.623 1.95E−06 2.70E−06 −4.738 142 81 111.5 H13 0.928104575 0.313841202 3.084 1.94E−12 5.30E−12 −1.119 71 155 113 CD55 0.300653595 0.854613734 4.114 2.32E−06 3.19E−06 −4.711 143 84 113.5 IL2RB 0.960784314 0.222103004 7.189 6.60E−10 1.31E−09 −2.376 99 128 113.5 CD8A 0.993464052 0.136802575 6.459 1.00E−08 1.76E−08 −2.857 112 119 115.5 SCARB2 0.346405229 0.814377682 0.506 5.06E−06 6.83E−06 −4.636 146 87 116.5 ICAM1 0.529411765 0.67167382 4.07 7.01E−07 1.05E−06 −3.925 131 103 117 FERMT3 0.91503268 0.323497854 4.461 1.02E−11 2.56E−11 −1.02 77 158 117.5 HSPA5 0.960784314 0.220493562 6.325 8.45E−10 1.65E−09 −2.081 101 135 118 CMTM6 0.620915033 0.607296137 1.967 3.70E−08 6.13E−08 −2.895 119 118 118.5 ITGB1 0.790849673 0.4527897 0.31 1.15E−09 2.20E−09 −2.107 103 134 118.5 LSM1 0.477124183 0.716201717 0.748 9.74E−07 1.44E−06 −3.859 133 105 119 GPR174 0.39869281 0.778433476 0.782 1.91E−06 2.68E−06 −4.163 141 98 119.5 IDE 0.699346405 0.516630901 0.251 1.58E−07 2.50E−07 −2.991 125 115 120 TMEM123 0.849673203 0.369098712 0.367 6.36E−09 1.16E−08 −2.232 108 133 120.5 TSPAN32 0.339869281 0.81276824 0.824 1.39E−05 1.82E−05 −4.315 150 94 122 CD38 0.392156863 0.783798283 3.77 1.92E−06 2.68E−06 −3.868 140 104 122 ROCK1 0.60130719 0.598712446 0.176 1.29E−06 1.85E−06 −3.617 138 108 123 STX4A 0.359477124 0.799356223 0.816 9.71E−06 1.29E−05 −4.147 148 99 123.5 ATP6AP2 0.535947712 0.662553648 1.438 1.05E−06 1.53E−06 −3.163 134 113 123.5 GRN 0.326797386 0.817596567 0.422 3.11E−05 4.05E−05 −4.271 151 97 124 CD97 0.784313725 0.442596567 4.364 1.31E−08 2.23E−08 −2.237 116 132 124 CD47 0.980392157 0.194742489 5.119 1.17E−10 2.57E−10 −0.957 90 160 125 ITGA4 0.843137255 0.376609442 1.799 7.03E−09 1.25E−08 −1.947 111 140 125.5 TNFRSF18 0.803921569 0.431866953 3.39 2.52E−09 4.74E−09 −1.505 105 146 125.5 CD5 0.68627451 0.53111588 3.165 1.43E−07 2.28E−07 −2.265 124 130 127 CD2 0.941176471 0.240879828 6.025 5.78E−09 1.06E−08 −1.363 107 149 128 XPOT 0.352941176 0.791845494 0.111 5.47E−05 6.86E−05 −4.105 157 100 128.5 IL21R 0.77124183 0.4222103 0.367 1.04E−06 1.53E−06 −2.625 135 122 128.5 CD52 1 0.145922747 8.417 9.16E−11 2.03E−10 −0.696 89 168 128.5 CD82 0.947712418 0.274678112 4.369 6.13E−12 1.59E−11 −0.062 76 186 131 LY9 0.437908497 0.730686695 0.566 1.29E−05 1.71E−05 −3.114 149 114 131.5 FASL 0.653594771 0.5472103 0.526 1.20E−06 1.74E−06 −2.448 136 127 131.5 CD247 0.895424837 0.30472103 4.586 1.05E−08 1.83E−08 −1.127 113 154 133.5 ITGAL 0.954248366 0.233369099 1.753 6.89E−10 1.36E−09 −0.606 100 169 134.5 NAMPT 0.37254902 0.772532189 0.189 7.67E−05 9.39E−05 −3.543 161 110 135.5 CD164 0.888888889 0.311695279 5.856 1.39E−08 2.34E−08 −1.118 117 156 136.5 ADAM10 0.660130719 0.52360515 1.316 8.02E−06 1.07E−05 −2.289 147 129 138 HSPA9 0.633986928 0.566523605 2.316 1.28E−06 1.83E−06 −1.713 137 142 139.5 PEAR1 0.37254902 0.760729614 0.287 0.000292242 0.000340661 −2.925 169 116 142.5 CD27 0.849673203 0.336909871 2.606 4.00E−07 6.16E−07 −1.021 128 157 142.5 HSP90AB1 0.928104575 0.212446352 9.441 3.90E−06 5.34E−06 −1.534 144 145 144.5 CCL5 0.960784314 0.227467811 4.626 2.87E−10 5.90E−10 0 96 193 144.5 IGF2R 0.529411765 0.621244635 0.111 0.000197024 0.000233818 −2.452 166 126 146 MYO9B 0.483660131 0.658261803 0.163 0.000355806 0.000409905 −2.536 171 123 147 CD3G 0.993464052 0.135729614 8.608 1.19E−08 2.05E−08 −0.323 114 180 147 NRP1 0.509803922 0.635729614 0.163 0.000292112 0.000340661 −2.005 168 138 153 TNFSF10 0.31372549 0.813304721 3.029 0.000217591 0.000256679 −2.003 167 139 153 KLRK1 0.594771242 0.571888412 3.883 4.96E−05 6.30E−05 −1.273 155 151 153 IL18RAP 0.529411765 0.594420601 0.411 0.001968858 0.002179017 −1.686 178 143 160.5 NR3C1 0.405228758 0.709763948 0.138 0.002309675 0.002527811 −1.615 180 144 162 CD28 0.738562092 0.423819742 1.433 4.27E−05 5.50E−05 −0.399 153 173 163 TNIP1 0.535947712 0.586373391 0.433 0.002239312 0.002464494 −1.394 179 148 163.5 KLRC2 0.568627451 0.559012876 1.202 0.00154658 0.001731116 −1.189 176 152 164 B4GALT1 0.908496732 0.238733906 1.7 4.75E−06 6.45E−06 −0.137 145 183 164 LRPAP1 0.379084967 0.722639485 0.333 0.005659077 0.006125484 −1.42 182 147 164.5 CD3E 0.836601307 0.301502146 6.523 0.000112033 0.000134576 −0.726 164 167 165.5 IL2RG 1 0.086373391 5.406 1.75E−06 2.48E−06 0 139 194 166.5 CD84 0.614379085 0.519849785 0.275 0.000912275 0.001026961 −0.958 175 159 167 IL16 0.581699346 0.559549356 0.287 0.000513618 0.000588272 −0.919 172 162 167 LILRB4 0.477124183 0.620171674 0.632 0.011588922 0.012340636 −1.288 185 150 167.5 C1QBP 0.581699346 0.564377682 0.956 0.000337964 0.00039164 −0.727 170 166 168 KLRC1 0.62745098 0.498390558 1.339 0.001729156 0.001924541 −0.951 177 161 169 IRAK2 0.503267974 0.591738197 0.239 0.014063724 0.014780977 −1.132 187 153 170 LTB 0.882352941 0.245708155 4.932 0.000102855 0.00012431 −0.384 163 177 170 SELPLG 0.986928105 0.094957082 6.566 5.45E−05 6.86E−05 −0.104 156 185 170.5 CD3D 1 0.065450644 2.26 4.83E−05 6.18E−05 −0.027 154 189 171.5 CD37 0.85620915 0.287553648 2.43 4.12E−05 5.34E−05 −0.003 152 192 172 B2M 1 0.064377682 11.746 5.72E−05 7.13E−05 −0.041 158 187 172.5 SLC3A2 0.816993464 0.324570815 3.578 0.000114552 0.000136768 −0.311 165 181 173 IL27RA 0.575163399 0.532725322 0.444 0.006484301 0.006942431 −0.753 184 165 174.5 CNP 0.660130719 0.475858369 0.496 0.000720175 0.000815371 −0.398 174 175 174.5 CD226 0.549019608 0.547746781 0.705 0.013177153 0.013956447 −0.83 186 164 175 IFNGR1 0.928104575 0.186158798 7.705 8.56E−05 0.000104151 −0.034 162 188 175 MSN 0.973856209 0.11695279 4.455 7.35E−05 9.05E−05 −0.011 160 190 175 CD8B1 1 0.063304721 7.859 6.76E−05 8.38E−05 −0.008 159 191 175 LYST 0.509803922 0.585300429 0.111 0.014105704 0.014780977 −0.896 188 163 175.5 TGFBR2 0.712418301 0.391630901 0.299 0.006312132 0.006795028 −0.399 183 174 178.5 CD6 0.732026144 0.401287554 5.207 0.000623793 0.000710331 −0.122 173 184 178.5 PDE4B 0.54248366 0.551502146 0.31 0.015560524 0.016219171 −0.578 189 170 179.5 ICOS 0.673202614 0.444206009 0.39 0.002885539 0.003140614 −0.363 181 178 179.5 STK10 0.705882353 0.376609442 0.239 0.024678219 0.025587417 −0.432 190 172 181 NOTCH2 0.588235294 0.475321888 0.138 0.076060047 0.078040778 −0.509 192 171 181.5 CD160 0.359477124 0.696351931 0.895 0.090137346 0.092005477 −0.39 193 176 184.5 IL18R1 0.522875817 0.549356223 0.151 0.050731163 0.052324812 −0.356 191 179 185 BST2 0.39869281 0.649141631 1.345 0.135699441 0.137797886 −0.214 194 182 188 ITGB7 0.339869281 0.616416309 0.401 0.876904402 0.885898293 0 195 195 195 CCND2 0.562091503 0.386266094 0.111 0.910102194 0.914745572 0 196 196 196 IL4RA 0.366013072 0.559012876 0.287 0.970844302 0.970844302 0 197 197 197
TABLE-US-00015 TABLE 13 Ranked top 100 differentially expressed genes in cluster 9 as compared to all 15 CD8 T cell clusters adj. adj. adj. adj. adj. adj. adj. adj. adj. adj. adj. adj. adj. adj. adj. pval. pval. pval. pval. pval. pval. pval. pval. pval. pval. pval. pval. pval. pval. pval. clus- clus- clus- clus- clus- clus- clus- clus- clus- clus- clus- clus- clus- clus- clus- ter ter ter ter ter ter ter ter ter ter ter ter ter ter ter 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 CDC20 0 0 0 0 0 0 0 0 −184.362 −2.344 −0.001 0 0 0 −19.657 PLK1 0 0 0 0 0 0 0 0 −175.867 −4.542 −0.001 0 0 0 −13.485 CDCA3 0 0 0 0 0 0 −0.024 0 −167.524 −10.223 −0.001 0 0 0 −15.116 CCNB2 0 0 0 0 0 0 −1.05 0 −165.839 −8.768 −0.001 0 0 0 −15.116 FAM64A 0 0 0 0 0 0 0 0 −165.547 −3.612 −0.001 0 0 0 −11.262 NEK2 0 0 0 0 0 0 0 0 −163.602 −5.146 −0.001 0 0 0 −7.58 CCNA2 0 0 0 0 0 0 0 0 −158.623 −27.377 −0.001 0 0 0 −13.106 KIF20A 0 0 0 0 0 0 0 0 −155.825 −8.605 0 0 0 0 −13.485 CEP55 0 0 0 0 0 0 0 0 −153.213 −4.218 −0.001 0 0 0 −13.685 CDCA8 0 0 0 0 0 0 0 0 −150.419 −20.638 −0.001 0 0 −1.963 −11.541 CDKN3 0 0 0 0 0 0 −0.139 0 −148.364 −1.429 −0.001 0 0 0 −10.472 KIF2C 0 0 0 0 0 0 0 0 −144.555 −3.85 −0.001 0 0 0 −16.857 CKAP2L 0 0 0 0 0 0 0 0 −142.355 −13.708 −0.001 0 0 0 −7.314 KIF22 0 0 0 0 0 0 0 0 −140.192 −16.462 −0.001 0 0 0 −6.208 CENPE 0 0 0 0 0 0 0 0 −136.216 −3.348 −0.001 0 0 0 −8.748 BUB1 0 0 0 0 0 0 0 0 −134.146 −20.446 −0.001 0 0 0 −11.29 BUB1B 0 0 0 0 0 0 −0.206 0 −134.119 −8.876 −0.001 −0.045 0 0 −10.758 CCNB1 0 0 0 0 0 0 −0.191 0 −133.892 −4.436 −0.001 0 0 0 −16.09 MKI67 0 0 0 0 0 0 0 0 −133.503 −25.436 0 0 −0.086 0 −9.865 NUSAP1 0 0 0 0 0 0 0 0 −129.805 −32.937 −0.001 0 0 0 −7.459 KIF4 0 0 0 0 0 0 0 0 −129.036 −8.502 −0.001 0 0 0 −11.574 TACC3 0 0 0 0 0 0 −0.179 0 −127.27 −16.479 0 0 0 0 −10.348 TROAP 0 0 0 0 0 0 0 0 −126.503 −1.124 −0.001 0 0 0 −8.15 ASPM 0 0 0 0 0 0 0 0 −125.186 −4.045 −0.001 0 0 0 −3.083 CKS1B 0 0 0 0 0 0 −2.318 0 −123.685 −23.331 −0.001 0 0 −0.721 −11.29 SAPCD2 0 0 0 0 0 0 0 0 −123.685 −3.581 −0.001 0 0 0 −7.515 KIF23 0 0 0 0 0 0 0 0 −123.218 −5.376 −0.001 0 0 0 −10.472 CKAP2 0 0 0 0 0 0 −0.29 0 −121.254 −3.232 −0.001 0 0 0 −10.687 PIF1 0 0 0 0 0 0 0 0 −120.466 −0.217 −0.001 0 0 0 −0.702 GTSE1 0 0 0 0 0 0 0 0 −115.338 −13.376 −0.001 0 0 0 −4.787 PARPBP 0 0 0 0 0 0 0 0 −115.188 −3.439 −0.001 0 0 0 −9.09 AURKB 0 0 0 0 0 0 0 0 −115.142 −33.175 −0.001 0 0 0 −7.378 DEPDC1A 0 0 0 0 0 0 0 0 −115.01 −15.849 −0.001 0 0 0 −6.805 CDC25C 0 0 0 0 0 0 0 0 −114.908 −1.332 −0.001 0 0 0 −15.116 KNSTRN 0 0 0 0 0 0 −0.391 0 −114.296 −4.993 −0.001 0 0 0 −11.96 SKA1 0 0 0 0 0 0 0 0 −112.855 −11.739 −0.001 0 0 0 −4.976 AURKA 0 0 0 0 0 0 0 0 −111.39 −1.655 −0.001 0 0 0 −11.464 ECT2 0 0 0 0 0 0 0 0 −106.144 −7.388 −0.001 0 0 0 −8.951 SHCBP1 0 0 0 0 0 0 0 0 −104.967 −11.892 −0.001 0 0 0 −5.066 SPAG5 0 0 0 0 0 0 0 0 −104.142 −8.895 −0.001 0 0 0 −10.147 MELK 0 0 0 0 0 0 0 0 −103.052 −15.26 −0.001 0 0 0 −6.238 ARHGAP19 0 0 0 0 0 0 0 0 −103.014 −1.382 −0.001 0 0 0 −7.167 UBE2C 0 0 0 0 0 0 −0.472 0 −102.684 −2.539 −0.001 0 0 0 −7.412 SPC25 0 0 0 0 0 0 0 0 −100.821 −24.336 −0.001 0 0 0 −5.838 TPX2 0 0 0 0 0 0 0 0 −100.808 −10.384 −0.001 0 0 0 −10.249 NCAPG 0 0 0 0 0 0 0 0 −99.319 −40.113 −0.001 0 0 0 −5.526 SGOL1 0 0 0 0 0 0 0 0 −98.56 −15.25 −0.001 0 0 0 −5.511 STMN1 0 0 0 0 0 0 −0.635 0 −98.221 −68.25 −0.001 0 0 0 −8.858 FOXM1 0 0 0 0 0 0 0 0 −96.119 −4.817 −0.001 0 0 0 −2.686 BIRC5 0 0 0 0 0 0 −0.026 0 −94.968 −14.204 −0.001 0 0 0 −7.921 MAD2L1 0 0 0 0 0 0 −0.454 0 −94.515 −33.55 −0.001 0 0 0 −7.613 2810417H13RIK 0 0 0 0 0 0 −0.877 0 −94.353 −61.938 −0.001 0 0 0 −7.68 NEIL3 0 0 0 0 0 0 0 0 −91.051 −21.987 −0.001 0 0 0 −6.154 NCAPD2 0 0 0 0 0 0 −0.408 0 −90.985 −35.029 0 0 0 0 −10.266 CDK1 0 0 0 0 0 0 0 0 −89.58 −36.898 −0.001 0 0 0 −5.968 CENPA 0 0 0 0 0 0 −17.723 −1.237 −88.504 −1.854 −0.001 0 0 0 −8.377 NDC80 0 0 0 0 0 0 0 0 −87.237 −16.831 −0.001 0 0 0 −3.648 ESPL1 0 0 0 0 0 0 0 0 −87.003 −8.242 −0.001 0 0 0 −7.975 MIS18BP1 0 0 0 0 0 0 0 0 −86.091 −8.204 −0.001 0 0 0 −3.528 MXD3 0 0 0 0 0 0 0 0 −84.852 −4.135 −0.001 0 0 0 −4.433 C330027C09RIK 0 0 0 0 0 0 0 0 −84.459 −10.643 −0.001 0 0 0 −9.216 HMGB2 0 0 0 0 0 0 0 0 −83.608 −27.111 −0.001 0 0 0 −7.061 CDCA2 0 0 0 0 0 0 −0.02 0 −82.191 −36.305 −0.001 0 0 0 −5.418 ARHGAP11A 0 0 0 0 0 0 0 0 −79.407 −14.392 −0.001 0 0 −0.499 −7.496 1190002F15RIK 0 0 0 0 0 0 −0.771 −0.022 −79.269 −7.813 −0.001 0 0 0 −12.234 HIST1H2AO 0 0 0 0 0 0 −0.199 0 −77.944 −37.764 −0.001 0 −0.147 0 −5.609 SKA2 0 0 0 0 0 0 −0.013 0 −76.368 −12.484 −0.001 0 0 0 −4.225 RACGAP1 0 0 0 0 0 0 0 0 −76.052 −8.624 0 0 0 0 −7.106 CDCA5 0 0 0 0 0 0 0 0 −75.623 −38.383 −0.001 0 0 0 −3.513 ASF1B 0 0 0 0 0 0 −0.123 0 −73.726 −56.208 −0.001 0 0 −4.035 −3.737 NCAPH 0 0 0 0 0 0 −0.439 0 −72.574 −38.076 −0.001 −0.609 0 0 −2.757 CKS2 0 0 0 0 0 0 −0.558 −0.086 −72.359 −6.677 −0.001 0 0 −0.039 −5.626 NUF2 0 0 0 0 0 0 0 0 −72.288 −9.096 0 0 0 0 −4.518 CASC5 0 0 0 0 0 0 0 0 −70.176 −16.007 −0.001 0 0 0 −1.245 TOP2A 0 0 0 0 0 0 −1.539 −0.04 −69.996 −49.278 −0.001 0 0 0 −3.78 REEP4 0 0 0 0 0 0 0 0 −69.638 −3.201 −0.001 0 0 0 −7.177 TUBB4B 0 0 0 0 0 0 −1.175 0 −69.61 −5.712 −0.001 0 0 0 −3.285 KIF11 0 0 0 0 0 0 0 0 −69.213 −16.195 −0.001 0 0 0 −4.304 HIST2H3C2 0 0 0 0 0 0 0 0 −68.991 −31.983 −0.001 0 0 0 −6.158 FAM83D 0 0 0 0 0 0 −0.064 0 −68.714 −13.104 −0.001 0 0 0 −1.971 HMGN2 0 0 0 0 0 0 −0.795 0 −68.584 −21.667 −0.001 0 0 0 −5.602 SMC2 0 0 0 0 0 0 −0.203 0 −68.225 −39.346 −0.001 0 0 0 −3.648 CENPW 0 0 0 0 0 0 −3.078 −0.012 −67.606 −17.172 0.001 0 0 0 −5.443 ZWILCH 0 0 0 0 0 0 0 0 −67.361 −9.87 0.001 0 0 0 −7.311 HMGB3 0 0 0 0 0 0 −8.432 −1.502 −67.08 −12.654 −0.001 0 0 0 −9.633 CIT 0 0 0 0 0 0 0 0 −66.701 −12.005 −0.001 0 0 0 −3.906 RRM2 0 0 0 0 0 0 −0.044 0 −66.459 −72.59 −0.001 0 0 0 −3.577 H2AFZ 0 0 0 0 0 0 −0.317 −0.763 −65.313 −19.273 −0.001 0 0 0 −7.39 CEP89 0 0 0 0 0 0 −0.285 0 −63.892 −0.003 −0.001 0 0 0 −8.453 TUBA1C 0 0 0 0 0 0 −1.248 0 −63.107 −1.775 −0.001 −1.171 0 −0.241 −1.841 PLK4 0 0 0 0 0 0 −0.876 0 −62.504 −16.711 −0.001 0 0 0 −2.986 POC1A 0 0 0 0 0 0 −0.437 0 −62.189 −7.108 −0.001 0 0 0 −9.259 TUBA1B 0 0 0 0 0 0 −0.341 0 −62.089 −32 −0.001 −0.81 0 0 −4.026 GPSM2 0 0 0 0 0 0 −0.012 0 −61.281 −1.655 −0.001 0 0 0 −2.287 CENPN 0 0 0 0 0 0 0 −0.069 −61.278 −12.165 −0.001 0 0 0 −6.532 TTK 0 0 0 0 0 0 0 0 −61.232 −11.957 −0.001 0 0 0 −12.143 GEN1 0 0 0 0 0 0 0 0 −61.077 −12.717 −0.001 0 0 0 −3.094 HIST2H3B 0 0 0 0 0 0 0 0 −60.755 −33.065 −0.001 0 0 0 −5.492 PBK 0 0 0 0 0 0 0 0 −60.6 −36.206 −0.001 0 0 0 −4.177
TABLE-US-00016 TABLE 14 Cluster 10 Specific Gene Signature 0 7 8 9 rank_0 rank_7 rank_8 rank_9 mean_rank MCM5 −90.123 −32.703 −34.411 −14.846 3 3 1 6 3.25 MCM7 −83.194 −33.793 −32.988 −18.085 8 1 2 4 3.75 LIG1 −93.006 −28.89 −31.839 −11.559 2 4 3 8 4.25 MCM3 −81.522 −25.562 −30.682 −18.786 12 7 4 2 6.25 MCM2 −68.448 −23.944 −29.597 −22.092 20 10 6 1 9.25 TIPIN −75.17 −25.275 −25.529 −11.425 15 9 9 9 10.5 PRIM1 −85.258 −22.464 −25.424 −6.265 6 12 11 25 13.5 MCM6 −53.377 −21.391 −25.799 −18.381 31 16 7 3 14.25 CDC6 −89.823 −19.414 −20.77 −8.491 4 20 23 15 15.5 POLA1 −80.75 −22.871 −22.23 −6.85 13 11 19 23 16.5 FEN1 −81.94 −27.864 −24.896 −3.926 9 5 12 45 17.75 DHFR −75.759 −17.755 −20.45 −6.927 14 21 26 22 20.75 HELLS −84.063 −14.995 −20.765 −6.689 7 30 24 24 21.25 SLBP −43.549 −21.883 −24.035 −10.174 49 13 14 10 21.5 MCM4 −48.681 −20.669 −22.398 −9.103 37 18 18 13 21.5 RFC3 −81.642 −21.693 −16.201 −6.136 11 14 35 26 21.5 UHRF1 −87.385 −21.415 −25.465 −3.552 5 15 10 56 21.5 DUT −61.556 −16.56 −23.6 −7.124 25 25 16 21 21.75 DTL −81.642 −12.956 −20.973 −8.365 10 40 22 17 22.25 POLD1 −64.464 −20.796 −24.315 −4.562 22 17 13 38 22.5 CCNE1 −62.539 −15.342 −17.384 −8.704 23 29 31 14 24.25 PCNA −45.092 −15.554 −23.972 −8.416 43 28 15 16 25.5 DNMT1 −45.002 −20.339 −25.599 −5.229 44 19 8 32 25.75 CHAF1B −50.588 −14.572 −16.878 −7.345 34 31 32 20 29.25 DNAJC9 −33.663 −27.523 −22.908 −5.381 68 6 17 29 30 TCF19 −70.03 −25.562 −18.913 −3.012 18 8 27 68 30.25 CDK2 −56.916 −15.972 −14.41 −4.101 26 26 41 41 33.5 CHEK1 −61.86 −14.505 −14.205 −4.779 24 33 43 35 33.75 DCK −43.927 −17.41 −15.557 −5.357 48 22 37 30 34.25 GINS2 −69.56 −15.692 −17.414 −3.214 19 27 30 62 34.5 CDCA7 −54.772 −8.493 −14.713 −13.381 28 65 40 7 35 CDCA7L −46.809 −11.956 −13.162 −9.167 41 47 46 12 36.5 RRM2 −96.054 −33.678 −29.597 −1.388 1 2 5 140 37 RANBP1 −34.581 −12.464 −20.765 −5.674 66 44 25 28 40.75 CCNE2 −54.01 −10.64 −11.3 −5.789 30 50 57 27 41 POLE −70.119 −13.094 −16.346 −2.524 17 38 34 78 41.75 UNG −51.405 −9.422 −9.92 −18.085 32 57 74 5 42 RPA2 −36.145 −12.413 −21.529 −3.959 61 45 20 43 42.25 ORC6 −56.235 −13.409 −21.479 −2.338 27 35 21 86 42.25 POLD2 −39.416 −14.115 −16.193 −3.679 54 34 36 54 44.5 TYMS −38.405 −17.245 −18.75 −2.444 57 23 28 83 47.75 SYCE2 −46.6 −8.869 −12.167 −4.542 42 61 53 39 48.75 WDHD1 −49.543 −8.473 −13.05 −3.793 36 66 48 48 49.5 RFC2 −42.522 −9.381 −13.835 −3.74 51 58 44 49 50.5 CHAF1A −67.019 −12.956 −16.531 −1.761 21 41 33 115 52.5 SIVA1 −54.441 −5.14 −11.562 −4.243 29 94 56 40 54.75 CTPS −38.876 −5.774 −10.471 −8.365 55 86 69 18 57 MCM10 −71.959 −16.96 −13.732 −1.352 16 24 45 145 57.5 PAICS −32.263 −9.302 −8.927 −7.918 70 60 82 19 57.75 RPA1 −25.501 −11.755 −14.822 −3.448 90 48 39 57 58.5 CAD −31.972 −6.842 −11.038 −4.859 71 76 59 33 59.75 POLD3 −34.711 −9.428 −11.3 −3.288 65 56 58 61 60 E2F1 −34.143 −7.228 −8.388 −9.253 67 74 90 11 60.5 PPIL1 −50.14 −10.663 −12.721 −1.932 35 49 51 107 60.5 IPO5 −37.104 −6.707 −9.883 −5.337 60 77 75 31 60.75 WDR76 −44.185 −9.37 −14.309 −2.067 47 59 42 96 61 MYBL2 −47.404 −12.618 −9.979 −2.08 39 43 73 94 62.25 SHMT1 −39.536 −6.17 −10.813 −3.711 53 83 62 52 62.5 ATAD5 −47.253 −11.973 −8.325 −2.493 40 46 92 79 64.25 PASK −47.422 −13.083 −8.796 −2.067 38 39 85 97 64.75 CDK4 −25.426 −13.124 −8.704 −3.926 91 37 87 46 65.25 CDT1 −18.754 −14.535 −18.171 −2.247 111 32 29 90 65.5 TFDP1 −44.751 −5.669 −12.984 −2.448 45 87 49 82 65.75 HAT1 −37.445 −10.189 −11.737 −2.027 59 53 55 101 67 TIMELESS −42.896 −10.424 −13.162 −1.621 50 52 47 119 67 ZFP367 −51.286 −13.232 −9.689 −1.574 33 36 77 125 67.75 4930422G04RIK −44.633 −9.677 −7.637 −2.929 46 54 102 70 68 ATAD2 −22.651 −8.638 −10.471 −3.73 99 63 68 50 70 SMC6 −22.559 −8.762 −8.82 −4.644 100 62 83 37 70.5 HNRNPD −28.669 −7.888 −10.506 −3.17 83 72 66 65 71.5 PARP1 −31.808 −5.203 −10.51 −3.37 72 92 65 58 71.75 SLC29A1 −38.605 −8.588 −8.092 −2.717 56 64 94 75 72.25 POLA2 −28.277 −7.476 −10.921 −2.799 85 73 60 72 72.5 NASP −31.654 −12.642 −15.514 −1.379 74 42 38 142 74 MTHFD1 −30.483 −3.588 −10.343 −4.087 77 111 71 42 75.25 PAQR4 −31.745 −5.803 −8.82 −3.008 73 85 84 69 77.75 NAP1L1 −28.365 −4.112 −10.613 −3.21 84 102 64 63 78.25 NUP85 −32.877 −10.626 −12.489 −1.362 69 51 52 143 78.75 MSH2 −23.769 −5.83 −8.069 −3.956 97 84 95 44 80 DSCC1 −41.202 −8.301 −10.354 −1.52 52 70 70 131 80.75 MTBP −35.475 −8.339 −7.861 −1.964 63 69 98 103 83.25 NT5C3L −26.158 −6.851 −9.16 −2.136 88 75 80 93 84 SLC43A3 −35.982 −8.363 −9.27 −1.438 62 67 78 136 85.75 USP37 −25.276 −3.546 −7.032 −4.779 93 112 104 36 86.25 RBBP7 −26.131 −8.341 −9.817 −1.556 89 68 76 129 90.5 MCMBP −14.129 −6.679 −4.822 −4.791 127 78 125 34 91 EXOSC7 −24.542 −5.076 −5.504 −3.634 95 96 118 55 91 DTYMK −29.657 −6.609 −8.723 −1.618 80 79 86 120 91.25 CISD1 −37.888 −1.972 −10.823 −1.766 58 133 61 114 91.5 TKT −22.08 −3.706 −8.115 −3.032 102 108 93 66 92.25 DNA2 −35.236 −5.076 −6.534 −1.796 64 95 106 112 94.25 UMPS −30.1 −6.37 −7.688 −1.736 78 81 101 118 94.5 PRDX1 −22.428 −3.916 −12.859 −1.594 101 104 50 123 94.5 PFAS −21.576 −4.045 −4.517 −3.895 103 103 126 47 94.75 NOP56 −9.608 −4.819 −12.159 −2.324 139 98 54 88 94.75 VDAC3 −27.822 −2.584 −10.118 −1.829 86 122 72 111 97.75 HSPA8 −7.171 −5.407 −8.702 −2.76 143 89 88 73 98.25 D430020J02RIK −31.014 −3.695 −3.997 −2.472 76 110 129 81 99 FXN −14.452 −8.072 −8.054 −1.961 126 71 96 105 99.5 MB21D1 −21.521 −5.158 −6.34 −2.08 104 93 108 95 100 PPAT −30.083 −3.353 −5.093 −2.336 79 114 121 87 100.25 TRMT2A −19.903 −3.235 −7.745 −2.472 107 115 100 80 100.5 DDB2 −10.851 −9.528 −9.113 −1.53 136 55 81 130 100.5 SRSF7 −10.641 −5.473 −10.799 −1.761 137 88 63 116 101 MEAF6 −29.64 −6.356 −6.161 −1.509 81 82 112 133 102 TIMM23 −16.88 −2.544 −5.536 −3.7 117 124 117 53 102.75 IDE −18.63 −1.829 −6.401 −3.303 112 134 107 60 103.25 MAD2L2 −29.167 −1.521 −5.301 −2.8 82 144 119 71 104 TMEM109 −26.971 −4.731 −5.989 −1.757 87 99 114 117 104.25 LRDD −23.864 −3.707 −9.249 −1.452 96 107 79 135 104.25 SHMT2 −19.307 −1.636 −7.904 −2.74 108 140 97 74 104.75 NCL −8.413 −3.369 −6.743 −3.185 142 113 105 64 106 INTS7 −18.073 −1.45 −8.365 −2.565 113 145 91 76 106.25 NHP2L1 −15.754 −3.812 −7.845 −1.964 121 105 99 104 107.25 NAA38 −17.88 −6.51 −7.218 −1.504 114 80 103 134 107.75 FH1 −31.651 −3.228 −3.723 −1.915 75 116 133 108 108 SLC25A5 −13.401 −2.525 −8.646 −2.148 128 125 89 92 108.5 SNX5 −16.108 −2.054 −4.93 −3.338 120 132 124 59 108.75 MRPL49 −23.216 −4.622 −5.75 −1.618 98 100 116 121 108.75 NAA50 −24.697 −2.572 −5.853 −1.957 94 123 115 106 109.5 GM5141 −25.378 −5.054 −4.943 −1.569 92 97 123 126 109.5 POLE4 −16.116 −2.844 −3.438 −3.03 119 118 137 67 110.25 GART −18.883 −2.096 −6.061 −2.286 110 131 113 89 110.75 ADAM19 −8.578 −2.481 −10.484 −1.888 141 126 67 109 110.75 2310022A10RIK −21.145 −2.737 −3.497 −2.386 106 121 135 85 111.75 TONSL −21.5 −5.292 −6.29 −1.359 105 91 109 144 112.25 ZMYND19 −17.551 −2.787 −4.948 −2.039 116 119 122 99 114 SET −12.486 −1.562 −3.662 −3.712 134 143 134 51 115.5 SCARB1 −12.553 −4.609 −3.493 −2.067 132 101 136 98 116.75 9130206I24RIK −17.736 −3.792 −3.303 −1.836 115 106 139 110 117.5 PPRC1 −15.17 −2.156 −5.239 −2.006 123 129 120 102 118.5 MBOAT1 −12.7 −2.32 −2.953 −2.439 130 128 140 84 120.5 PMM1 −11.704 −2.781 −6.276 −1.6 135 120 110 122 121.75 CBX2 −12.558 −5.308 −2.473 −1.594 131 90 142 124 121.75 ARL6IP6 −15.73 −3.703 −1.941 −1.796 122 109 145 113 122.25 NEFH −14.673 −1.777 −3.801 −2.032 125 137 132 100 123.5 PACS1 −3.545 −1.613 −3.383 −2.565 146 141 138 77 125.5 SFMBT1 −16.43 −3.018 −1.942 −1.566 118 117 144 128 126.75 PPID −14.792 −2.116 −4.242 −1.569 124 130 128 127 127.25 DPYSL2 −19.228 −1.602 −3.828 −1.514 109 142 131 132 128.5 DHX9 −12.773 −1.768 −6.219 −1.391 129 138 111 139 129.25 AKAP8 −5.348 −1.438 −2.754 −2.189 145 146 141 91 130.75 TSN −12.538 −1.804 −4.324 −1.381 133 135 127 141 134 FKBP3 −8.617 −2.432 −2.426 −1.392 140 127 143 138 137 SLC38A1 −10.5 −1.788 −1.436 −1.414 138 136 146 137 139.25 ACPL2 −6.848 −1.733 −3.942 −1.313 144 139 130 146 139.75
TABLE-US-00017 TABLE 15 Ranked top transcription factors differentially expressed in cluster 10 Gene TP TN thresh_mhg hyper_pval hyper_qval gen_qval rank_hyper_qval rank_gen_qval mean_rank UHRF1 0.838461538 0.803921569 1.816 2.68E−51 1.02E−48 −63.748 1 1 1 TCF19 0.646153846 0.889772125 5.024 5.89E−43 1.13E−40 −59.212 2 2 2 CCNE1 0.607692308 0.8945416 0.526 4.03E−39 3.08E−37 −56.691 5 3 4 CHAF1A 0.6 0.883942766 0.856 1.19E−35 6.48E−34 −48.964 7 4 5.5 CHAF1B 0.607692308 0.875993641 5.16 7.63E−35 3.64E−33 −45.683 8 5 6.5 DNMT1 0.792307692 0.767355591 5.755 3.98E−38 2.53E−36 −40.123 6 8 7 PMF1 0.807692308 0.762056174 3.684 2.43E−39 2.32E−37 −39.271 4 10 7 PTMA 0.761538462 0.80445151 11.266 2.83E−40 3.61E−38 −34.989 3 12 7.5 BRCA1 0.384615385 0.951775305 0.546 1.01E−27 2.98E−26 −42.986 13 6 9.5 WDHD1 0.561538462 0.878113408 0.214 6.32E−30 2.41E−28 −39.503 10 9 9.5 MYBL2 0.369230769 0.951245363 0.651 9.79E−26 2.34E−24 −41.707 16 7 11.5 HMGB2 0.938461538 0.562798092 7.028 1.84E−32 7.82E−31 −27.111 9 17 13 E2F1 0.376923077 0.955484897 2.642 5.09E−28 1.77E−26 −30.829 11 16 13.5 TIMELESS 0.507692308 0.892951775 0.88 5.58E−27 1.42E−25 −34.828 15 13 14 E2F8 0.369230769 0.948065713 0.275 8.68E−25 1.84E−23 −38.663 18 11 14.5 TFDP1 0.692307692 0.772655008 4.093 4.12E−27 1.13E−25 −31.03 14 15 14.5 WHSC1 0.730769231 0.746687864 1.233 8.22E−28 2.62E−26 −26.17 12 18 15 RAD54B 0.392307692 0.930047695 0.604 1.14E−22 2.18E−21 −31.811 20 14 17 HNRNPD 0.815384615 0.645468998 0.39 2.55E−25 5.72E−24 −23.382 17 19 18 HMGB1 0.661538462 0.763645999 9.144 7.18E−23 1.44E−21 −22.967 19 20 19.5 DEK 0.830769231 0.582935877 6.123 6.64E−21 1.10E−19 −22.005 23 21 22 RBL1 0.530769231 0.835188129 0.31 7.92E−20 1.26E−18 −20.873 24 24 24 E2F3 0.415384615 0.893481717 0.575 6.19E−18 8.16E−17 −21.687 29 22 25.5 NMRAL1 0.407692308 0.895071542 3.065 1.70E−17 2.03E−16 −21.391 32 23 27.5 ERH 0.907692308 0.454689984 7.808 2.04E−18 2.89E−17 −17.295 27 28 27.5 SSRP1 0.876923077 0.51245363 1.251 1.13E−19 1.72E−18 −16.688 25 30 27.5 TOX 0.9 0.498145204 3.281 4.67E−21 8.11E−20 −14.785 22 34 28 RBBP4 0.815384615 0.581875994 3.707 2.75E−19 4.05E−18 −15.892 26 32 29 CBX3 0.915384615 0.425013249 5.158 5.12E−17 5.93E−16 −17.551 33 27 30 BAZ1B 0.684615385 0.698993111 0.888 4.53E−18 6.19E−17 −14.523 28 35 31.5 EZH2 0.546153846 0.797562268 0.678 1.31E−16 1.43E−15 −16.795 35 29 32 ANAPC11 0.792307692 0.587705352 0.433 1.24E−17 1.53E−16 −14.892 31 33 32 E2F2 0.369230769 0.899841017 0.322 6.93E−15 6.78E−14 −18.005 39 26 32.5 RFC1 0.561538462 0.786963434 0.189 1.04E−16 1.17E−15 −16.019 34 31 32.5 PA2G4 0.853846154 0.518812931 3.128 7.96E−18 1.01E−16 −13.825 30 36 33 TRIP13 0.323076923 0.922098569 2.359 2.04E−14 1.73E−13 −18.924 45 25 35 CDCA4 0.623076923 0.72972973 5.025 6.24E−16 6.63E−15 −11.574 36 45 40.5 XRCC6 0.4 0.875993641 5.96 3.90E−14 3.24E−13 −13.106 46 38 42 RBBP8 0.476923077 0.821409645 1.864 8.80E−14 6.59E−13 −13.798 51 37 44 MAZ 0.630769231 0.706942236 0.401 1.69E−14 1.54E−13 −11.557 42 46 44 RUVBL2 0.569230769 0.760466349 6.094 1.15E−14 1.07E−13 −11.503 41 47 44 POLE3 0.446153846 0.843137255 4.173 8.28E−14 6.33E−13 −12.77 50 41 45.5 PHF5A 0.715384615 0.641229465 4.608 1.55E−15 1.60E−14 −9.926 37 54 45.5 SUZ12 0.469230769 0.822469528 0.475 2.53E−13 1.82E−12 −12.873 53 39 46 HMGB3 0.561538462 0.756756757 0.444 9.23E−14 6.78E−13 −12.654 52 42 47 GTF3A 0.676923077 0.6645469 4.167 1.89E−14 1.64E−13 −10.318 44 51 47.5 HDAC1 0.792307692 0.540540541 6.094 5.10E−14 4.15E−13 −10.352 47 50 48.5 TARDBP 0.684615385 0.650768415 3.32 6.15E−14 4.89E−13 −10.033 48 53 50.5 SMYD2 0.407692308 0.857445681 3.791 1.58E−12 9.76E−12 −12.772 62 40 51 LITAF 0.938461538 0.458929518 0.774 1.47E−22 2.68E−21 −7.349 21 81 51 TCERG1 0.592307692 0.725490196 2.272 2.89E−13 2.04E−12 −10.741 54 49 51.5 UBTF 0.692307692 0.650238474 2.485 1.80E−14 1.60E−13 −9.196 43 60 51.5 PPRC1 0.4 0.862215156 0.214 1.72E−12 1.04E−11 −12.568 63 43 53 GTF2F2 0.507692308 0.789613143 5.486 6.71E−13 4.34E−12 −11.27 59 48 53.5 TFDP2 0.307692308 0.91626921 1.876 3.15E−12 1.80E−11 −11.858 67 44 55.5 RBL2 0.753846154 0.568627451 2.406 4.92E−13 3.35E−12 −9.537 56 56 56 AES 0.776923077 0.542660307 0.934 5.69E−13 3.75E−12 −9.525 58 57 57.5 MSL3 0.461538462 0.812930578 2.029 7.53E−12 4.11E−11 −10.245 70 52 61 CBX6 0.453846154 0.819289878 0.748 6.44E−12 3.62E−11 −9.482 68 58 63 TFAM 0.484615385 0.785373609 1.084 5.76E−11 2.86E−10 −9.718 77 55 66 COMMD3 0.738461538 0.595654478 4.241 8.22E−14 6.33E−13 −7.277 49 86 67.5 GTF2H5 0.676923077 0.638049815 2.511 1.94E−12 1.16E−11 −7.617 64 73 68.5 FUBP1 0.707692308 0.589295178 0.345 3.43E−11 1.72E−10 −8.408 76 62 69 NR4A2 0.823076923 0.485426603 1 1.08E−12 6.85E−12 −7.402 60 78 69 SUB1 0.823076923 0.466878643 6.946 1.66E−11 8.66E−11 −7.991 73 66 69.5 EDF1 0.953846154 0.341282459 6.46 1.79E−15 1.80E−14 −6.142 38 103 70.5 TCEA1 0.8 0.519342872 3.287 3.75E−13 2.60E−12 −7.214 55 87 71 MED7 0.476923077 0.783253842 0.516 2.65E−10 1.20E−09 −9.255 84 59 71.5 ILF3 0.815384615 0.479597244 0.465 9.98E−12 5.37E−11 −7.587 71 74 72.5 NONO 0.953846154 0.29517753 4.81 2.32E−12 1.34E−11 −7.38 66 79 72.5 RBX1 0.876923077 0.446740859 1.406 1.11E−14 1.06E−13 −5.969 40 107 73.5 HDAC3 0.623076923 0.659777424 0.475 2.03E−10 9.32E−10 −8.03 83 65 74 OVCA2 0.392307692 0.843137255 3.874 5.03E−10 2.19E−09 −8.536 88 61 74.5 YBX1 0.730769231 0.560148384 1.926 7.41E−11 3.54E−10 −7.541 80 75 77.5 RNPS1 0.746153846 0.560148384 5.837 6.63E−12 3.67E−11 −7.167 69 89 79 VAMP7 0.423076923 0.815050344 3.342 1.56E−09 6.19E−09 −8.053 96 64 80 GATAD1 0.515384615 0.750927398 1.57 3.38E−10 1.50E−09 −7.498 86 77 81.5 HCFC1 0.753846154 0.536830949 0.111 6.10E−11 2.99E−10 −7.181 78 88 83 CBFB 0.438461538 0.800211977 1.485 2.77E−09 1.04E−08 −7.873 101 68 84.5 CENPB 0.353846154 0.865924748 4.012 1.16E−09 4.75E−09 −7.499 93 76 84.5 MED28 0.792307692 0.520932697 3.759 1.14E−12 7.15E−12 −5.891 61 110 85.5 SMARCC2 0.623076923 0.643879173 1.362 2.11E−09 8.08E−09 −7.634 100 72 86 MTF2 0.469230769 0.775304716 0.526 3.15E−09 1.17E−08 −7.685 103 71 87 PARN 0.4 0.834128246 4.282 1.04E−09 4.30E−09 −7.329 92 83 87.5 HMGXB4 0.3 0.892421834 2.029 9.13E−09 3.17E−08 −7.978 110 67 88.5 CASP8AP2 0.361538462 0.84790673 0.345 1.61E−08 5.25E−08 −8.375 117 63 90 NCOR2 0.607692308 0.665076842 0.189 7.81E−10 3.32E−09 −7.15 90 90 90 UBE2K 0.692307692 0.590885003 0.202 2.67E−10 1.20E−09 −6.775 85 95 90 BOLA2 0.576923077 0.696873344 2.444 4.25E−10 1.87E−09 −7.021 87 94 90.5 ZNHIT3 0.323076923 0.875993641 3.996 1.21E−08 4.06E−08 −7.782 114 69 91.5 TRIM28 0.484615385 0.761526232 1.556 3.93E−09 1.44E−08 −7.351 104 80 92 HCFC2 0.4 0.819289878 0.696 1.72E−08 5.56E−08 −7.758 118 70 94 SCAP 0.384615385 0.836248013 3.975 6.14E−09 2.21E−08 −7.349 106 82 94 IKZF3 0.846153846 0.435082141 0.345 2.67E−11 1.36E−10 −5.683 75 115 95 BDP1 0.469230769 0.771065183 0.227 6.38E−09 2.28E−08 −7.286 107 85 96 PNN 0.730769231 0.570747218 0.465 1.55E−11 8.25E−11 −5.518 72 122 97 PHB2 0.838461538 0.471648119 2.039 5.09E−13 3.41E−12 −4.957 57 137 97 CDC5L 0.576923077 0.689984102 4.233 1.23E−09 5.01E−09 −6.283 94 101 97.5 IRF8 0.684615385 0.616322205 0.367 1.89E−11 9.76E−11 −5.51 74 123 98.5 CCNH 0.461538462 0.784843667 5.84 1.74E−09 6.80E−09 −6.314 98 100 99 GTF2A2 0.546153846 0.704292528 1.384 8.52E−09 2.98E−08 −7.124 109 91 100 SMARCB1 0.592307692 0.673555909 4.507 1.80E−09 6.94E−09 −6.278 99 102 100.5 AIP 0.753846154 0.533651298 1.163 9.59E−11 4.52E−10 −5.548 81 121 101 GTF3C5 0.361538462 0.845257022 0.941 2.67E−08 8.29E−08 −7.308 122 84 103 SARNP 0.807692308 0.474827769 1.911 7.18E−11 3.47E−10 −5.346 79 127 103 PRDM1 0.4 0.820349762 1.77 1.42E−08 4.68E−08 −7.027 116 93 104.5 ILF2 0.576923077 0.674085851 0.963 1.24E−08 4.13E−08 −6.724 115 96 105.5 MED30 0.584615385 0.688394277 4.883 5.48E−10 2.35E−09 −5.504 89 125 107 MYBBP1A 0.615384615 0.64917859 3.079 2.78E−09 1.04E−08 −5.75 102 113 107.5 TBC1D2B 0.453846154 0.774244833 0.239 2.83E−08 8.71E−08 −7.068 124 92 108 MKI67IP 0.476923077 0.76099629 3.216 1.18E−08 3.98E−08 −6.1 113 105 109 PHF6 0.446153846 0.779014308 2.531 3.54E−08 1.05E−07 −6.376 129 98 113.5 MED14 0.461538462 0.768415474 1.021 2.65E−08 8.29E−08 −6.061 123 106 114.5 PLRG1 0.430769231 0.786963434 0.848 7.05E−08 2.01E−07 −6.341 134 99 116.5 SAP18 0.738461538 0.496555379 0.287 9.91E−08 2.74E−07 −6.475 138 97 117.5 GTF2E2 0.469230769 0.760466349 3.469 3.42E−08 1.02E−07 −5.969 127 108 117.5 GNPTAB 0.361538462 0.83836778 3.399 9.41E−08 2.64E−07 −6.14 136 104 120 RNF4 0.792307692 0.471648119 2.011 1.25E−09 5.01E−09 −4.74 95 145 120 GTF3C1 0.546153846 0.695283519 0.766 3.08E−08 9.41E−08 −5.679 125 116 120.5 ZC3H15 0.746153846 0.50609433 0.651 1.14E−08 3.90E−08 −5.268 112 129 120.5 GTF3C2 0.615384615 0.64281929 0.536 6.77E−09 2.39E−08 −5.031 108 134 121 SMARCA5 0.4 0.810280869 1.911 8.03E−08 2.27E−07 −5.795 135 111 123 FUS 0.553846154 0.679915209 4.226 9.67E−08 2.70E−07 −5.754 137 112 124.5 SF1 0.807692308 0.430312666 2.18 2.32E−08 7.31E−08 −5.336 121 128 124.5 TCF3 0.430769231 0.783783784 1.683 1.16E−07 3.15E−07 −5.613 140 117 128.5 PFDN1 0.569230769 0.674085851 3.429 3.26E−08 9.88E−08 −5.208 126 132 129 ATF1 0.461538462 0.758346582 1.546 1.21E−07 3.27E−07 −5.583 141 120 130.5 RUVBL1 0.507692308 0.728139905 5.51 3.42E−08 1.02E−07 −5.173 128 133 130.5 CSDA 0.538461538 0.688924218 0.696 1.83E−07 4.75E−07 −5.591 147 119 133 UTP6 0.384615385 0.819289878 0.903 1.27E−07 3.38E−07 −5.472 144 126 135 ZRANB2 0.461538462 0.75145734 1.828 3.24E−07 8.04E−07 −5.604 154 118 136 HCLS1 0.869230769 0.42236354 6.652 2.29E−12 1.34E−11 −2.841 65 208 136.5 PPIE 0.530769231 0.699523052 3.717 1.12E−07 3.07E−07 −5.003 139 135 137 L3MBTL2 0.3 0.879173291 5.453 1.63E−07 4.26E−07 −5.212 146 131 138.5 HMGA1 0.361538462 0.82617912 1.949 7.24E−07 1.68E−06 −5.722 165 114 139.5 FOXN2 0.492307692 0.722840488 0.263 4.45E−07 1.08E−06 −5.509 157 124 140.5 GTF2B 0.592307692 0.657127716 5.004 1.83E−08 5.87E−08 −4.155 119 164 141.5 RPL7L1 0.584615385 0.674615792 2.98 4.27E−09 1.55E−08 −3.73 105 178 141.5 TERF1 0.369230769 0.815580286 0.566 1.48E−06 3.24E−06 −5.953 175 109 142 SND1 0.553846154 0.668786433 3.945 4.00E−07 9.85E−07 −5.245 155 130 142.5 E2F4 0.353846154 0.845786963 5.891 6.81E−08 1.96E−07 −4.583 133 152 142.5 SREBF1 0.469230769 0.759936407 3.198 3.71E−08 1.09E−07 −4.288 130 157 143.5 SIN3A 0.430769231 0.774774775 1.58 4.40E−07 1.08E−06 −4.929 156 138 147 BAZ1A 0.461538462 0.752517223 1.637 2.79E−07 7.02E−07 −4.798 152 143 147.5 CPPS5 0.484615385 0.734499205 5.938 2.26E−07 5.77E−07 −4.708 150 147 148.5 NFYB 0.530769231 0.685214626 0.485 7.02E−07 1.64E−06 −4.819 163 142 152.5 MORF4L2 0.6 0.644409115 3.343 3.82E−08 1.11E−07 −3.784 131 176 153.5 RAI1 0.361538462 0.827239004 1.47 6.12E−07 1.46E−06 −4.658 160 149 154.5 CNOT1 0.615384615 0.607843137 0.444 5.62E−07 1.35E−06 −4.627 159 151 155 SMARCA4 0.676923077 0.547429783 0.263 4.99E−07 1.21E−06 −4.43 158 155 156.5 PHB 0.723076923 0.532591415 4.168 9.31E−09 3.21E−08 −3.115 111 202 156.5 LRRFIP1 0.838461538 0.431372549 5.275 1.69E−10 7.87E−10 −2.399 82 231 156.5 CNOT3 0.507692308 0.699523052 0.696 1.53E−06 3.29E−06 −5.002 178 136 157 HIF1A 0.807692308 0.41600424 0.299 1.24E−07 3.32E−07 −3.819 143 172 157.5 TBP 0.4 0.793322734 1.541 1.09E−06 2.44E−06 −4.78 172 144 158 GTF2F1 0.630769231 0.59936407 4.07 2.62E−07 6.62E−07 −4.001 151 168 159.5 CAND1 0.453846154 0.744568098 0.189 1.94E−06 4.07E−06 −4.861 182 140 161 SREBF2 0.638461538 0.578696343 0.333 1.16E−06 2.56E−06 −4.646 174 150 162 HTATSF1 0.384615385 0.802331744 1.091 1.75E−06 3.74E−06 −4.689 179 148 163.5 PWP1 0.376923077 0.808161102 5.403 1.82E−06 3.86E−06 −4.477 180 153 166.5 ID2 0.923076923 0.259671436 0.88 2.19E−07 5.61E−07 −3.54 149 185 167 PSMC3 0.776923077 0.467408585 5.738 1.96E−08 6.25E−08 −2.725 120 214 167 MED23 0.353846154 0.821409645 1.195 3.68E−06 7.43E−06 −4.731 189 146 167.5 BCLAF1 0.6 0.616852146 3.619 1.10E−06 2.44E−06 −4.039 171 166 168.5 UIMC1 0.5 0.706412295 0.807 1.52E−06 3.29E−06 −4.205 177 161 169 MTA2 0.807692308 0.414414414 3.71 1.49E−07 3.92E−07 −3.261 145 193 169 METTL14 0.369230769 0.804981452 0.433 6.72E−06 1.28E−05 −4.871 200 139 169.5 NFX1 0.569230769 0.643349232 0.566 1.51E−06 3.27E−06 −4.159 176 163 169.5 THRAP3 0.784615385 0.42554319 1.257 8.56E−07 1.95E−06 −3.843 168 171 169.5 TAF1B 0.407692308 0.787493376 3.977 1.04E−06 2.34E−06 −3.897 170 170 170 PHF20 0.323076923 0.845786963 1.401 3.23E−06 6.59E−06 −4.46 187 154 170.5 RBPJ 0.669230769 0.562798092 1.189 2.11E−07 5.45E−07 −3.259 148 194 171 ZMAT2 0.638461538 0.58399576 1.118 6.44E−07 1.52E−06 −3.646 162 181 171.5 AATF 0.376923077 0.803921569 3.087 3.33E−06 6.77E−06 −4.346 188 156 172 TSG101 0.561538462 0.656597774 4.563 7.41E−07 1.71E−06 −3.724 166 179 172.5 YAF2 0.323076923 0.835718071 0.614 1.45E−05 2.67E−05 −4.858 207 141 174 ING3 0.484615385 0.71754107 0.651 2.05E−06 4.28E−06 −4.133 183 165 174 PREB 0.569230769 0.641229465 0.546 1.92E−06 4.05E−06 −3.922 181 169 175 RBM38 0.769230769 0.46581876 2.66 6.70E−08 1.94E−07 −2.6 132 218 175 MLX 0.484615385 0.711711712 0.722 4.13E−06 8.22E−06 −4.223 192 160 176 DPF2 0.576923077 0.64917859 3.629 3.22E−07 8.04E−07 −3.161 153 199 176 NDUFA13 0.930769231 0.291467939 5.001 8.88E−10 3.73E−09 −1.892 91 264 177.5 SMARCE1 0.723076923 0.492315845 0.465 1.03E−06 2.32E−06 −3.513 169 187 178 EED 0.346153846 0.827239004 5.106 3.75E−06 7.54E−06 −4.032 190 167 178.5 CTBP1 0.415384615 0.767885533 1.757 6.18E−06 1.19E−05 −4.233 199 159 179 C1D 0.515384615 0.697933227 3.825 8.03E−07 1.84E−06 −3.317 167 191 179 CXXC1 0.538461538 0.668256492 0.766 2.30E−06 4.77E−06 −3.795 184 175 179.5 CREM 0.607692308 0.608903021 0.731 1.17E−06 2.56E−06 −3.479 173 188 180.5 CBFA2T2 0.323076923 0.836248013 1.949 1.34E−05 2.52E−05 −4.254 204 158 181 CALR 0.869230769 0.339692634 0.911 1.21E−07 3.27E−07 −2.538 142 223 182.5 MYEF2 0.484615385 0.701112878 0.454 1.38E−05 2.58E−05 −4.163 205 162 183.5 CIZ1 0.476923077 0.718071012 0.911 4.34E−06 8.59E−06 −3.813 193 174 183.5 CNOT8 0.546153846 0.659247483 1.718 2.86E−06 5.87E−06 −3.558 186 184 185 ECD 0.384615385 0.79491256 5.027 4.92E−06 9.64E−06 −3.745 195 177 186 NR3C1 0.461538462 0.730259671 1.077 5.03E−06 9.81E−06 −3.622 196 182 189 IFI35 0.576923077 0.623741388 1.245 5.87E−06 1.13E−05 −3.586 198 183 190.5 BUD31 0.6 0.621621622 5.295 6.36E−07 1.51E−06 −2.549 161 222 191.5 ZMIZ1 0.569230769 0.625331214 0.275 1.07E−05 2.03E−05 −3.229 202 195 198.5 MLLT6 0.423076923 0.754107048 2.621 1.51E−05 2.77E−05 −3.293 208 192 200 FLII 0.661538462 0.53418124 0.595 1.06E−05 2.01E−05 −2.892 201 207 204 KAT2A 0.323076923 0.817170111 0.506 0.000158092 0.000255895 −3.814 236 173 204.5 UHRF2 0.392307692 0.765765766 0.379 7.89E−05 0.000134623 −3.537 224 186 205 RNF5 0.423076923 0.739798622 1.091 7.46E−05 0.000128378 −3.435 222 189 205.5 TCF20 0.607692308 0.576046635 1.864 3.48E−05 6.15E−05 −3.214 216 196 206 MAX 0.446153846 0.727080021 3.294 3.36E−05 5.99E−05 −3.186 214 198 206 IKZF2 0.469230769 0.697933227 0.084 8.20E−05 0.000139287 −3.435 225 190 207.5 PURB 0.523076923 0.658187599 0.595 3.15E−05 5.66E−05 −3.09 213 203 208 NPM1 0.992307692 0.100158983 7.766 2.57E−05 4.65E−05 −2.919 211 206 208.5 ELF2 0.323076923 0.816110228 0.275 0.000178828 0.000285825 −3.686 239 180 209.5 MLLT3 0.523076923 0.651828299 0.345 5.91E−05 0.000102562 −3.141 220 200 210 FLI1 0.692307692 0.495495495 1.727 2.02E−05 3.68E−05 −2.753 210 210 210 TBX21 0.638461538 0.567037626 0.433 4.07E−06 8.13E−06 −2.377 191 232 211.5 ABT1 0.284615385 0.853206147 4.143 7.77E−05 0.000133087 −3.123 223 201 212 THOC2 0.507692308 0.672496025 0.345 3.12E−05 5.63E−05 −2.716 212 215 213.5 PLAGL2 0.353846154 0.790673026 0.124 0.00017998 0.000286468 −3.194 240 197 218.5 BHLHE40 0.915384615 0.31054584 0.731 1.59E−09 6.26E−09 −0.569 97 341 219 RUNX3 0.753846154 0.449920509 1.091 2.56E−06 5.28E−06 −2.085 185 254 219.5 PML 0.430769231 0.726550079 0.163 0.000145194 0.000236018 −2.726 235 213 224 STAT3 0.861538462 0.333863275 4.622 7.19E−07 1.68E−06 −1.529 164 285 224.5 RNF2 0.4 0.748277689 0.299 0.000245261 0.000382017 −2.984 246 204 225 FOXJ3 0.376923077 0.766825649 0.239 0.000282531 0.000431707 −2.956 250 205 227.5 SMYD3 0.423076923 0.731319555 0.163 0.000177439 0.000285577 −2.635 238 217 227.5 CNBP 0.907692308 0.234234234 8.625 3.96E−05 6.95E−05 −2.303 218 238 228 NMI 0.546153846 0.643349232 5.658 1.59E−05 2.91E−05 −2.16 209 250 229.5 GABPB1 0.415384615 0.73608903 0.848 0.000216169 0.000341226 −2.593 242 219 230.5 YEATS4 0.453846154 0.696873344 0.895 0.000340112 0.000515566 −2.746 252 211 231.5 CHURC1 0.492307692 0.671436142 5.333 0.00013847 0.000226049 −2.414 234 230 232 HMG20B 0.461538462 0.693693694 0.687 0.000240097 0.00037589 −2.58 244 221 232.5 IRF2 0.6 0.570217276 0.888 0.000118311 0.000196498 −2.311 230 236 233 PHRF1 0.476923077 0.676735559 0.263 0.000311484 0.000474051 −2.7 251 216 233.5 MEN1 0.323076923 0.803921569 0.526 0.000672165 0.000976301 −2.79 263 209 236 RELA 0.623076923 0.546899841 0.401 0.000121264 0.000200532 −2.237 231 241 236 CTCF 0.369230769 0.765235824 0.227 0.00063258 0.000922311 −2.742 262 212 237 ATRX 0.576923077 0.588235294 0.07 0.000177925 0.000285577 −2.304 237 237 237 CCNT2 0.438461538 0.708532061 0.31 0.000417502 0.000625435 −2.585 255 220 237.5 REXO4 0.392307692 0.75145734 0.614 0.000346552 0.000523252 −2.538 253 224 238.5 NFATC1 0.815384615 0.361950185 0.632 1.41E−05 2.62E−05 −1.791 206 271 238.5 XAB2 0.469230769 0.685744568 0.696 0.000261486 0.000404404 −2.359 247 233 240 TCF25 0.830769231 0.353471118 1.787 5.25E−06 1.02E−05 −1.468 197 287 242 TSC22D4 0.669230769 0.501854796 0.604 0.000100854 0.000169718 −1.968 227 260 243.5 HSBP1 0.584615385 0.598834128 4.583 3.43E−05 6.09E−05 −1.745 215 275 245 MLL5 0.615384615 0.558028617 3.902 8.99E−05 0.000151901 −1.887 226 265 245.5 DDX54 0.538461538 0.620561738 0.379 0.000270477 0.000414948 −2.221 249 243 246 CHD4 0.692307692 0.488606253 1.195 3.83E−05 6.74E−05 −1.73 217 277 247 GTF2H2 0.323076923 0.80127186 0.848 0.000877194 0.00124568 −2.486 269 227 248 TWISTNB 0.407692308 0.725490196 0.465 0.001070377 0.001502316 −2.516 273 225 249 GABPA 0.4 0.731319555 0.227 0.001171536 0.00162737 −2.509 275 226 250.5 TBL1XR1 0.530769231 0.636459989 0.287 0.000126733 0.000207776 −1.796 233 270 251.5 EP300 0.453846154 0.687864335 0.098 0.000746758 0.001076459 −2.286 265 240 252.5 MED4 0.3 0.816110228 0.872 0.001369096 0.001881276 −2.485 278 228 253 LDB1 0.507692308 0.640699523 0.516 0.000581964 0.000861668 −2.161 258 249 253.5 TMF1 0.569230769 0.567567568 0.138 0.001662961 0.00226068 −2.429 281 229 255 NOTCH1 0.646153846 0.524642289 0.263 0.000109848 0.000183239 −1.53 229 284 256.5 ING1 0.330769231 0.788553259 0.422 0.001580999 0.002156935 −2.343 280 234 257 HTATIP2 0.415384615 0.722310546 0.748 0.000775953 0.001114338 −2.177 266 248 257 DR1 0.415384615 0.724960254 0.345 0.000613734 0.000905198 −2.015 259 257 258 SP110 0.761538462 0.408055114 2.501 6.19E−05 0.000106945 −1.29 221 297 259 NCOA4 0.453846154 0.685744568 0.275 0.00089151 0.001261321 −2.128 270 251 260.5 TRIM27 0.315384615 0.820879703 3.219 0.000212144 0.000336261 −1.655 241 280 260.5 RNF44 0.653846154 0.502384738 0.227 0.000362585 0.000545305 −1.843 254 268 261 EIF3H 0.984615385 0.129835718 6.915 4.81E−06 9.47E−06 −0.817 194 328 261 SP3 0.423076923 0.70800212 0.263 0.001445503 0.001979148 −2.215 279 244 261.5 NRF1 0.430769231 0.696343402 0.322 0.002090047 0.002762623 −2.319 289 235 262 AEBP2 0.453846154 0.675145734 0.111 0.002070131 0.002755365 −2.226 286 242 264 MTA3 0.538461538 0.610492846 0.444 0.000623021 0.000915362 −1.79 260 272 266 PQBP1 0.492307692 0.644939057 0.941 0.001323084 0.001824614 −2.006 277 258 267.5 MED17 0.346153846 0.767355591 0.163 0.003123932 0.00399111 −2.298 299 239 269 CNOT7 0.438461538 0.690514043 0.454 0.001897181 0.002542888 −2.087 285 253 269 BLOC1S1 0.430769231 0.70482247 0.941 0.001055242 0.001487463 −1.822 271 269 270 MORF4L1 0.661538462 0.499735029 5.916 0.00023623 0.000371358 −1.194 243 300 271.5 DNM2 0.676923077 0.491255962 2.87 0.000125926 0.000207344 −1.045 232 311 271.5 SNW1 0.615384615 0.545310016 0.411 0.000266795 0.000410951 −1.3 248 296 272 IKZF1 0.769230769 0.393216746 2.698 0.000106491 0.00017842 −0.926 228 318 273 CBX4 0.361538462 0.753047165 0.138 0.003309326 0.004185969 −2.191 302 245 273.5 CEBPZ 0.4 0.719130896 0.401 0.003148239 0.004008758 −2.181 300 247 273.5 NRBF2 0.307692308 0.801801802 0.595 0.002844803 0.003658972 −2.088 297 252 274.5 GON4L 0.453846154 0.681505034 0.057 0.001259528 0.001743259 −1.739 276 276 276 GABPB2 0.607692308 0.514573397 0.029 0.004489896 0.005586776 −2.191 307 246 276.5 KDM2B 0.507692308 0.62427133 0.263 0.002081507 0.002760887 −1.866 288 266 277 ZNRD1 0.407692308 0.71754107 1.406 0.002065194 0.002755365 −1.857 287 267 277 FOSB 0.446153846 0.679385268 0.214 0.002578397 0.003338806 −1.966 295 261 278 RUNX2 0.630769231 0.505564388 0.124 0.00169323 0.002293667 −1.757 282 274 278 KEAP1 0.361538462 0.753577107 0.356 0.0031715 0.004024961 −2.027 301 256 278.5 NCOA2 0.469230769 0.657657658 0.084 0.002610066 0.003368397 −1.927 296 262 279 STAT1 0.746153846 0.401695813 3.65 0.000440334 0.000657061 −1.161 256 303 279.5 MED24 0.346153846 0.763116057 0.31 0.004397886 0.005490172 −2.044 306 255 280.5 MED1 0.576923077 0.5590885 0.227 0.001770331 0.002389634 −1.706 283 278 280.5 BTF3 0.984615385 0.121886592 7.506 1.31E−05 2.47E−05 −0.271 203 359 281 CAMTA2 0.361538462 0.748277689 0.239 0.004805109 0.005959584 −2.004 308 259 283.5 NFKB2 0.669230769 0.491255962 0.275 0.000246011 0.000382017 −0.882 245 322 283.5 TARBP2 0.315384615 0.792792793 0.941 0.003506398 0.00439162 −1.906 305 263 284 MED8 0.353846154 0.763645999 0.774 0.002422937 0.003158915 −1.704 293 279 286 MED15 0.576923077 0.55590885 0.214 0.002216947 0.00291022 −1.634 291 281 286 PTTG1 0.607692308 0.535241123 0.322 0.001073645 0.001502316 −1.165 272 302 287 CNOT2 0.515384615 0.614732379 0.651 0.002432379 0.003160438 −1.442 294 288 291 CHD3 0.515384615 0.629040806 0.176 0.000827506 0.0011805 −0.981 268 314 291 BATF 0.584615385 0.561738209 1.098 0.000828204 0.0011805 −0.915 267 319 293 RNF7 0.661538462 0.485426603 5.049 0.000729503 0.001055568 −0.882 264 323 293.5 COPS2 0.392307692 0.71754107 0.299 0.005951618 0.007357664 −1.611 309 282 295.5 PNRC2 0.523076923 0.607843137 0.496 0.002342715 0.003064784 −1.206 292 299 295.5 TRIP12 0.530769231 0.579226285 0.084 0.009416967 0.011276745 −1.771 319 273 296 SBDS 0.5 0.616322205 0.722 0.005997032 0.007389891 −1.603 310 283 296.5 PFDN5 0.876923077 0.271860095 5.965 5.41E−05 9.44E−05 −0.049 219 375 297 NT5C 0.692307692 0.455219926 0.918 0.000625642 0.000915691 −0.781 261 334 297.5 RLIM 0.646153846 0.479597244 0.138 0.003398602 0.004270612 −1.323 304 294 299 STAT5A 0.538461538 0.589825119 0.014 0.002910944 0.003731478 −1.168 298 301 299.5 VAV1 0.592307692 0.54954955 4.64 0.001164709 0.001623791 −0.841 274 326 300 NACA 0.976923077 0.105988341 8.157 0.000474445 0.000705206 −0.541 257 343 300 BRD8 0.607692308 0.505034446 0.07 0.008136744 0.009898842 −1.394 314 289 301.5 CCNT1 0.407692308 0.700582936 0.556 0.00724694 0.008844508 −1.367 313 292 302.5 MIER1 0.630769231 0.495495495 0.287 0.003373312 0.004252822 −1.156 303 304 303.5 MLXIP 0.515384615 0.593004769 0.202 0.010157615 0.012125653 −1.326 320 293 306.5 HDAC4 0.384615385 0.715951245 0.239 0.010789167 0.012839445 −1.303 321 295 308 ARID1A 0.746153846 0.382617912 0.287 0.001833786 0.002466571 −0.787 284 332 308 ELF4 0.392307692 0.695813461 0.251 0.024082657 0.027793278 −1.484 331 286 308.5 HIVEP1 0.392307692 0.698463169 0.151 0.020633997 0.024178487 −1.386 326 291 308.5 SERTAD1 0.376923077 0.727080021 0.791 0.008177881 0.009917303 −1.148 315 305 310 EGR1 0.546153846 0.568627451 0.214 0.007139558 0.008741382 −1.076 312 309 310.5 ATF6B 0.369230769 0.71436142 0.299 0.028613822 0.032628298 −1.392 335 290 312.5 CNOT4 0.315384615 0.767885533 0.299 0.022358071 0.025959827 −1.247 329 298 313.5 NFATC3 0.538461538 0.571807101 0.111 0.0093423 0.011241079 −1.067 317 310 313.5 NFYC 0.438461538 0.665076842 0.433 0.011271759 0.013372087 −1.138 322 307 314.5 NR1H2 0.576923077 0.535241123 0.575 0.008507946 0.010284923 −1.01 316 313 314.5 SCAND1 0.3 0.777954425 1.036 0.028500335 0.032596191 −1.14 334 306 320 LIMD1 0.430769231 0.66136725 0.176 0.021686374 0.025256692 −1.016 328 312 320 VGLL4 0.546153846 0.569157393 0.705 0.006907501 0.008484455 −0.794 311 330 320.5 PHF20L1 0.438461538 0.648648649 0.151 0.029163857 0.033156528 −1.077 336 308 322 ATF4 0.8 0.320084791 1.22 0.002184212 0.002877135 −0.28 290 357 323.5 NR4A3 0.430769231 0.659247483 0.604 0.024422379 0.028100448 −0.936 332 316 324 DAXX 0.384615385 0.701112878 0.546 0.026852701 0.030804 −0.894 333 320 326.5 ARID5B 0.376923077 0.700582936 0.214 0.041029908 0.046098309 −0.98 340 315 327.5 HDAC7 0.615384615 0.478537361 0.263 0.023208899 0.026866059 −0.849 330 325 327.5 TET3 0.384615385 0.693693694 0.124 0.040264914 0.045372262 −0.932 339 317 328 TOX4 0.546153846 0.533651298 0.043 0.047337129 0.052873635 −0.893 342 321 331.5 CCNL2 0.684615385 0.410174881 0.496 0.019763979 0.023230277 −0.622 325 338 331.5 MED12 0.484615385 0.602013778 0.124 0.032517067 0.036859108 −0.83 337 327 332 RNF166 0.523076923 0.572866985 0.356 0.020862813 0.024371849 −0.654 327 337 332 NR4A1 0.692307692 0.411764706 0.275 0.011525026 0.013630217 −0.361 323 349 336 DENND4A 0.723076923 0.371489136 0.124 0.017803265 0.020990269 −0.36 324 350 337 NFKBIB 0.576923077 0.533651298 0.642 0.009357756 0.011241079 −0.282 318 356 337 BCL11B 0.423076923 0.647588765 0.111 0.063888514 0.071152806 −0.785 343 333 338 NFKB1 0.392307692 0.669316375 0.151 0.090500848 0.099058234 −0.81 349 329 339 RNF19A 0.407692308 0.657127716 0.239 0.080864207 0.089277824 −0.716 346 335 340.5 HSF1 0.361538462 0.691043985 0.536 0.124988239 0.135256395 −0.794 353 331 342 CDK7 0.553846154 0.491255962 0.014 0.182958536 0.193066742 −0.873 362 324 343 VPS72 0.4 0.659777424 0.444 0.099009723 0.108062041 −0.667 350 336 343 ING4 0.392307692 0.671436142 0.731 0.082559966 0.09088734 −0.56 347 342 344.5 NCOA3 0.623076923 0.457869634 0.176 0.043719541 0.048976143 −0.397 341 348 344.5 CREBBP 0.430769231 0.633280339 0.163 0.086408678 0.094850905 −0.476 348 344 346 RNF14 0.315384615 0.729199788 0.465 0.158320707 0.168934386 −0.588 358 339 348.5 NOTCH2 0.584615385 0.474297827 0.138 0.112776801 0.12238846 −0.472 352 345 348.5 GATA3 0.484615385 0.576576577 0.379 0.101937767 0.110940818 −0.402 351 347 349 KDM5A 0.584615385 0.500794913 0.084 0.036243786 0.040961912 −0.269 338 362 350 TLE3 0.446153846 0.604663487 0.176 0.146499903 0.157199334 −0.426 356 346 351 DTX3L 0.630769231 0.439321675 0.163 0.07039306 0.077942461 −0.27 345 360 352.5 SMAD7 0.415384615 0.632750397 0.239 0.157350387 0.168369321 −0.305 357 354 355.5 REL 0.423076923 0.623211447 0.367 0.168793051 0.179108182 −0.32 360 352 356 MYSM1 0.546153846 0.492315845 0.043 0.224355068 0.236098171 −0.329 363 351 357 NSD1 0.561538462 0.486486486 0.084 0.166267058 0.176919265 −0.296 359 355 357 RNF114 0.623076923 0.447800742 0.299 0.06852014 0.076089225 −0.091 344 371 357.5 STAT6 0.546153846 0.50609433 0.163 0.144163849 0.155128424 −0.27 355 361 358 GLRX2 0.7 0.293587705 0.111 0.604781803 0.609568994 −0.58 378 340 359 MYC 0.369230769 0.673555909 0.333 0.181584894 0.192148004 −0.276 361 358 359.5 TBPL1 0.338461538 0.683624801 0.401 0.332148047 0.34384974 −0.317 369 353 361 IRF3 0.392307692 0.643879173 0.696 0.22933455 0.24067527 −0.241 364 364 364 CCNL1 0.607692308 0.420243773 0.475 0.298309917 0.312203803 −0.152 365 367 366 KLF6 0.761538462 0.28881823 0.333 0.128582033 0.138752363 0 354 379 366.5 RNF125 0.438461538 0.588765236 0.585 0.301200842 0.313511503 −0.152 366 368 367 ATF7IP 0.515384615 0.502914679 0.275 0.377191966 0.387331535 −0.16 372 366 369 ATF2 0.307692308 0.702702703 0.263 0.435327885 0.442274606 −0.248 376 363 369.5 SPOP 0.461538462 0.565977742 0.379 0.300549638 0.313511503 −0.088 367 372 369.5 MKL1 0.415384615 0.579226285 0.176 0.582407766 0.590132007 −0.167 377 365 371 XBP1 0.353846154 0.658187599 0.401 0.423690283 0.432753177 −0.122 374 369 371.5 PER1 0.561538462 0.455219926 0.227 0.390605456 0.400030252 −0.119 373 370 371.5 PNRC1 0.476923077 0.543720191 0.526 0.356539543 0.367110797 −0.064 371 373 372 FOSL2 0.592307692 0.429782724 0.214 0.345579917 0.356787914 −0.016 370 376 373 MAF1 0.669230769 0.354531002 0.585 0.327521118 0.33998116 0 368 380 374 UBXN4 0.523076923 0.488606253 0.084 0.433942783 0.442043048 −0.051 375 374 374.5 PYHIN1 0.392307692 0.599894012 0.333 0.603709408 0.609568994 −0.016 379 377 378 MAML2 0.338461538 0.610492846 0.098 0.894958451 0.899668759 −0.016 380 378 379 PBXIP1 0.415384615 0.501324854 0.189 0.973312343 0.973312343 0 381 381 381 TGIF1 0.407692308 0.509803922 0.585 0.972336961 0.973312343 0 382 382 382
TABLE-US-00018 TABLE 16 Ranked top surface cytokines differentially expressed in cluster 10 Genes TP TN thresh_mhg hyper_pval hyper_qval SIVA1 0.753846154 0.761526232 6.445 1.91E−32 3.26E−30 NUP85 0.653846154 0.789083201 4.43 2.40E−25 1.37E−23 PAQR4 0.423076923 0.905140435 0.632 1.17E−20 4.02E−19 HMGB1 0.661538462 0.763645999 9.144 7.18E−23 3.07E−21 LGALS1 0.953846154 0.407525172 9.608 1.90E−20 5.42E−19 PDCD1 1 0.411234764 6.848 2.41E−29 2.06E−27 ATPIF1 0.753846154 0.641229465 4.118 8.73E−19 1.49E−17 ULBP1 0.384615385 0.910439852 3.345 5.93E−18 8.45E−17 IDE 0.830769231 0.526232114 0.485 3.12E−16 3.60E−15 HAVCR2 0.746153846 0.644409115 1.761 2.20E−18 3.41E−17 CXCR6 0.961538462 0.382617912 1.996 1.40E−19 3.00E−18 LAG3 0.915384615 0.464758877 0.774 4.17E−20 1.02E−18 CMTM7 0.823076923 0.535241123 6.084 3.16E−16 3.60E−15 TFRC 0.592307692 0.731319555 0.444 9.31E−14 6.92E−13 HSPD1 0.853846154 0.496555379 5.669 4.06E−16 4.08E−15 CD244 0.392307692 0.872284049 4.52 4.44E−13 2.92E−12 MIF 0.961538462 0.319024907 7.358 6.74E−15 6.06E−14 ENTPD1 0.646153846 0.672496025 0.575 7.65E−13 4.67E−12 HNRNPU 0.784615385 0.54954955 2.834 4.77E−14 3.88E−13 PGLYRP1 0.823076923 0.53418124 6.746 3.81E−16 4.07E−15 TIGIT 0.984615385 0.325384208 3.669 7.83E−19 1.49E−17 TNFRSF9 0.769230769 0.572337043 4.358 1.76E−14 1.50E−13 HSPA9 0.769230769 0.551669316 0.575 5.21E−13 3.30E−12 LAP3 0.376923077 0.861685215 4.92 8.61E−11 3.51E−10 USP14 0.492307692 0.781664017 4.578 3.71E−11 1.81E−10 NR4A2 0.823076923 0.485426603 1 1.08E−12 6.35E−12 HSPA8 0.907692308 0.348171701 11.569 4.53E−11 2.09E−10 M6PR 0.907692308 0.420243773 6.122 7.70E−16 7.32E−15 2-Sep 0.923076923 0.346051934 1.618 2.24E−12 1.24E−11 CTLA4 0.930769231 0.391626921 2.257 2.65E−16 3.49E−15 IFNG 0.561538462 0.718071012 1.47 1.21E−10 4.72E−10 XPOT 0.453846154 0.797032326 0.111 5.70E−10 1.95E−09 ADAM10 0.8 0.485956545 0.214 5.33E−11 2.28E−10 C1QBP 0.723076923 0.574986751 1.705 2.74E−11 1.38E−10 PEBP1 0.838461538 0.480127186 7.427 1.37E−13 9.77E−13 IL10RA 0.792307692 0.518282989 0.251 1.71E−12 9.77E−12 P4HB 0.861538462 0.427133015 6.085 4.98E−12 2.66E−11 CTSB 0.946153846 0.322204557 1.064 2.97E−13 2.03E−12 GPR56 0.476923077 0.771595125 0.604 2.07E−09 6.33E−09 NCOR2 0.607692308 0.665076842 0.189 7.81E−10 2.52E−09 HSP90AB1 0.984615385 0.195018548 9.312 7.18E−10 2.36E−09 PDIA3 0.938461538 0.289348172 5.431 2.23E−10 7.96E−10 PGRMC1 0.553846154 0.724960254 5.442 1.16E−10 4.60E−10 HSP90AA1 0.869230769 0.401165872 4.724 4.76E−11 2.14E−10 IL2RB 1 0.164811871 5.599 1.59E−10 6.02E−10 SEMA4D 0.923076923 0.28881823 0.189 5.95E−09 1.73E−08 ITGAV 0.638461538 0.61791203 0.084 9.93E−09 2.74E−08 IL12RB1 0.392307692 0.818229995 0.465 5.69E−08 1.41E−07 LYST 0.576923077 0.667196608 1.401 3.19E−08 8.15E−08 ERP29 0.630769231 0.643349232 3.343 8.02E−10 2.54E−09 CD38 0.453846154 0.775834658 2.92 2.20E−08 5.69E−08 IGF2R 0.6 0.635400106 0.275 1.21E−07 2.83E−07 ISG20 0.369230769 0.836777954 5.339 4.54E−08 1.14E−07 FLOT2 0.438461538 0.775304716 0.895 1.63E−07 3.66E−07 NRP1 0.607692308 0.644939057 0.422 1.36E−08 3.64E−08 ERP44 0.769230769 0.500264971 2.227 9.11E−10 2.83E−09 FERMT3 0.938461538 0.296237414 3.077 8.59E−11 3.51E−10 IL21R 0.807692308 0.432432432 0.84 1.79E−08 4.72E−08 CTSD 0.984615385 0.162162162 5.25 6.91E−08 1.69E−07 CLIC4 0.484615385 0.738738739 1.669 1.26E−07 2.90E−07 RAC1 0.838461538 0.405405405 3.048 5.01E−09 1.50E−08 GDI2 0.961538462 0.260201378 5.029 5.01E−11 2.20E−10 FASL 0.561538462 0.674085851 6.847 8.30E−08 2.00E−07 ATP5B 0.953846154 0.233704293 8.83 1.24E−08 3.36E−08 GPI1 0.953846154 0.287758347 7.6 6.92E−12 3.59E−11 LY6A 0.661538462 0.595654478 6.686 9.45E−09 2.65E−08 LRPAP1 0.423076923 0.779014308 4.695 5.88E−07 1.24E−06 CCR5 0.561538462 0.655537891 0.546 8.41E−07 1.73E−06 ITGB2 0.930769231 0.300476948 7.403 2.62E−10 9.16E−10 PDLIM2 0.507692308 0.707472178 3.87 5.70E−07 1.22E−06 LSM1 0.484615385 0.717011129 0.895 2.19E−06 4.20E−06 EZR 0.892307692 0.359300477 4.859 2.01E−10 7.31E−10 CCRL2 0.453846154 0.746687864 0.632 1.47E−06 2.93E−06 TLN1 0.915384615 0.326974033 3.176 1.76E−10 6.55E−10 SCARB2 0.361538462 0.813460519 0.506 4.84E−06 8.63E−06 MYO9B 0.523076923 0.703232644 1.214 1.69E−07 3.75E−07 CCL5 0.984615385 0.258611553 7.976 5.11E−14 3.97E−13 CLPTM1 0.423076923 0.767885533 0.678 2.71E−06 5.08E−06 BSG 0.907692308 0.348171701 2.239 4.53E−11 2.09E−10 PDIA4 0.553846154 0.647588765 0.978 4.71E−06 8.57E−06 CD2BP2 0.623076923 0.588765236 0.345 2.05E−06 3.98E−06 CALR 0.869230769 0.339692634 0.911 1.21E−07 2.83E−07 GRN 0.323076923 0.840487546 2.31 7.26E−06 1.27E−05 NR3C1 0.461538462 0.730259671 1.077 5.03E−06 8.87E−06 PTPRCAP 0.984615385 0.195018548 1.811 7.18E−10 2.36E−09 H13 0.9 0.323794383 3.905 5.12E−09 1.51E−08 ADAM8 0.515384615 0.678325384 0.345 7.98E−06 1.38E−05 LILRB4 0.530769231 0.668786433 2.882 4.82E−06 8.63E−06 CR1L 0.530769231 0.6709062 5.969 3.80E−06 7.06E−06 CD52 0.984615385 0.141494436 8.378 1.07E−06 2.18E−06 REEP4 0.353846154 0.812400636 5.512 1.29E−05 2.19E−05 GPR65 0.6 0.604663487 0.949 4.20E−06 7.72E−06 NAMPT 0.392307692 0.772125066 0.189 3.85E−05 6.10E−05 GABARAPL1 0.469230769 0.709062003 0.595 2.60E−05 4.19E−05 H2-M3 0.515384615 0.672496025 2.296 1.50E−05 2.49E−05 CD8A 1 0.137784844 6.569 8.48E−09 2.42E−08 CD3G 0.992307692 0.118706942 8.288 2.26E−06 4.29E−06 PSTPIP1 0.746153846 0.461579226 3.269 1.85E−06 3.64E−06 KLRC1 0.715384615 0.510863805 3.234 3.31E−07 7.16E−07 BST2 0.507692308 0.684684685 4.919 8.56E−06 1.46E−05 CCL4 0.553846154 0.626391097 1.257 4.18E−05 6.49E−05 NCKAP1L 0.692307692 0.494435612 2.118 2.23E−05 3.64E−05 CD48 0.853846154 0.358770535 5.697 1.32E−07 3.02E−07 PSEN1 0.515384615 0.647058824 0.401 0.000180441 0.000252913 CORO1A 0.930769231 0.211976683 10.514 1.33E−05 2.23E−05 SPN 0.7 0.463169051 1.257 0.000172896 0.000248447 THY1 0.907692308 0.271860095 4.919 7.11E−07 1.48E−06 LAMP2 0.446153846 0.706412295 0.585 0.000268583 0.000367422 SLC3A2 0.861538462 0.3290938 3.721 1.21E−06 2.43E−06 TNFRSF18 0.784615385 0.439321675 4.927 1.88E−07 4.12E−07 CD96 0.623076923 0.543190249 0.367 0.000166732 0.00024162 PEAR1 0.376923077 0.759406465 0.287 0.000583902 0.00077401 TNFRSF4 0.507692308 0.669846317 1.07 4.09E−05 6.41E−05 RPS6KB1 0.484615385 0.660837308 0.251 0.000661106 0.000869608 CAP1 0.723076923 0.463698993 0.401 1.83E−05 3.01E−05 KLRC2 0.623076923 0.561208267 1.202 3.33E−05 5.32E−05 CCL3 0.407692308 0.726550079 1.379 0.000977161 0.001246974 AIMP1 0.569230769 0.595654478 0.986 0.000179206 0.000252913 ECE1 0.361538462 0.764175941 0.227 0.0012909 0.00163514 CD44 0.692307692 0.456279809 0.356 0.000576875 0.000770669 ROCK1 0.546153846 0.591944886 0.111 0.001463222 0.001839787 NOTCH1 0.646153846 0.524642289 0.263 0.000109848 0.000162337 AAMP 0.653846154 0.524112348 5.699 5.74E−05 8.62E−05 PDE4D 0.476923077 0.655537891 0.151 0.001782987 0.002209354 F2R 0.484615385 0.64917859 0.444 0.001667431 0.002081247 CD164 0.884615385 0.262851086 3.392 4.94E−05 7.54E−05 HCST 0.823076923 0.338102809 5.272 5.61E−05 8.49E−05 CD82 0.907692308 0.232644409 1.091 4.64E−05 7.16E−05 ADAM17 0.407692308 0.696873344 0.251 0.009299564 0.010891955 STK10 0.730769231 0.428192899 1.202 0.00020202 0.000280858 IRAK2 0.523076923 0.591944886 0.239 0.006827407 0.008107545 CD160 0.415384615 0.699523052 0.895 0.004746152 0.005755972 SBDS 0.5 0.616322205 0.722 0.005997032 0.007171276 CD3E 0.807692308 0.345521993 7.041 0.00014529 0.000212347 SMPD1 0.330769231 0.768415474 0.632 0.008326184 0.009819155 ITGAL 0.884615385 0.254372019 3.415 0.000110123 0.000162337 B4GALT1 0.907692308 0.218865925 1.339 0.00017627 0.000251184 ANXA5 0.592307692 0.541070482 0.367 0.002142195 0.002635363 TMEM123 0.776923077 0.361420244 0.367 0.000704655 0.000919817 TRPV2 0.569230769 0.53736089 0.444 0.011812575 0.013648313 CD6 0.776923077 0.376258612 3.457 0.000214698 0.000296076 ATP6AP2 0.446153846 0.645468998 0.526 0.023239485 0.026493013 CAST 0.615384615 0.493375729 0.401 0.010226771 0.011896448 CD97 0.769230769 0.368309486 0.687 0.000804983 0.001034978 HSPA5 0.9 0.224165342 6.751 0.000278772 0.000378333 CNP 0.646153846 0.473237944 0.496 0.005127118 0.006174206 IL27RA 0.553846154 0.529941706 0.444 0.03930102 0.044213648 FLT3L 0.353846154 0.70800212 0.918 0.083001879 0.091569815 CD47 0.907692308 0.202437732 6.03 0.000784417 0.001016177 CD3D 0.992307692 0.080021198 5.681 0.000327523 0.000440996 ICOS 0.646153846 0.4409115 0.39 0.031709005 0.035908874 IL18RAP 0.461538462 0.588235294 0.411 0.153414613 0.163961868 CMTM6 0.492307692 0.573396926 0.39 0.085468407 0.093236223 CD27 0.807692308 0.31054584 0.696 0.002306039 0.002816662 NOTCH2 0.584615385 0.474297827 0.138 0.112776801 0.121288257 CD226 0.515384615 0.544250132 0.705 0.109734793 0.118763605 KLRK1 0.553846154 0.523582406 0.31 0.052818796 0.059032772 ITGB1 0.638461538 0.437731849 0.239 0.053520057 0.059428115 CD37 0.815384615 0.276099629 1.501 0.012826956 0.014720869 CD5 0.576923077 0.489136195 0.566 0.085602848 0.093236223 ICAM1 0.423076923 0.61791203 0.251 0.201104231 0.212276688 IL16 0.492307692 0.551669316 0.287 0.188351528 0.200050381 TNIP1 0.430769231 0.57763646 0.433 0.460212051 0.479855248 CCND2 0.623076923 0.391096979 0.111 0.412262776 0.432496532 CXCR3 0.3 0.68627451 0.614 0.661022409 0.680932723 CD28 0.615384615 0.382617912 0.251 0.557553199 0.57782786 KLRD1 0.553846154 0.40063593 1.189 0.867473835 0.882964439 IL4RA 0.415384615 0.563328034 0.287 0.713069164 0.730148665 CD84 0.438461538 0.50609433 0.275 0.905698529 0.916416855 PDE4B 0.392307692 0.540010599 0.31 0.944621169 0.950177764 IL18R1 0.346153846 0.536301007 0.151 0.996721649 0.996721649 Genes gen_qval rank_hyper_qval rank_gen_qval mean_rank SIVA1 −35.654 1 1 1 NUP85 −26.704 3 3 3 PAQR4 −26.737 5 2 3.5 HMGB1 −22.967 4 4 4 LGALS1 −14.204 6 8 7 PDCD1 −10.914 2 13 7.5 ATPIF1 −15.563 10 6 8 ULBP1 −21.514 12 5 8.5 IDE −14.337 15 7 11 HAVCR2 −11.845 11 11 11 CXCR6 −10.395 8 16 12 LAG3 −9.648 7 18 12.5 CMTM7 −11.642 14 12 13 TFRC −13.128 23 9 16 HSPD1 −9.938 17 17 17 CD244 −12.777 26 10 18 MIF −9.141 19 20 19.5 ENTPD1 −10.653 28 14 21 HNRNPU −9.082 21 21 21 PGLYRP1 −7.444 16 27 21.5 TIGIT −6.684 9 37 23 TNFRSF9 −6.921 20 32 26 HSPA9 −7.58 27 26 26.5 LAP3 −10.474 42 15 28.5 USP14 −8.614 35 22 28.5 NR4A2 −7.402 29 28 28.5 HSPA8 −7.744 37 25 31 M6PR −5.78 18 45 31.5 2-Sep −6.85 31 34 32.5 CTLA4 −5.182 13 54 33.5 IFNG −7.877 44 24 34 XPOT −9.176 50 19 34.5 ADAM10 −7.117 40 30 35 C1QBP −6.748 34 36 35 PEBP1 −5.371 24 51 37.5 IL10RA −5.555 30 47 38.5 P4HB −5.755 32 46 39 CTSB −5.196 25 53 39 GPR56 −8.024 56 23 39.5 NCOR2 −7.15 53 29 41 HSP90AB1 −7.088 51 31 41 PDIA3 −6.798 48 35 41.5 PGRMC1 −6.256 43 41 42 HSP90AA1 −5.526 38 48 43 IL2RB −5.386 45 50 47.5 SEMA4D −6.308 59 40 49.5 ITGAV −6.619 62 38 50 IL12RB1 −6.877 69 33 51 LYST −6.418 67 39 53 ERP29 −5.341 54 52 53 CD38 −5.903 66 43 54.5 IGF2R −6.171 73 42 57.5 ISG20 −5.493 68 49 58.5 FLOT2 −5.816 76 44 60 NRP1 −4.848 64 57 60.5 ERP44 −3.984 55 66 60.5 FERMT3 −3.067 41 81 61 IL21R −4.477 65 60 62.5 CTSD −4.731 70 58 64 CLIC4 −5.052 74 55 64.5 RAC1 −3.585 57 72 64.5 GDI2 −2.658 39 90 64.5 FASL −4.257 71 61 66 ATP5B −3.718 63 70 66.5 GPI1 −2.297 33 100 66.5 LY6A −3.074 61 80 70.5 LRPAP1 −4.182 81 63 72 CCR5 −4.208 83 62 72.5 ITGB2 −2.383 49 97 73 PDLIM2 −3.972 80 67 73.5 LSM1 −4.546 89 59 74 EZR −2.293 47 101 74 CCRL2 −4.152 86 64 75 TLN1 −2.174 46 104 75 SCARB2 −5.039 96 56 76 MYO9B −3.28 77 75 76 CCL5 −0.865 22 132 77 CLPTM1 −4.014 91 65 78 BSG −1.568 36 121 78.5 PDIA4 −3.785 94 69 81.5 CD2BP2 −3.246 88 77 82.5 CALR −2.538 72 93 82.5 GRN −3.919 98 68 83 NR3C1 −3.622 97 71 84 PTPRCAP −1.636 52 116 84 H13 −1.702 58 113 85.5 ADAM8 −3.536 99 73 86 LILRB4 −3.139 95 79 87 CR1L −2.958 92 84 88 CD52 −2.52 84 94 89 REEP4 −3.201 101 78 89.5 GPR65 −2.846 93 86 89.5 NAMPT −3.307 108 74 91 GABARAPL1 −3.276 106 76 91 H2-M3 −3.027 103 82 92.5 CD8A −1.481 60 125 92.5 CD3G −2.319 90 98 94 PSTPIP1 −1.969 87 107 97 KLRC1 −1.67 79 115 97 BST2 −2.474 100 96 98 CCL4 −2.82 110 87 98.5 NCKAP1L −2.589 105 92 98.5 CD48 −1.496 75 124 99.5 PSEN1 −3.022 122 83 102.5 CORO1A −2.149 102 105 103.5 SPN −2.775 119 89 104 THY1 −1.247 82 127 104.5 LAMP2 −2.916 125 85 105 SLC3A2 −1.331 85 126 105.5 TNFRSF18 −0.839 78 133 105.5 CD96 −2.507 118 95 106.5 PEAR1 −2.815 129 88 108.5 TNFRSF4 −1.862 109 109 109 RPS6KB1 −2.611 130 91 110.5 CAP1 −1.569 104 120 112 KLRC2 −1.553 107 122 114.5 CCL3 −2.31 134 99 116.5 AIMP1 −1.709 121 112 116.5 ECE1 −2.269 135 102 118.5 CD44 −1.758 128 110 119 ROCK1 −2.26 136 103 119.5 NOTCH1 −1.53 116 123 119.5 AAMP −1.174 114 128 121 PDE4D −2.074 138 106 122 F2R −1.743 137 111 124 CD164 −0.671 112 136 124 HCST −0.665 113 137 125 CD82 −0.582 111 141 126 ADAM17 −1.872 146 108 127 STK10 −0.812 123 134 128.5 IRAK2 −1.697 144 114 129 CD160 −1.583 141 118 129.5 SBDS −1.603 143 117 130 CD3E −0.411 117 145 131 SMPD1 −1.575 145 119 132 ITGAL −0.332 115 150 132.5 B4GALT1 −0.384 120 147 133.5 ANXA5 −1.01 139 130 134.5 TMEM123 −0.497 131 142 136.5 TRPV2 −1.036 148 129 138.5 CD6 −0.21 124 156 140 ATP6AP2 −0.959 150 131 140.5 CAST −0.787 147 135 141 CD97 −0.303 133 151 142 HSPA5 −0.086 126 159 142.5 CNP −0.387 142 146 144 IL27RA −0.643 152 139 145.5 FLT3L −0.648 155 138 146.5 CD47 −0.059 132 161 146.5 CD3D 0 127 166 146.5 ICOS −0.366 151 148 149.5 IL18RAP −0.643 160 140 150 CMTM6 −0.493 157 143 150 CD27 −0.079 140 160 150 NOTCH2 −0.472 159 144 151.5 CD226 −0.359 158 149 153.5 KLRK1 −0.232 153 154 153.5 ITGB1 −0.221 154 155 154.5 CD37 −0.011 149 163 156 CD5 −0.178 156 157 156.5 ICAM1 −0.238 162 152 157 IL16 −0.237 161 153 157 TNIP1 −0.139 164 158 161 CCND2 −0.006 163 164 163.5 CXCR3 −0.026 166 162 164 CD28 0 165 167 166 KLRD1 −0.002 168 165 166.5 IL4RA 0 167 168 167.5 CD84 0 169 169 169 PDE4B 0 170 170 170 IL18R1 0 171 171 171
TABLE-US-00019 TABLE 17 Ranked top 100 differentially expressed genes in cluster 10 as compared to all 15 CD8 T cell clusters adj.pval.cluster adj.pval.cluster adj.pval.cluster adj.pval.cluster adj.pval.cluster 1 2 3 4 5 CDC6 0 0 0 0 0 LIG1 0 0 0 0 0 MCM5 0 0 0 0 0 MCM7 0 0 0 0 0 RRM2 0 0 0 0 0 PRIM1 0 0 0 0 0 RAD51 0 0 0 0 0 MCM3 0 0 0 0 0 STMN1 0 0 0 0 0 CDC45 0 0 0 0 0 POLA1 0 0 0 0 0 DHFR 0 0 0 0 0 UHRF1 0 0 0 0 0 FEN1 0 0 0 0 0 NCAPG2 0 0 0 0 0 HELLS 0 0 0 0 0 RFC3 0 0 0 0 0 TK1 0 0 0 0 0 DTL 0 0 0 0 0 2810417H13RIK 0 0 0 0 0 MCM2 0 0 0 0 0 TIPIN 0 0 0 0 0 TCF19 0 0 0 0 0 RAD51AP1 0 0 0 0 0 CCNE1 0 0 0 0 0 ASF1B 0 0 0 0 0 MCM10 0 0 0 0 0 GINS2 0 0 0 0 0 POLD1 0 0 0 0 0 CHEK1 0 0 0 0 0 RRM1 0 0 0 0 0 POLE 0 0 0 0 0 GMNN 0 0 0 0 0 CLSPN 0 0 0 0 0 TOP2A 0 0 0 0 0 CENPH 0 0 0 0 0 CHAF1A 0 0 0 0 0 FIGNL1 0 0 0 0 0 MCM6 0 0 0 0 0 CDCA7 0 0 0 0 0 DUT 0 0 0 0 0 UNG 0 0 0 0 0 CHAF1B 0 0 0 0 0 CDK2 0 0 0 0 0 RFC4 0 0 0 0 0 ORC6 0 0 0 0 0 CHTF18 0 0 0 0 0 CCNE2 0 0 0 0 0 MCM4 0 0 0 0 0 PASK 0 0 0 0 0 BRCA1 0 0 0 0 0 RFC5 0 0 0 0 0 MYBL2 0 0 0 0 0 STIL 0 0 0 0 0 E2F7 0 0 0 0 0 SLBP 0 0 0 0 0 SYCE2 0 0 0 0 0 DNMT1 0 0 0 0 0 NCAPG 0 0 0 0 0 RAD54L 0 0 0 0 0 WDHD1 0 0 0 0 0 ZFP367 0 0 0 0 0 SMC2 0 0 0 0 0 PMF1 0 0 0 0 0 PCNA 0 0 0 0 0 PKMYT1 0 0 0 0 0 ATAD5 0 0 0 0 0 CDCA7L 0 0 0 0 0 E2F8 0 0 0 0 0 DCK 0 0 0 0 0 CDCA5 0 0 0 0 0 NCAPH 0 0 0 0 0 CDC7 0 0 0 0 0 HIST1H2AO 0 0 0 0 0 RNASEH2B 0 0 0 0 0 FANCI 0 0 0 0 0 4930422G04RIK 0 0 0 0 0 CDK1 0 0 0 0 0 CDCA2 0 0 0 0 0 PBK 0 0 0 0 0 TICRR 0 0 0 0 0 SIVA1 0 0 0 0 0 FBXO5 0 0 0 0 0 PPIL1 0 0 0 0 0 NCAPD2 0 0 0 0 0 PTMA 0 0 0 0 0 TIMELESS 0 0 0 0 0 WDR76 0 0 0 0 0 DSCC1 0 0 0 0 0 MAD2L1 0 0 0 0 0 KNTC1 0 0 0 0 0 POLD2 0 0 0 0 0 TYMS 0 0 0 0 0 DNAJC9 0 0 0 0 0 AURKB 0 0 0 0 0 NUP62 0 0 0 0 0 HIST2H3B 0 0 0 0 0 NUSAP1 0 0 0 0 0 RFWD3 0 0 0 0 0 adj.pval.cluster adj.pval.cluster adj.pval.cluster adj.pval.cluster adj.pval.cluster 6 7 8 9 10 CDC6 0 −0.375 0 −5.963 −80.932 LIG1 0 −2.952 0 −29.581 −75.296 MCM5 0 −3.082 0 −28.644 −75.296 MCM7 0 −2.487 0 −23.605 −72.59 RRM2 0 −0.044 0 −66.459 −72.59 PRIM1 0 −1.408 0 −19.24 −68.79 RAD51 0 −0.085 0 −52.488 −68.583 MCM3 0 −5.735 0 −17.252 −68.528 STMN1 0 −0.635 0 −98.221 −68.25 CDC45 0 −0.079 0 −47.1 −67.854 POLA1 0 −0.896 0 −15.48 −65.955 DHFR 0 −0.791 0 −9.228 −64.125 UHRF1 0 −3.683 0 −35.788 −63.748 FEN1 0 −0.895 0 −34.054 −63.6 NCAPG2 0 −0.015 0 −58.374 −63.475 HELLS 0 −4.143 0 −15.141 −63.122 RFC3 0 −0.713 −0.208 −16.602 −62.998 TK1 0 −3.788 −0.031 −58.393 −62.819 DTL 0 −5.276 0 −10.026 −62.775 2810417H13RIK 0 −0.877 0 −94.353 −61.938 MCM2 0 −4.813 0 −7.004 −61.904 TIPIN 0 −4.244 −0.074 −20.86 −60.518 TCF19 0 0 0 −24.957 −59.212 RAD51AP1 0 0 0 −32.834 −57.189 CCNE1 0 −1.07 0 −2.819 −56.691 ASF1B 0 −0.123 0 −73.726 −56.208 MCM10 0 −0.009 0 −22.236 −55.388 GINS2 0 −0.865 0 −18.673 −53.678 POLD1 0 −0.966 0 −21.264 −53.491 CHEK1 0 −0.307 0 −6.859 −53.253 RRM1 0 −3.401 0 −47.743 −52.264 POLE 0 −1.436 0 −17.435 −52.102 GMNN 0 −0.53 0 −41.762 −51.69 CLSPN 0 0 0 −33.627 −49.936 TOP2A 0 −1.539 −0.04 −69.996 −49.278 CENPH 0 −0.171 0 −52.651 −49.136 CHAF1A 0 −1.454 0 −20.331 −48.964 FIGNL1 0 −0.599 0 −42.968 −48.643 MCM6 0 −7.123 −0.004 −9.263 −48.616 CDCA7 0 −5.71 0 −0.193 −47.71 DUT 0 −17.989 −0.155 −22.209 −47.471 UNG 0 −3.748 −0.435 0 −47.352 CHAF1B 0 −1.148 0 −4.203 −45.683 CDK2 0 −0.863 −0.068 −12.311 −45.448 RFC4 0 −1.406 0 −33.508 −44.901 ORC6 0 −3.025 0 −16.032 −44.275 CHTF18 0 −0.003 0 −29.359 −44.221 CCNE2 0 −1.961 −0.069 −3.802 −43.691 MCM4 0 −2.143 0 −14.929 −43.425 PASK 0 0 0 −6.489 −43.132 BRCA1 0 0 0 −16.998 −42.986 RFC5 0 −1.127 −0.067 −46.278 −42.449 MYBL2 0 −0.017 0 −7.383 −41.707 STIL 0 0 0 −36.048 −41.461 E2F7 0 0 0 −25.101 −40.974 SLBP 0 −2.511 0 −8.783 −40.456 SYCE2 0 −1.447 0 −3.05 −40.147 DNMT1 0 −2.951 0 −15.63 −40.123 NCAPG 0 0 0 −99.319 −40.113 RAD54L 0 −0.05 0 −26.147 −40.015 WDHD1 0 −2.686 0 −5.165 −39.503 ZFP367 0 −0.228 −0.15 −12.738 −39.379 SMC2 0 −0.203 0 −68.225 −39.346 PMF1 0 −2.377 0 −55.018 −39.271 PCNA 0 −10.539 0 −11.735 −39.204 PKMYT1 0 0 0 −25.968 −38.888 ATAD5 0 −0.175 −0.094 −6.27 −38.839 CDCA7L 0 −4.42 −0.146 −3.625 −38.797 E2F8 0 0 0 −25.071 −38.663 DCK 0 −0.666 0 −9.393 −38.53 CDCA5 0 0 0 −75.623 −38.383 NCAPH 0 −0.439 0 −72.574 −38.076 CDC7 0 −0.777 0 −24.66 −37.902 HIST1H2AO 0 −0.199 0 −77.944 −37.764 RNASEH2B 0 −8.308 0 −30.417 −37.634 FANCI 0 0 0 −12.873 −37.117 4930422G04RIK 0 −0.342 −0.121 −3.941 −36.923 CDK1 0 0 0 −89.58 −36.898 CDCA2 0 −0.02 0 −82.191 −36.305 PBK 0 0 0 −60.6 −36.206 TICRR 0 0 0 −25.958 −35.716 SIVA1 0 −16.842 −0.379 −11.903 −35.654 FBXO5 0 0 0 −50.949 −35.498 PPIL1 0 −6.372 −0.284 −19.117 −35.338 NCAPD2 0 −0.408 0 −90.985 −35.029 PTMA 0 −0.646 0 −42.495 −34.989 TIMELESS 0 −0.681 0 −11.07 −34.828 WDR76 0 −1.801 0 −11.48 −34.787 DSCC1 0 −0.433 0 −7.576 −34.079 MAD2L1 0 −0.454 0 −94.515 −33.55 KNTC1 0 0 0 −22.085 −33.52 POLD2 0 −2.099 0 −9.613 −33.433 TYMS 0 −2.408 −0.016 −16.524 −33.365 DNAJC9 −2.61 −0.078 0 −13.66 −33.305 AURKB 0 0 0 −115.142 −33.175 NUP62 0 −2.183 −0.036 −24.712 −33.144 HIST2H3B 0 0 0 −60.755 −33.065 NUSAP1 0 0 0 −129.805 −32.937 RFWD3 0 −1.287 −0.255 −17.015 −32.598 adj.pval.cluster adj.pval.cluster adj.pval.cluster adj.pval.cluster adj.pval.cluster 11 12 13 14 15 CDC6 −0.001 0 0 0 −0.692 LIG1 −0.001 0 0 −0.587 −3.286 MCM5 −0.001 −0.056 0 0 −3.117 MCM7 −0.001 0 0 0 −3.339 RRM2 −0.001 0 0 0 −3.577 PRIM1 −0.001 −0.142 0 0 −1.436 RAD51 −0.001 0 0 0 −4.518 MCM3 −0.001 0 0 0 −1.39 STMN1 −0.001 0 0 0 −8.858 CDC45 −0.001 0 0 0 −3.684 POLA1 −0.001 −0.045 0 0 −1.104 DHFR −0.001 −0.042 0 0 −0.949 UHRF1 −0.001 0 0 0 −5.496 FEN1 −0.001 −0.303 0 0 −2.709 NCAPG2 −0.001 0 0 0 −2.562 HELLS −0.001 0 0 0 −0.671 RFC3 −0.001 −0.006 0 0 −1.728 TK1 −0.001 0 0 0 −5.968 DTL −0.001 −0.031 0 0 −0.278 2810417H13RIK −0.001 0 0 0 −7.68 MCM2 −0.001 −0.208 0 0 −0.528 TIPIN −0.001 0 0 0 −1.756 TCF19 −0.001 0 0 0 −2.241 RAD51AP1 −0.001 0 0 0 −0.739 CCNE1 −0.001 0 0 0 −1.985 ASF1B −0.001 0 0 −4.035 −3.737 MCM10 −0.001 0 0 0 −2.856 GINS2 −0.001 0 0 0 −1.156 POLD1 −0.001 −0.052 0 0 −2.884 CHEK1 −0.001 −0.674 0 0 −2.143 RRM1 −0.001 0 0 −1.259 −4.578 POLE −0.001 0 0 0 −1.845 GMNN −0.001 −0.138 0 0 −1.572 CLSPN −0.001 0 0 0 −0.956 TOP2A −0.001 0 0 0 −3.78 CENPH −0.001 0 0 0 −2.809 CHAF1A −0.001 −0.001 0 0 −1.211 FIGNL1 −0.001 0 0 0 −4.277 MCM6 −0.001 −1.281 0 −0.497 −1.868 CDCA7 −0.001 −4.091 0 0 −1.131 DUT −0.001 −2.552 0 0 −1.356 UNG −0.001 −0.293 0 −0.301 −0.182 CHAF1B −0.045 0 0 0 −0.552 CDK2 −0.001 −0.09 0 −0.088 −1.209 RFC4 −0.001 0 0 0 −5.641 ORC6 −0.001 −0.008 0 0 −1.409 CHTF18 −0.001 0 0 0 −5.619 CCNE2 −0.001 0 0 0 −0.378 MCM4 −0.001 0 0 −0.35 −0.86 PASK −0.001 0 0 0 −0.148 BRCA1 −0.001 −0.006 0 0 −0.579 RFC5 −0.001 0 0 0 −2.609 MYBL2 −0.001 0 0 0 −0.636 STIL −0.001 0 0 0 −5.602 E2F7 −0.001 0 0 0 −0.125 SLBP −0.001 0 0 0 −1.242 SYCE2 −0.001 −0.051 0 0 −0.962 DNMT1 −0.001 0 0 −2.411 −0.78 NCAPG −0.001 0 0 0 −5.526 RAD54L −0.001 0 0 0 −4.47 WDHD1 −0.001 −0.302 0 0 −0.76 ZFP367 −0.001 0 0 0 −1.099 SMC2 −0.001 0 0 0 −3.648 PMF1 −0.001 0 0 −3.218 −4.469 PCNA −0.001 −0.357 0 0 −0.536 PKMYT1 −0.001 0 0 0 −2.823 ATAD5 −0.001 0 0 0 −1.576 CDCA7L −0.001 −0.391 0 0 −0.51 E2F8 −0.001 0 0 0 −1.624 DCK −0.001 0 0 −4.515 −0.928 CDCA5 −0.001 0 0 0 −3.513 NCAPH −0.001 −0.609 0 0 −2.757 CDC7 −0.001 −0.094 0 0 −1.439 HIST1H2AO −0.001 0 −0.147 0 −5.609 RNASEH2B −0.054 0 0 0 −1.948 FANCI −0.001 0 0 0 −0.44 4930422G04RIK −0.001 −0.04 0 0 −0.48 CDK1 −0.001 0 0 0 −5.968 CDCA2 −0.001 0 0 0 −5.418 PBK −0.001 0 0 0 −4.177 TICRR −0.001 0 0 0 −1.981 SIVA1 −0.001 −0.768 0 0 −3.203 FBXO5 −0.001 0 0 0 −2.173 PPIL1 −0.001 −0.195 0 0 −2.917 NCAPD2 0 0 0 0 −10.266 PTMA −0.269 −8.647 0 0 −1.945 TIMELESS −0.001 −0.25 0 0 −0.341 WDR76 0 0 0 0 −1.739 DSCC1 −0.001 0 0 0 −3.431 MAD2L1 −0.001 0 0 0 −7.613 KNTC1 −0.001 0 0 0 −2.562 POLD2 −0.125 −1.255 0 0 −0.872 TYMS −0.001 0 0 0 −2.73 DNAJC9 −0.001 0 0 −0.716 −1.62 AURKB −0.001 0 0 0 −7.378 NUP62 −0.001 −0.297 0 −3.122 −2.342 HIST2H3B −0.001 0 0 0 −5.492 NUSAP1 −0.001 0 0 0 −7.459 RFWD3 −0.001 0 0 −1.951 −3.148
TABLE-US-00020 TABLE 18 Cluster 7 Specific Gene Signature CD8_cluster7 Genes 1-25 Genes 26-50 Genes 51-75 Genes 76-100 Genes 101-124 PRF1 ADAMTS14 GZMD SLC16A3 STK24 GLDC RGS8 SERPINE2 GPR65 FKBP1A LAT2 CCNG1 SLC25A4 FCRL6 DSCAM ADAM8 CDK6 PADI2 GM14295 STK39 TNFRSF9 GPR56 PPP1R3B ITGB1BP1 ISY1 HILPDA GPD2 MYO10 SRGAP3 MRC2 TMPRSS6 PLAC8 SLC52A3 FOXRED2 NUDT18 CCRL2 HAVCR2 ASB2 NAGPA SIL1 ID2 GZMF LRRK1 RCN1 ENO1 NABP1 CBLB AFG3L2 GBP10 LPIN2 LILRB4 EHD1 PTK2B SLA2 GP49A 2900026A02RIK FILIP1 ACOXL RHOC ACOT7 AA467197 SLC2A3 NEK6 STAT3 RGS1 SERPINB9 GZME NEDD9 SYNGR3 SLC27A1 UBASH3B BCL2L11 ANXA2 PLXND1 CST7 CXCR6 INSRR DGAT1 SLC24A1 TIPRL PCYT1A PLEK IRAK2 ERO1L CTSD IL2RB RGS2 MT2 RLN3 CIAPIN1 CCL3 GZMC THEMIS2 EPDR1 PTPN5 LITAF GEM RGS16 IRF8 IL10RA EPAS1 GZMB PGLYRP1 MT1 GSTO1 C1QTNF6 SDCBP2 FXYD5 TMEM135 GBP6 ALDOA ITGAV SLC35D3 SLCO2A1 SERINC1 S100A11 PKM CCL4 TOMM40L RAB19 SLC37A2 SH2D2A DGKH D16ERTD472E
TABLE-US-00021 TABLE 19 Cluster 8 Specific Gene Signature CD8_cluster8 Genes 1-33 Genes 33-66 Genes 67-99 Genes 100-132 Genes 133-165 Genes 166-198 XCL1 REL LANCL1 CPNE8 EEF1B2 CSRNP1 CD83 DUSP1 ETV6 SPRY1 SH3BGRL KLRK1 CCR7 SLC25A42 PLK2 FAS RNF40 NFKBIZ LAD1 SAT1 MRPS6 TRAF1 AHCYL2 B4GALNT1 CRTAM FAM46A PER1 CALCOCO1 NMRK1 PRKCA TNFSF8 RAF1 ZFP467 ARC ASNSD1 SYNJ2 CD81 LTA KLRB1F RPL34-PS1 NEK7 CDON ITGB1 TESPA1 2610301B20RIK ICOS PTPRS NPTN PLXDC2 GPM6B IMMP2L CPNE3 PDCD1LG2 IGSF3 BACE2 SESN3 IER3 SH3RF1 FOSB ATP6V1G2 TNFSF11 GM12505 PRNP RNF19A DHRS3 CCR8 RAMP3 CD9 CCL1 FBXO11 NR4A3 PXMP2 BCL6 ABCA3 TGFB1 ITPR1 SLC17A6 PAIP2 GRAMD1B B3GNT2 PENK SPRY2 PARP3 TLCD2 CD74 REEP3 TSPAN32 HIF1A ANKRD46 CD68 DAPL1 GUCY1A3 LRIG1 AI836003 TNFRSF18 PKP3 ARAP2 1700019D03RIK FAM178B AKAP8L SDF4 NDUFA6 TBC1D4 IL2RA AXL SYT11 GABARAPL1 GTF2IRD1 SLC2A6 BTLA MS4A4B PACSIN1 PPAP2A DGKZ SYNPO SSH1 TNFSF4 MPC1 SDC4 GALM ZFP36L1 ASAP1 TIAM1 FAM195B CD70 CXCR5 BACH2 SIGIRR GM12942 DUSP4 ALCAM HGSNAT SLAMF6 SLA BHLHE40 ARL3 JAK2 TNFRSF4 ZC3H12D JUNB LRRC8D TMEM173 RELB RPL41 CXXC5 CTSW SCYL2 TGIF1 NRN1 FAM162A 2310001H17RIK FAM53B RASGEF1A NT5E EPHX1 H2-OA MS4A4C MGAT5 GYPC ST6GAL1 SPOCK2 RPL7 RAB37 GALNT9 RORA NFAT5 CTSZ VWA5A SAMD3 HEG1 NFKB1 GADD45B ORAI2 ITM2A JUN DCLK1 KLRI2 RIPK2 CD200 IER5 TNFSF14 PTPRK 2010015L04RIK FAM168A GM10548 0610011F06RIK CD160 EGR2 PIKFYVE B9D2 RCCD1 TG NFKBIA CAR2 CD82 TMEM243 EFHA2 GDI2
TABLE-US-00022 TABLE 20 Cluster 9/10 Specific Gene Signature CD8_cluster9/10 Genes 1-75 Genes 76-150 Genes 151-225 Genes 226-300 Genes 301-375 Genes 376-451 2810417H13RIK CLSPN NCAPH2 WHSC1 BRIP1 EIF1AD STMN1 RFC5 MCM4 POLE PFN1 TMEM97 HMGB2 FEN1 POLA1 RFC2 KIFC1 CENPO BIRC5 KIF23 HAUS4 FANCA CEP89 SYCE2 CCNA2 FBXO5 UBE2S TIMELESS SF3B5 PIH1D1 SPC24 SMC2 CCNF PKMYT1 RFWD3 HMGN5 CDCA8 1190002F15RIK RFC4 RAD21 ARL6IP1 CDCA4 HIST1H2AO TCF19 H2AFX 2700099C18RIK TXN1 1600002H07RIK TK1 PTMA AURKA LRR1 ANAPC5 MMS22L TPX2 TUBB5 PRIM1 CRIP1 AGFG2 HAT1 HMGN2 MELK PLK4 TCEB2 CENPL GM12504 MKI67 KNSTRN RFC3 CMTM7 TUBE1 4930422G04RIK CDK1 CENPE RPA2 1500009L16RIK LNP WDR90 RRM2 GMNN CDC25B CALM3 U2AF1 IPO9 NUSAP1 MXD3 PPIL1 NSL1 BC055324 PHF11B ASF1B PPIA CHTF18 PRR11 TUBA1A DDB2 KIF20A KIF4 SLBP PASK POLA2 ERCC6L CCNB2 RAN ANP32E SMC4 FDFT1 NDE1 CDC20 PARPBP MIS18A KIF20B NUCKS1 DNAAF2 CKS1B ARHGAP11A KIF18A ARSB PUF60 HIST1H1C NUF2 TIPIN TUBA1C HAUS5 TRP53I13 EHD4 KIF11 LMNB1 POC1A LSM5 TMEM107 RANBP1 MAD2L1 SHCBP1 SUV39H1 SNRPD1 DDX39 NT5C3L NEK2 GZMK ZWILCH RCBTB2 HAUS3 MCM8 NCAPD2 HIST2H3B BRCA1 ORC6 SLC43A3 HNRNPAB TOP2A SKA2 RAD54L RPA1 HIST1H2BJ GINS4 UBE2C HIST2H3C2 PCNA TERF1 RQCD1 PLEKHF1 NCAPG PBK YWHAH HIST1H1B ZBTBD6 MUTYH TACC3 ESPL1 SGOL2 PPP1CA BLM RBBP4 TUBA1B RAD54B CDC6 GLTP CDK4 POLD2 CDCA3 CENPW CENPK MCM6 MED30 CALM2 H2AFZ HMMR CEP57 RANGAP1 NUP107 CENPC1 FAM64A FOXM1 POLD1 BUB3 GIMAP7 SLFN3 MCM7 UHRF1 ANLN DBI EME1 RNF5 MCM5 BANF1 CENPI RNF26 UCHL5 NUTF2-PS1 HMGB1 BC030867 CENPM PHGDH CENPT CCDC18 CDCA2 ASPM CENPP TRAIP CKAP5 EXOSC7 PLK1 HELLS FXN ARHGAP33 GPAA1 2700029M09RIK KIF22 ANKLE1 WDR62 ULBP1 ATP5J E2F1 BUB1 CENPA DEK HIST1H4I EXOSC8 TFDP1 CKAP2L RNASEH2B SNRPB 6430706D22RIK HN1 NUP205 RAD51 STIL GPSM2 BARD1 RECQL4 HIST1H2BC PMF1 ECT2 HMGB3 ZFP367 CDK2 SHC1 PRC1 MIS18BP1 CBX3 EMP3 HIST1H2BG PARD6A CDCA5 CDC25C FANCI GINS1 A730008H23RIK RAD9A CDC45 FIGNL1 LSM2 OAZ1-PS HIST1H2AG HNRNPD AURKB C330027C09RIK FKBP2 SPDL1 MTBP SMC3 RACGAP1 PIF1 LSM3 DTL NDUFA4 1700097N02RIK SPC25 DUT 1810037I17RIK PRIM2 CDCA7L WDHD1 CKAP2 TTK NUP62 CCNE1 PSMB9 PRDX1 SAPCD2 E2F8 KNTC1 DCK NELFE ENKD1 KIF2C DNAJC9 TOPBP1 MASTL GINS3 TAP1 SKA1 TROAP RPA3 NASP SLC29A1 CEP70 BUB1B CIT TRIP13 MIS12 VIM FANCG NCAPG2 ESCO2 MCM2 FAM111A MB21D1 CD48 NCAPH 4930579G24RIK TMSB4X KIFC5B APITD1 STUB1 TUBB4B RAD51AP1 TICRR PSAT1 TSEN15 HIST1H3B DEPDC1A CASC5 CHAF1A LRRC40 NDUFB7 TAF12 LIG1 CLIC1 POLQ SMTN MAPRE1 TUBG1 DLGAP5 E2F7 CBX5 CCNE2 TMPO DSCC1 TYMS NRM 4930427A07RIK ATP5O GAS2L3 SRSF10 SPAG5 2700094K13RIK FANCD2 H2-T22 NLRP1A SUZ12 NEIL3 CENPN HIST1H2AB KIF14 SEC11C MNS1 CENPH INCENP UBE2T CCDC34 SLMO2 PAGR1A CEP55 GEN1 DHFR MAZ HIST1H2AE HELB GTSE1 ARHGAP19 GINS2 SEPHS1 ATAD5 0610010K14RIK CKS2 H2AFV RBL1 HIST1H2AI CASP7 POLD3 CDKN3 KPNA2 HJURP WDR76 UEVLD ELOF1 SKA3 MCM10 DNMT1 HIST1H2AK CEP72 NFYB RRM1 DSN1 NCAPD3 HIST1H4D NGFRAP1 CSE1L NDC80 REEP4 4632434I11RIK ARHGEF39 TINF2 GM5141 CENPF CMC2 E030024N20RIK LBR MYBL2 CARHSP1 MCM3 CDC7 CHEK1 PSMC3IP EFCAB11 OAT CCNB1 FAM83D ERH BORA GLRX ERI2 SGOL1 DIAP3 CTC1 RBBP7 SH3BGRL3 PLP2 PSRC1
Example 2—Identification of Novel Tumor Infiltrating CD4+ T Cells Populations
[0612] CD4 cells were analyzed from the mouse tumor model at time points as discussed in Example 1 herein. CD4 T cells (both Effector and Regulatory) were obtained by sorting for CD4+CD45+ cells. NK cells, dendritic cells, and macrophages were obtained by sorting for CD4-CD8-CD45+ cells. CD45.sup.− cells included fibroblasts and tumor cells.
[0613]
Example 3—Identification of Cell-Cell Interactions in CD8.SUP.+ and CD4+ T Cell Populations
[0614]
[0615]
[0616]
[0617]
[0618]
[0619]
[0620] In certain embodiments, cluster 8 CD8 T cells are primed for activation.
Example 4—Identification of CD8.SUP.+ T Cells Populations Using 10× Genomics Platform
[0621] Applicants performed single cell RNA sequencing on the B16 mouse model as described in Example 1 using the 10× genomics platform (10× Genomics, Inc., Pleasanton, Calif., www.10xgenomics.com/solutions/single-cell/). Applicants validated the previous results in that the 10× time course data revealed the same populations as in the CD8 plates, including cluster 7.
Example 5—Clonal Expansion in CD8 T Cell Clusters
[0622] Applicants measured clonal expansion in CD8 T cell clusters (B16). Applicants identified clonal identity of the CD8 T cells at single cell resolution. In certain embodiments, alpha and beta TCR chains were called and predicted to be functional using TRACER (see, e.g., Stubbington et al, (2016) T cell fate and clonality inference from single-cell transcriptomes. Nature Methods, 13 329-332). Applicants defined a clone, such that two cells share a clone if they have a reconstructed alpha and beta chain that are identical. This definition is stricter than the TRACER default.
[0623] Overlap of clones identified were detected across plates used in single cell RNA sequencing. There were no overlaps across plates from different mice (
[0624] Applicants used a OVA+SIY+lung cancer mouse model to induce tumors in mice. In this model SIY is a low affinity antigen and OVA is a high affinity antigen. In certain embodiments, a low affinity antigen binds a TCR weakly (>10 μM in a range of about 1-100 μM) or binds MHC weakly as compared to a high affinity antigen. In certain embodiments, affinity is defined as the probability of initial TCR:pMHC bond formation (see, e.g., Martinez and Evavold, 2015, Lower Affinity T Cells are Critical Components and Active Participants of the Immune Response, Front Immunol. 2015; 6: 468). Low affinity T cells efficiently propagate the signaling cascade as low-affinity T cells do expand, and differentiate during the immune response (see, e.g., Martinez and Evavold, 2015).
[0625] Applicants collected CD8 and CD4 T cells across a time course (5 weeks, 8 weeks, 12 weeks, and 20 weeks). The cells were tetramer sorted for SIY binding cells and OVA (OT1) binding cells and genes differentially expressed across the cells were annotated (
Example 6—Differentially Expressed Genes Across Time Points
[0626] Applicants clustered genes differentially expressed across time points to determine clusters of genes that change or are co-regulated over time (
[0627] Applicants observed connections between the time-change clusters and infomap clusters (B16 CD8 T cells) (
[0628] The genes that overlap infomap cluster 7 and logit 8 include GPR56, PDCD1, LAG3, HAVCR2, ENTPD1, 1700017B05RIK, CHN2, 2900026A02RIK, FGL2, SERPINA3H, OSBPL3, S100A4, CCL3, TNFRSF9, UBASH3B, CD244, RGS8, BCL2A1D, CCL4, CIAPIN1, GP49A, CCRL2, IRF8, GRINA, C1QTNF6, CD200R4, FILIP1, THEMIS2, SERPINA3F, LRRK1, ARNT2, MXI1, DAPK2, TWSG1, ADAM8, TRPS1, LAT2, SDCBP2, SLC37A2, MT2, ADAMTS14, GBP10, EPDR1 and DUT
[0629] The genes that overlap infomap cluster 7 and logit 11 include RGS16, GZMB, SERPINA3G, CXCR6, LITAF, SERPINA3I, TOX, PRF1, EHD1, LILRB4, PLEK, ITGAV, CREM, CDK6, NR4A2, UHRF2, GBP6, IRAK2, PTK2B, OXSR1 and ITGB1BP1.
[0630] The genes that overlap infomap cluster 7 and logit 10 include TIGIT, DGAT1, PLAC8, BHLHE40, GM5069, SAMSN1, RGS1, DENND4A and SIK1.
[0631] The genes that overlap infomap cluster 8 and logit 9 include RAMP3, NRGN, SLC16A11, MYO1E, FOSB, IL18RAP, OLFR1033, IL2RA, BCL2A1B, CD83, FAM46A, CD74, ENPP2, LAD1, A1836003, DUSP4, ARL14EP, CD81, XDH, KIT, TNFRSF4, RORA, ST6GAL1, ATP2B2, CAPG and PLXDC2.
[0632] Various modifications and variations of the described methods, pharmaceutical compositions, and kits of the invention will be apparent to those skilled in the art without departing from the scope and spirit of the invention. Although the invention has been described in connection with specific embodiments, it will be understood that it is capable of further modifications and that the invention as claimed should not be unduly limited to such specific embodiments. Indeed, various modifications of the described modes for carrying out the invention that are obvious to those skilled in the art are intended to be within the scope of the invention. This application is intended to cover any variations, uses, or adaptations of the invention following, in general, the principles of the invention and including such departures from the present disclosure come within known customary practice within the art to which the invention pertains and may be applied to the essential features herein before set forth.