ANTI-IL-17 ANTIBODY/TNFR ECD FUSION PROTEIN AND USE THEREOF

20210261654 · 2021-08-26

    Inventors

    Cpc classification

    International classification

    Abstract

    The invention relates to the field of medical biotechnology. Specifically, the present invention relates to a fusion protein containing an anti-interleukin-17 antibody and a tumor necrosis factor receptor extracellular region, a polynucleotide encoding the fusion protein, a vector comprising the polynucleotide, a host cell comprising the polynucleotide or the vector, and the use of the fusion protein for the treatment, prevention, and/or diagnosis of a related disease in an individual.

    Claims

    1. A fusion protein of an anti-IL-17 antibody and TNFR, comprising (i) an antigen-binding fragment derived from an anti-IL-17 antibody; (ii) an immunoglobulin constant region domain; and (iii) an extracellular region of TNFR.

    2. The fusion protein according to claim 1, wherein: (1) said (i) is an antigen-binding fragment derived from a human anti-IL-17 antibody; preferably comprising one of the following sequences (a)-(d): (a) one to three of the three heavy chain CDRs and one to three of the three light chain CDRs comprised in the paired heavy chain variable region sequence/light chain variable region sequence selected from the group consisting of SEQ ID NOs: 1/2, 3/4, 5/6, 7/8, 9/10, 11/12, 13/14, and 15/16; or one to three of the three heavy chain CDRs and one to three of the three light chain CDRs comprised in the paired heavy chain variable region sequence/light chain variable region sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or higher sequence identity with the paired heavy chain variable region sequence/light chain variable region sequence selected from the group consisting of SEQ ID NOs: 1/2, 3/4, 5/6, 7/8, 9/10, 11/12, 13/14, and 15/16, or one to three of the three heavy chain CDRs and one to three of the three light chain CDRs comprised in the paired heavy chain variable region sequence/light chain variable region sequence having one or more amino acid substitutions, deletions or insertions of the paired heavy chain variable region sequence/light chain variable region sequence selected from the group consisting of SEQ ID NOs: 1/2, 3/4, 5/6, 7/8, 9/10, 11/12, 13/14, and 15/16; (b) a paired heavy chain variable region sequence/light chain variable region sequence selected from the group consisting of SEQ ID NOs: 1/2, 3/4, 5/6, 7/8, 9/10, 11/12, 13/14, and 15/16; or a paired heavy chain variable region sequence/light chain variable region sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or higher sequence identity with the paired heavy chain variable region sequence/light chain variable region sequence selected from the group consisting of SEQ ID NOs: 1/2, 3/4, 5/6, 7/8, 9/10, 11/12, 13/14, and 15/16; or a paired heavy chain variable region sequence/light chain variable region sequence having one or more amino acid substitutions, deletions or insertions of the paired heavy chain variable region sequence/light chain variable region sequence selected from the group consisting of SEQ ID NOs: 1/2, 3/4, 5/6, 7/8, 9/10, 11/12, 13/14, and 15/16; (c) one to three of the three heavy chain CDRs and one to three of the three light chain CDRs comprised in the paired first subunit/second subunit sequences selected from the group consisting of SEQ ID NOs: 60/62, 64/66, 68/70, and 74/72; or one to three of the three heavy chain CDRs and one to three of the three light chain CDRs comprised in the paired first subunit/second subunit sequences having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or higher sequence identity with the paired first subunit/second subunit sequences selected from the group consisting of SEQ ID NOs: 60/62, 64/66, 68/70, and 74/72; or one to three of the three heavy chain CDRs and one to three of the three light chain CDRs comprised in the paired first subunit/second subunit sequences having one or more amino acid substitutions, deletions or insertions of the paired first subunit/second subunit sequences selected from the group consisting of SEQ ID NOs: 60/62, 64/66, 68/70, and 74/72; and (d) a paired heavy chain variable region sequence/light chain variable region sequence comprised in the paired first subunit/second subunit sequences selected from the group consisting of SEQ ID NOs: 60/62, 64/66, 68/70, and 74/72; or a paired heavy chain variable region sequence/light chain variable region sequence comprised in the paired first subunit/second subunit sequences having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or higher sequence identity with the paired first subunit/second subunit sequences selected from the group consisting of SEQ ID NOs: 60/62, 64/66, 68/70, and 74/72; or a paired heavy chain variable region sequence/light chain variable region sequence comprised in the paired first subunit/second subunit sequences having one or more amino acid substitutions, deletions or insertions of the paired first subunit/second subunit sequences selected from the group consisting of SEQ ID NOs: 60/62, 64/66, 68/70, and 74/72; (2) said (ii) is a human immunoglobulin constant region domain; preferably comprising or consisting of one of the following sequences: a constant region domain of the amino acid sequence shown in SEQ ID NO: 19, 20 or 21, or an Fc domain of the amino acid sequence shown in SEQ ID NO: 75, 76 or 77, or a constant region domain having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or higher sequence identity with the constant region domain of the amino acid sequence shown in SEQ ID NO: 19, 20 or 21, or an Fc domain having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or higher sequence identity with the Fc domain of the amino acid sequence shown in SEQ ID NO: 75, 76 or 77, or a constant region domain having one or more amino acid substitutions, deletions or insertions in the constant region domains of the amino acid sequence shown in SEQ ID NO: 19, 20 or 21, or an Fc domain having one or more amino acid substitutions, deletions or insertions in the Fc domain of the amino acid sequence shown in SEQ ID NO: 75, 76 or 77; (3) said (iii) is the extracellular region of a human TNFR; preferably comprising or consisting of one of the following sequences: an amino acid sequence shown in SEQ ID NO: 22, 23, 24 or 25; or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or higher identity with the amino acid sequence shown in SEQ ID NO: 22, 23, 24 or 25, or an amino acid sequence having one or more amino acid substitutions, deletions or insertions in the amino acid sequence shown in SEQ ID NO: 22, 23, 24, or 25.

    3. The fusion protein according to claim 2, wherein the at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or higher identity is at least 95%, 96%, 97%, 98%, 99% or higher identity.

    4. The fusion protein according to claim 2, wherein the one or more amino acid substitutions, deletions or insertions are at most 5 substitutions, deletions or insertions, preferably at most 5 conservative substitutions.

    5. The fusion protein according to claim 2, wherein the (i) is Fab, Fab′, F(ab).sub.2, F(ab′).sub.2, Fv, single-chain Fv derived from a human anti-IL-17 antibody, or the (ii) is a heavy chain constant region domain of a human IgG1, IgG2, or IgG4; or the (iii) comprises a human TNFR1 extracellular region or a human TNFR2 extracellular region, more preferably comprises a full length or a part of a human TNFR2 extracellular region; most preferably comprises a fragment of CRD1-CRD2-CRD3-CRD4 of a human TNFR2 extracellular region.

    6. The fusion protein according to claim 1, wherein the anti-IL-17 antibody is an anti-human IL-17 antibody, preferably an anti-human IL-17A antibody; the light chain type of the antibody is κ type or λ type, preferably κ type; the anti-IL-17 antibody is preferably an IgG class antibody, more preferably IgG.sub.1 subclass, IgG.sub.2 subclass, IgG.sub.4 subclass antibody.

    7. The fusion protein according to claim 1, wherein the fusion protein comprises a linker peptide between (i), (ii) and/or (iii); the linker peptide preferably comprises one or more amino acids; more preferably at least 5 amino acids; most preferably the linker peptide comprises one selected from the group consisting of SEQ ID NOs: 30-58.

    8. The fusion protein according to claim 7, wherein the fusion protein is operatively linked from the N-terminus to the C-terminus: (1) in the order of (i), (ii) and (iii), preferably, the C-terminus of the heavy chain part in (i) is operatively linked to the N-terminus of (ii); or the C-terminus of the light chain part in (i) is operatively linked to the N-terminus of (ii); or (2) in the order of (iii), (ii), and (i), preferably, the C-terminus of (ii) is operatively linked to N-terminus of each of the two heavy chain parts of (iii); or the C-terminus of (ii) is operatively linked to N-terminus of each of the two light chain parts of (iii).

    9. The fusion protein according to claim 1, wherein the fusion protein comprises or consists of one of the following sequences: (1) the first subunit of SEQ ID NO: 60 and the second subunit of SEQ ID NO: 62; (2) the first subunit of SEQ ID NO: 64 and the second subunit of SEQ ID NO: 66; (3) the first subunit of SEQ ID NO: 68 and the second subunit of SEQ ID NO: 70; and (4) the first subunit of SEQ ID NO: 74 and the second subunit of SEQ ID NO: 72.

    10. A polynucleotide encoding the fusion protein according to claim 1.

    11. A vector comprising the polynucleotide according to claim 10, wherein the vector is preferably an expression vector, more preferably a glutamine synthetase expression vector with dual expression cassettes.

    12. A host cell comprising the polynucleotide according to claim 10, preferably, the host cell is a CHO, HEK293 or NSO cell.

    13. A method for producing the fusion protein according to claim 1, comprising the steps of (i) cultivating a host cell comprising a polynucleotide encoding the fusion protein according to claim 1 under conditions suitable for expressing the fusion protein, and (ii) recovering the fusion protein.

    14. A pharmaceutical composition comprising the fusion protein according to claim 1 and a pharmaceutically acceptable carrier.

    15. A method for treating or preventing diseases related to the activities of IL-17 and TNF-α in an individual, comprising administering an effective amount of the fusion protein according to claim 1 to an individual in need thereof, wherein the disease is preferably an autoimmune disease, more preferably rheumatoid arthritis, ankylosing spondylitis, psoriasis, and ulcerative colitis; most preferably psoriasis; wherein the individual is a mammal, more preferably a human.

    16. A polynucleotide encoding the fusion protein according to claim 2.

    17. A host cell comprising the polynucleotide according to claim 16, preferably, the host cell is a CHO, HEK293 or NSO cell.

    18. A host cell comprising the vector according to claim 11, preferably, the host cell is a CHO, HEK293 or NSO cell.

    19. A method for producing the fusion protein according to claim 2 comprising the steps of (i) cultivating the host cell according to claim 17 under conditions suitable for expressing the fusion protein, and (ii) recovering the fusion protein.

    20. A method for treating or preventing diseases related to the activities of IL-17 and TNF-α in an individual, comprising administering an effective amount of the fusion protein according to claim 2 to an individual in need thereof, wherein the disease is preferably an autoimmune disease, more preferably rheumatoid arthritis, ankylosing spondylitis, psoriasis, and ulcerative colitis; most preferably psoriasis; wherein the individual is a mammal, more preferably a human.

    Description

    DESCRIPTION OF THE DRAWINGS

    [0101] The preferred embodiments of the present invention described in detail below will be better understood when read in combination with drawings. For the purpose of illustrating the invention, some preferred embodiments are shown in the figures. However, it should be understood that the present invention is not limited to the embodiments shown in the drawings.

    [0102] FIGS. 1A and 1B: show the structural schematic diagram of the fusion protein of the present invention targeting IL-17 and TNF-α. FIG. 1A exemplifies the structural schematic diagram of the fusion protein from the N-terminus to the C-terminus comprising an antigen-binding fragment of an anti-IL-17 antibody, the constant domains of an immunoglobulin heavy chain, and TNFR ECD; FIG. 1B exemplifies the structural schematic diagram of the fusion protein from the N-terminus to the C-terminus comprising TNFR ECD, immunoglobulin Fc domain, and an antigen-binding fragment of an anti-IL-17 antibody.

    [0103] FIG. 2: shows a gel image of the fusion proteins of the present invention after SDS-PAGE electrophoresis in the presence of a reducing agent (5 mM 1,4-dithiothreitol) and Coomassie blue staining, wherein said fusion proteins are prepared and purified in Example 2 Lane 1: protein molecular weight marker; lane 2: fusion protein BY19.3; lane 3: fusion protein BY19.5; lane 4: fusion protein BY19.6; lane 5: fusion protein BY19.7; lane 6: fusion protein BY19.4.

    [0104] FIG. 3: shows that the anti-IL-17/TNFR fusion protein of the present invention binds TNF-α and IL-17 respectively, without interfering with each other.

    [0105] FIG. 4: shows the synergistic promotion effect of TNF-α and IL-17 on CXCL1 expression.

    [0106] FIG. 5: shows the synergistic promotion effect of TNF-α and IL-17 on IL-8 expression.

    [0107] FIG. 6: shows the inhibitory effect of the anti-IL-17/TNFR fusion protein of the present invention on the expression of CXCL1.

    [0108] FIG. 7: shows the inhibitory effect of the anti-IL-17/TNFR fusion protein of the present invention on the expression of IL-8.

    DETAILED DESCRIPTION OF THE INVENTION

    [0109] Unless otherwise defined, all terms used herein have the meanings as commonly understood by those skilled in the art to which this invention belongs.

    [0110] For illustrating the specification, the following definitions for some terms are given, and as appropriate, terms used in the singular also include the plural, and vice versa. It is to be understood that the terms defined herein are only for describing specific embodiments, and not for limiting.

    [0111] I. Definition

    [0112] The term “antibody” as used herein is in its broadest sense and covers a variety of antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments, as long as they show the desired antigen-binding activity.

    [0113] As used herein, the terms “whole antibody”, “full-length antibody”, “complete antibody”, and “intact antibody” are used interchangeably herein, all refer to one having a structure that is substantially similar to the structure of a naturally occurring antibody.

    [0114] The term “monoclonal antibody” or “monoclonal antibody composition” as used herein refers to a preparation of antibody molecules having homogeneous amino acid components, and is not limited to the method of production. Monoclonal antibodies or antigen-binding fragments thereof can be produced, for example, by hybridoma technology, recombinant technology, phage display technology, synthetic technology such as CDR grafting, or other techniques known in the art and combinations thereof.

    [0115] The term “human antibody” as used herein refers to an antibody having an amino acid sequence corresponding to an antibody produced by a human or human cell, or derived from a non-human source that utilizes human antibody repertoires or other human antibody-encoding sequences. This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues.

    [0116] The antibody may be a complete antibody molecule, or a functional fragment thereof, including but not limited to, for example, an antigen binding portion, Fab, Fab′, F(ab).sub.2, F(ab′).sub.2, Fv. The constant regions of an antibody can be altered (e.g., mutated) to modify the characteristics of the antibody, for example, one or more of the following characteristics can be increased or decreased: antibody glycosylation, number of cysteine residues, effector function, or complement function. An intact antibody will generally comprises at least two full-length heavy chains and two full-length light chains, but in some cases may comprise fewer chains, for example, antibodies that naturally occur in camels only possess heavy chains.

    [0117] As used herein, the term “antibody fragment” refers to a molecule that is different from an intact antibody, and possesses a portion of the intact antibody, binding to the antigen to which the intact antibody binds.

    [0118] As used herein, the term “antigen-binding fragment” of an antibody is a portion or a part of an intact or entire antibody, capable of binding antigen or competing with an intact antibody (i.e., from which the antigen-binding fragment is derived) for antigen binding. Antigen-binding fragments can be prepared by recombinant DNA technology, enzymatic cleavage, or chemical cleavage of intact antibodies. Examples of antigen binding fragments include but are not limited to Fab, Fab′, F(ab′).sub.2, Fv, single-chain Fv. The Fab fragment is a monovalent fragment consisting of the VL, VH, CL and CH1 domains, and can be obtained for example by papain digestion of a complete antibody. The F(ab′).sub.2 fragment is a bivalent fragment as a dimer of Fab′, and can be produced by pepsin digesting a complete antibody below the disulfide bond in the hinge region. F(ab′).sub.2 can be reduced under neutral conditions by breaking disulfide bonds in the hinge region, and converted to Fab′ monomer. Fab′ monomer is basically an Fab fragment with a hinge region (for more detailed descriptions of other antibody fragments, see: Fundamental Immunology, edited by W. E. Paul. Raven Press, N.Y. (1993)). an Fv fragment is composed of V.sub.L and V.sub.H domains of a half-antibody. In addition, although V.sub.L and V.sub.H domains, two domains in Fv fragment, are encoded by separate genes, they can be linked by a synthetic linker that enables the two domains to be produced as a. single protein chain through recombinant methods. The V.sub.L and V.sub.H regions in the single protein chain pair to form a single chain Fv. An antigen-binding fragment of an antibody can be obtained by chemical methods, recombinant DNA methods, or protease digestion methods.

    [0119] The term “antibody heavy chain” as used herein refers to the larger of the two types of polypeptide chains present in an antibody molecule, which normally determines the class of an antibody it derives from.

    [0120] The term “antibody light chain” as used herein refers to the smaller of the two types of polypeptide chains present in an antibody molecule. κ light chain and λ light chain refer to the two major antibody light chain isotypes.

    [0121] Depending on the amino acid sequences of the constant regions of heavy chains, antibodies are divided into “classes” of IgA, IgD, IgE, IgG, and IgM, and several of these classes can be further divided into subclass, such as IgG1, IgG2, IgG3 and IgG4, IgA1 and lgA2. The heavy chain constant regions that correspond to the different classes of antibodies are called α, δ, ε, γ, and μ, respectively. The light chain constant regions (CL) that can be found in all five antibody classes are called κ or λ. Within the full-length light and heavy chains, the variable region and the constant region are usually linked together by a “J” region of about 12 or more amino acids, and the heavy chain further comprises a “D” region of about 10 or more amino acids. See, for example, Fundamental immunology, Ch. 7 (Paul, W. Editor, Second Edition, Raven Press, N.Y. (1989)) (which is incorporated herein by reference in its entirety for all purposes). The variable regions of each light/heavy chain pair usually form an antigen binding site.

    [0122] As used herein, the term “variable region” or “variable domain” refers to the domain of an antibody heavy or light chain that participates in the binding of an antibody to an antigen. A heavy chain variable domain (VH) and a light chain variable domain (VL) of a natural antibody usually have similar structures, with each domain comprising four conserved framework regions (FRs) and three complementarity determining regions, (See, e.g. Kindt et al., Kuby Immunology, 6.sup.th ed., W.H. Freeman and Co., page 91 (2007). A single VH or VL domain may be sufficient to confer antigen-binding specificity. The light chain variable region and the heavy chain variable region generally comprise from N- to C-terminus the domains FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4.

    [0123] The term “immunoglobulin” as used herein refers to a protein having the structure of a naturally occurring antibody. For example, an immunoglobulin of the IgG class is a heterotetrameric glycoprotein of about 150,000 daltons, composed of two light chains and two heavy chains that are disulfide-bonded. From N- to C-terminus, each immunoglobulin heavy chain has a variable region (VH), also called a variable heavy domain or a heavy chain variable domain, followed by three constant domains (CH1, CH2, and CH3), also called a heavy chain constant region. Similarly, from N- to C-terminus, each immunoglobulin light chain has a variable region (VL), also called a variable light domain or a light chain variable domain, followed by a constant light (CL) domain, also called “a light chain constant region (domain)”.

    [0124] The term “human immunoglobulin” as used herein is one which possesses an amino acid sequence which corresponds to that of an immunoglobulin produced by a human or a human cell or derived from a non-human source that utilizes human immunoglobulin repertoires or other human immunoglobulin-encoding sequences.

    [0125] The terms “binding” and “specific binding” as used herein refer to the binding of an antibody or antigen-binding portion to an epitope in vitro, preferably in bio-optical interferometry (ForteBio) using purified wild-type antigen. In certain embodiments, when the antibody or antigen-binding portion preferably recognizes its target antigen in a complex mixture of proteins and/or macromolecules, the antibody or antigen-binding portion is referred to as capable of specifically binding antigen. The specific binding can be measured by enzyme-linked immunosorbent assay (ELISA) or other techniques familiar to those skilled in the art, such as surface plasmon resonance (SPR) technology (analysis on a BIAcore instrument) (Liljeblad et al., Analysis of agalacto-IgG in rheumatoid arthritis using surface plasmon resonance, Glyco J., 2000, 17, 323-329).

    [0126] The term “affinity” as used herein refers to the strength of the sum total of non-covalent interactions between a single binding site of a molecule (e.g. an antibody) and its binding partner (e.g. an antigen). Unless indicated otherwise, as used herein, “binding affinity” refers to intrinsic binding affinity which reflects a 1:1 interaction between members of a binding pair (e.g. antibody and antigen). The affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (K.sub.D), which is the ratio of dissociation and association rate constants (k.sub.off and k.sub.on, respectively). Affinity can be measured by common methods known in the art. A particular method for measuring affinity is Surface Plasmon Resonance (SPR).

    [0127] When the term “competition” as used herein is used in the case of competing of antigen binding proteins (eg, neutralizing antigen binding protein or neutralizing antibody) for the same epitope, it means competition between antigen binding proteins, which is determined by an assay wherein the antigen binding protein to be detected (e.g. antibody or immunologically functional fragment thereof) prevents or inhibits (e.g. reduces) the specific binding of a reference antigen binding protein (e.g. ligand or a reference antibody) to a common antigen (e.g. IL-17 or fragments thereof). Many types of competitive binding assays can be used to determine whether one antigen binding protein competes with another. These assays are, for example, solid phase direct or indirect radioimmunoassay (RIA), solid phase direct or indirect enzyme immunoassay (EIA), sandwich competition assay (see, for example, Stallli et al., 1983, Methods in Enzymology 9: 242-253). Usually when the competitive antigen binding protein is present in excess, it will inhibit (e.g. reduce) at least 40-45%, 45-50%, 50-55%, 55-60%, 60-65%, 65-70%, 70-75% or 75% or more of the specific binding of the reference antigen binding protein to the common antigen. In some cases, binding is inhibited by at least 80-85%, 85-90%, 90-95%, 95-97%, or 97% or more.

    [0128] The term “effector function” as used herein refers to those biological activities that can be attributed to the Fc region of an antibody, and vary with the antibody isotype. Examples of antibody effector functions include: C1q binding, and complement-dependent cytotoxicity (CDC); Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; cell surface receptors (such as B cell receptors) downregulation; and B cell activation.

    [0129] The term “about” as used herein, when used in combination with a number, is meant to cover a number within a range that has a lower limit that is 5% less than the specified number and an upper limit that is 5% greater than the specified number.

    [0130] The term “comprise” or “comprising” as used herein means including elements, integers, or steps, but does not exclude any other elements, integers, or steps, and sometimes specifically refers to only the listed elements, integers, or steps.

    [0131] As used herein, the terms “effective amount” and “therapeutically effective amount” refer to the amount or dose that produces the desired effects in an individual after the antibody or antigen-binding fragment of the present invention is administered in a single or multiple doses. The desired effects include improvement of the individual's condition (eg, improvement of one or more symptoms) and/or delay in the progression of symptoms, etc.

    [0132] The effective amount can be easily determined by the attending physician as a person skilled in the art by considering the following factors: such as mammal species; its size, age, and general health; the specific disease involved; the degree or severity of the disease; the response from an individual patient; specific antibody administered; mode of administration; bioavailability characteristics of the administered formulation; selected dosing regimen; and use of any concomitant therapy.

    [0133] As mentioned above, in some cases, the interaction between an antibody and its target antigen can interfere with the function of the target. The required amount of administration further depends on the binding affinity of the antibody for its specific antigen, and also on the clearance rate of the antibody in the individual receiving the administration. As a non-limiting example, the therapeutically effective dose of the fusion protein of the present invention generally ranges from about 0.1 mg/kg body weight to about 100 mg/kg body weight. In some embodiments, the fusion protein of the present invention is administered to an individual at a dose of 0.1 mg/kg, 0.5 mg/kg, 1 mg/kg, 2 mg/kg, 5 mg/kg, 10 mg/kg, 15 mg/kg, 20 mg/kg, 25 mg/kg, 30 mg/kg, 50 mg/kg, 75 mg/kg, 100 mg/kg or higher. Common dosage frequency ranges are, for example, twice a day to once a week, once every two weeks, once every three weeks, once every month, once every two months, once every three months, once every six months.

    [0134] The term “operably linked to” as used herein means that the specified components are linked in a relationship that allows them to function in an expected manner.

    [0135] The term “signal sequence” as used herein is an amino acid sequence linked to the N-terminus of a protein, which promotes secretion of the protein outside the cell. The mature form of the extracellular protein has no signal sequence, which is excised during the secretory process.

    [0136] As used herein, the term “N-terminus” refers to the last amino acid at the N-terminus, and the term “C-terminus” refers to the last amino acid at the C-terminus.

    [0137] The term “fusion” as used herein refers to the direct connection of two or more components by peptide bonds or the operable connection of two or more components via one or more linker peptides.

    [0138] The term “host cell” as used herein refers to a cell into which a foreign polynucleotide sequence has been introduced, including the progeny of such cells. Host cells include “transformants”, and “transformed cells”, which include the primary transformed cells (parent cells), and progeny derived therefrom. Progeny may not be completely identical in nucleic acid content to a parent cell, but may contain mutations. Mutant progeny that has the same function or biological activity as screened or selected for in the originally transformed cell is included herein. Host cells are any type of cell system that can be used to produce the fusion protein of the present invention. Host cells not only include cultured cells, but also include cells within transgenic animals, transgenic plants, or cultured plant tissues or animal tissues.

    [0139] As used herein, the terms “individual” and “subject” are used interchangeably and refer to a mammal. Mammals include, but are not limited to domesticated animals (eg, cows, sheep, cats, dogs. and horses), primates (eg, humans and non-human primates such as monkeys), rabbits, and rodents (e.g., mice and rats). In particular, the individual is a human.

    [0140] The term “vector” as used herein refers to a nucleic acid molecule capable of propagating another nucleic acid to which it is linked. The term includes the vector as a self-replicating nucleic acid structure as well as the vector incorporated into the genome of a host cell into which it has been introduced. Certain vectors are capable of directing the expression of nucleic acids to which they are operatively linked. Such vectors are referred to herein as “expression vectors”.

    [0141] The term “isolated” antibody as used herein is one which has been separated from a component of its natural environment. In some embodiments, an antibody is purified to greater than 95% or 99% purity as determined by, for example, electrophoretic (e.g., SDS-PAGE, isoelectric focusing (IEF), capillary electrophoresis) or chromatographic (e.g., ion exchange chromatography or reverse phase HPLC). For review of methods for assessment of antibody purity, see, e.g., Flatman, S. et al., J. Chromatogr. B 848: 79-87 (2007).

    [0142] As used herein, the term “treatment” refers to a clinical intervention that is intended to alter the natural course of the disease in the individual being treated. Desirable therapeutic effects include but are not limited to preventing the occurrence or recurrence of the disease, reducing symptoms, reducing any direct or indirect pathological consequences of the disease, preventing metastasis, reducing the rate of progression of the disease, improving or alleviating the disease state, and relieving or improving the prognosis. In some embodiments, the fusion protein of the present invention is used to delay disease progression or to slow the progression of the disease.

    [0143] As used herein, the term “autoimmune disease” refers to a disease caused by the body's immune response to its own components, resulting in damage to its own tissues. In the present invention, it particularly refers to rheumatoid arthritis, ankylosing spondylitis, psoriasis and ulcerative colitis.

    [0144] The term “variant” as used herein refers to a nucleotide sequence or amino acid sequence derived from a parent nucleotide sequence or amino acid sequence, but the sequence itself is different from the parent sequence. “Variants” include variant sequences that exist in nature, variant sequences obtained through natural processes, and variant sequences obtained through artificial methods.

    [0145] The term “conservative substitution/replacement” as used herein refers to the substitution/replacement of one amino acid with another amino acid in the same category, for example, the substitution/replacement of one acidic amino acid with another acidic amino acid, and the substitution of one basic amino acid with another basic amino acid/Substitution or substitution/replacement of a neutral amino acid with another neutral amino acid. Exemplary substitutions are shown in Table A below.

    TABLE-US-00001 TABLE A Preferred Original Residue Exemplary Substitutions Substitutions Ala (A) Val; Leu; Ile Val Arg (R) Lys; Gln; Asn Lys Asn (N) Gln; His; Asp, Lys; Arg Gln Asp (D) Glu; Asn Glu Cys (C) Ser; Ala Ser Gln (Q) Asn; Glu Asn Glu (E) Asp; Gln Asp Gly (G) Ala Ala His (H) Asn; Gln; Lys; Arg Arg Ile (I) Leu; Val; Met; Ala; Phe; norleucine Leu Leu (L) norleucine; Ile; Val; Met; Ala; Phe Ile Lys (K) Arg; Gln; Asn Arg Met (M) Leu; Phe; Ile Leu Phe (F) Trp; Leu; Val; Ile; Ala; Tyr Tyr Pro (P) Ala Ala Ser (S) Thr Thr Thr (T) Val; Ser Ser Trp (W) Tyr; Phe Tyr Tyr (Y) Trp; Phe; Thr; Ser Phe Val (V) Ile; Leu: Met; Phe; Ala; norleucine Leu

    [0146] “Percent (%) amino acid sequence identity” with respect to a reference amino acid sequence is defined as the percentage of amino acid residues in an amino acid sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity, calculated as: the number of amino acid residues in the amino acid sequence that is the same as the amino acid residues of the control/reference polypeptide sequence is divided by the total number of amino acid residues to obtain the quotient (expressed as a percentage). Sequence alignment can be performed using various methods in the art to determine percent amino acid sequence identity, for example, using publicly available computer software such as BLAST, BLAST-2, ALIGN, or MEGALIGN (DNASTAR) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.

    [0147] When referring to percent (%) amino acid sequence identity in this application, it is calculated in terms of the full length of the longer sequence unless otherwise specified. Said calculation in terms of the full length of the longer sequence applies to both nucleic acid sequences and polypeptide sequences.

    [0148] II. Fusion Protein

    [0149] The term “fusion protein” as used herein refers to a new polypeptide sequence resulting from the linkage of two or more identical or different polypeptide sequences, and in particular refers to a recombinantly obtained sequence, comprising one or more identical or different naturally unlinked polypeptide sequences.

    [0150] The fusion protein of the present invention binds to IL-17 with a dissociation constant (K.sub.D) of 10.sup.−8 M or less, such as 10.sup.−9 M to 10.sup.−12 M; and specifically binds to TNF molecule with a dissociation constant (K.sub.D) of 10.sup.−8 M or less, such as 10.sup.−9 M to 10.sup.−12 M.

    [0151] In the fusion protein of the present invention, the above-mentioned (i), (ii) and/or (iii) are optionally operatively linked via a linker peptide.

    [0152] II-1. Anti-IL-17 Antibody

    [0153] An interleukin (IL) is a cytokine. Human IL-17 (CTLA-8, Swiss Prot Q16552) is a proinflammatory cytokine, produced by a subset of memory T cells (called Th17) that participate in the pathogenesis of MS, and can induce epithelial cells, endothelial cells, and fibroblasts to synthesize and secrete IL-6, IL-8, G-CSF, and PGE2, to promote the expression of ICAM-1. IL-17 plays a role in inducing other inflammatory cytokines, chemokines and adhesion molecules. Treatment of animals with IL-17 neutralizing antibodies reduces the incidence and severity of disease in autoimmune encephalomyelitis (Komiyama, Y. et al., J. Immunol., 177 (2006) 566-573). IL-17A is overexpressed in cerebrospinal fluid of MS patients (Hellings, P. W. et al., Am. J. Resp. Cell Mol. Biol., 28 (2003) 42-50; Matusevicius, D. et al., Multiple Sclerosis 5 (1999) 101-104; WO 2005/051422). In addition, IL-17A neutralizing antibodies reduce the severity and morbidity of the mouse collagen-induced arthritis RA model, and high levels of IL-17A can be detected in synovial fluid from inflamed joints of RA patients (Ziolkowska, M. et al., J. Immunol. 164 (2000) 2832-2838; Kotake, S. et al., J. Clin. Invest. 103 (1999) 1345-1352; Hellings, P. W. et al. Am. J. Resp. Cell Mol. Biol. 28 (2003) 42-50).

    [0154] As used herein, IL-17 refers to any natural IL-17 from any vertebrate source (including mammals such as primates (eg, humans) and rodents (eg, mice and rats)), unless otherwise indicated. The term encompasses “full-length” unprocessed IL-17 as well as any form of IL-17 or any fragment thereof produced by intracellular processing. The term also includes naturally occurring variants of IL-17, for example, splice variants or allelic variants. IL-17 herein is sometimes preferable IL-17A.

    [0155] As used herein, the terms “anti-IL-17 antibody”, “anti-IL-17”, “IL-17 antibody” or “IL-17 binding antibody” refer to an antibody that is capable of binding IL-17 or fragments thereof with sufficient affinity, so that the antibody can be used as a diagnostic and/or therapeutic agent targeting IL-17. In one embodiment, the degree to which the anti-IL-17 antibody binds to unrelated, non-IL-17 protein is less than about 10% of the antibody's binding to IL-17, as measured, for example, by radioimmunoassay (RIA). In some embodiments, the anti-IL-17 antibody provided herein has a dissociation constant (Kd) ≤1 μM, ≤100 nM, ≤10 nM, ≤1 nM, ≤0.01 nM, or ≤0.001 nM (e.g. 10.sup.−8 M or less, such as 10.sup.−8 M to 10.sup.−13 M, such as 10.sup.−9 M to 10.sup.−13 M). In some embodiments, the anti-IL-17 antibody is a multispecific antibody, such as a bispecific antibody.

    [0156] The IL-17 antibody or antigen-binding fragment of the present invention comprises substitutions, insertions or deletions. In preferred embodiments, the substitution, insertion or deletion occurs in a region outside the CDRs (for example in FRs). Optionally, the anti-IL-17 antibodies of the invention comprise post-translational modifications to the light chain variable region or heavy chain variable region, to light chain or heavy chain.

    [0157] The IL-17 antibody provided by the present invention exhibits inhibitory activity, such as inhibiting the expression, activity and/or signaling of IL-17 (such as inhibiting the expression of IL-17 by T cells), or interfering with the interaction of IL-17 and its receptor. The IL-17 antibody provided by the present invention completely or partially reduces or regulates the expression or activity of IL-17 upon binding or interacting with IL-17 (such as human IL-17). After the interaction between the antibody and the human IL-17 polypeptide and/or peptide, the reduction or regulation of the biological function of IL-17 is complete, significant or partial. The antibody is considered to be able to completely inhibit the expression or activity of IL-17, in the case that the expression or activity level of IL-17 is reduced by at least 95% (e.g., reduced by 96%, 97%, 98%, 99% or 100%) when the antibody is present, compared to the level of IL-17 expression or activity when there is no interaction (such as binding) with the antibody herein. The IL-17 antibody is considered to be able to significantly inhibit the expression or activity of IL-17, in the case that the expression or activity level of IL-17 is reduced by at least 50% (e.g., reduced by 55%, 60%, 75%, 80%, 85% or 90%) when the IL-17 antibody is present, compared to the level of IL-17 expression or activity when there is no interaction (such as binding) with the antibody herein. The IL-17 antibody is considered to be able to partially inhibit the expression or activity of IL-17, in the case that the expression or activity level of IL-17 is reduced by less than 95% (e.g., reduced by 10%, 20%, 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85% or 90%) when the IL-17 antibody is present, compared to the level of IL-17 expression or activity when there is no interaction (such as binding) with the antibody herein.

    [0158] If the activity is reduced compared to the activity measured in the absence of the antibody, the antibody “inhibits” the activity induced by or associated with the antigen, such as the activity induced by IL-17. In certain embodiments, the antibody inhibits the activity of the antigen in the presence of the antibody by at least 10% compared to the activity in the absence of the antibody. In some embodiments, the antibody inhibits activity by at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% or 100%. If the activity is reduced by at least 50% in the presence of the antibody compared to the activity in the absence of the antibody, then the antibody is deemed to “neutralize” the antigen or its related activity. In some embodiments, the neutralizing antibody inhibits activity by at least 60%, at least 70%, at least 80%, or at least 90% or 100%. In certain embodiments, the activity induced by IL-17 is cell proliferation in vitro or in vivo. In certain other embodiments, the IL-17-induced activity is IL-17-mediated inflammation or immune-related diseases. In other embodiments, the IL-17-induced activity is IL-17-mediated inflammatory cell infiltration.

    [0159] In certain embodiments, one or more amino acid modifications may be introduced into the Fc-region of an antibody provided herein, thereby generating an Fc-region variant. The Fc-region variant may comprise a human Fc-region sequence (e.g., a human IgG1, IgG2, IgG3 or IgG4 Fc-region) comprising an amino acid modification (e.g. a substitution) at one or more amino acid positions.

    [0160] In certain embodiments, it may be desirable to create cysteine engineered antibodies, e.g., “thioMAbs,” in which one or more residues of an antibody are substituted with cysteine residues.

    [0161] In certain embodiments, an antibody provided herein may be further modified to contain additional non-proteinaceous moieties that are known in the art and readily available. The moieties suitable for derivatization of the antibody include but are not limited to water soluble polymers. Non-limiting examples of water soluble polymers include, but are not limited to, polyethylene glycol (PEG), copolymers of ethylene glycol/propylene glycol, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, poly-1,3-dioxolane, poly-1,3,6-trioxane, ethylene/maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers), and dextran or poly(n-vinyl pyrrolidone)polyethylene glycol, propropylene glycol homopolymers, prolypropylene oxide/ethylene oxide co-polymers, polyoxyethylated polyols (e.g., glycerol), polyvinyl alcohol, and mixtures thereof.

    [0162] Examples of paired heavy chain variable regions (VH) and light chain variable regions (VL) in antigen-binding fragments of anti-IL-17 antibodies comprised in the fusion protein of the present invention are provided in Table 1A below.

    TABLE-US-00002 TABLE 1 Examples of heavy chain variable region and light chain variable region sequences in antigen-binding fragments of anti-IL-17 antibodies comprised in the fusion protein of the present invention SEQ Variable ID regions AminQ acid sequences NO: VH EVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMNW 1 VRQAPGKGLHWVAAINQDGSEKYYVGSVKGRFTISR DNAKNSLYLQMNSLRVEDTAVYYCVRDYYDILTDYY IHYWYFDLWGRG VL EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAW 2 YQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDF TLTISRLEPEDFAVYYCQQYGSSPCTFGQG VH EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHW 3 VRQAPGKGLEWVSGINWSSGGIGYADSVKGRFTISR DNAKNSLYLQMNSLRAEDTALYYCARDIGGFGEFYW NFGLWGRG VL EIVLTQSPATLSLSPGERATLSCRASQSVRSYLAWY 4 QQKPGQAPRLLIYDASNRATGIPARFSGSGSGTDFT LTISSLEPEDFAVYYCQQRSNWPPATFGGG VH EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYNMAW 5 VRQAPGKGLEWVATITYEGRNTYYRDSVKGRFTISR DNAKNSLYLQMNSLRAEDTAVYYCASPPQYYEGSIY RLWFAHWGQG VL AIQLTQSPSSLSASVGDRVTITCRADESVRTLMHWY 6 QQKPGKAPKLLFYLVSNSEIGVPDRFSGSGSGTDFR LTISSLQPEDFATYYCQQTWSDPWTFGQG VH QVQLVQSGAEVKKPGSSVKVSCKASGYSFTDYHIHW 7 VRQAPGQGLEWMGVINPMYGTTDYNQRFKGRVTITA DESTSTAYMELSSLRSEDTAVYYCARYDYFTGTGVY WGQG VL DIVWQTPLSLSVTPGQPASISCRSSRSLVHSRGNTY 8 LHWYLQKPGQSPQLLIYKVSNRFIGVPDRFSGSGSG TDFTLKTSRVEAEDVGVYYCSQSTHLPFTFGQG VH EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYTMLW 9 VRQAPGKGLEWVAIIKSGGSYSYYPDSVKGRFTISR DNAKNSLYLQMNSLRAEDTAVYYCARDGDYGSSYGA MDYWGQG VL DIQMTQSPSSLSASVGDRVFITCRASQDINSYLSWF 10 QQKPGKAPKSLIVRANRLVDGVPSRFSGSGSGQDYS LTISSLQPEDFATYYCLQYDAFPPYTTGQG VH EVQLVQSGAEVKKPGSSVKVSCKASGGSFGGYGIGW 11 VRQAPGQGLEWMGGITPFFGFADYAQKFQGRVTITA DESTTTAYMELSGLTSDDTAVYYCARDPNEFWNGYY STHDFDSWGQG VL EIVLTQSPDFQSVTPKEKVTTTCRASQDIGSELHWY 12 QQKPDQPPKLLIKYASHSTSGVPSRFSGSGSGTDFT LTINGLEAEDAGTYYCHQTDSLPYTFGPG VH EVQLVQSGAEVKKPGASVKVSCKASGYTFTDYEVHW 13 VRQAPGQGLEWMGVIDPGTGGVAYNQKFEGRVTMTA DTSTSTAYMELRSLRSDDTAVYYCTRYSLFYGSSPY AMDYWGQG VL EIVLTQSPDFQSVTPKEKVTTTCSASSSVNYMHWFQ 14 QKPDQSPKLWIYRTSNLASGWSRFSGSGSGTDYTLT INSLEAEDAATYYCQQRSSYPWTTGQG VH EVQLVESGGGLVQPGGSLRLSCAASGMSMSDYWMNW 15 VRQAPGKGLEWVAALNQDGDEKYYVGSVKGRFTFSR DNAKNSLYLQMNSLRVEDTAVYYCVRDYYDLISDYY IHYWYFDLWGRG VL DIQMTQSPSSLSASVGDRVTTHCRASQNVHNRLTWY 16 QQKPGKAPKLLIYGASNLESGVPSRFSGSGSGTDFT LTISSLQPEDFATYYCQQYNGSPTTFGQG

    [0163] Examples of amino acid sequences of the light chain constant regions and the heavy chain constant regions of the anti-IL-17 antibodies comprised in the fusion protein of the present invention are provided in the following Tables 2 and 3 below.

    TABLE-US-00003 TABLE 2 Examples of the amino acid sequences of the light chain constant regions in the antigen- binding fragment of the anti-IL-17 antibody comprised in the fusion protein of the present invention Type of SEQ light Amino acid sequence of ID chain light chain constant region NO: κ TKVEIKRTVAAPSWIFPPSDEQLKSGTASWCLLNNFYPR 17 EAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL SKADYEKHKVYACEVTHQGESSPVTKSFNRGEC λ TKLTVLGQPKAAPSYTLFPPSSEELQANKATLVCLISDF 18 YPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYL SLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

    TABLE-US-00004 TABLE 3 Examples of the amino acid sequences of the heavy chain constant regions in the antigen- binding fragment of the anti-IL-17 antibody comprised in the fusion protein of the present invention Class of SEQ heavy Amino acid sequence of ID chain heavy chain constant region NO: IgGl TLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDY 19 FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTV PSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP PCTAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV SHEDPEVTCFNWYVDGYTSVHNAKTKPREEQYNSTYRWS VLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP REPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWE SNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN VFSCSVMHEALHNHYTQKSLSLSPGK IgG2 TTYTVSTASTKGPSVFPLAPCSRSTSESTAALGCLVKDY 20 FPEPVTVSWNISGALTSGVHTFPAVLQSSGLYSLSSVVT VPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPC PAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVQF

    [0164] II-2 Immunoglobulin Fc Domain

    [0165] The term “Fc region” as used herein is to define the C-terminus region of the immunoglobulin heavy chain that contains at least a portion of the constant region. The term includes native sequence Fc regions and variant Fc regions. In some embodiments, a human IgG heavy chain Fc-region extends from Cys226 or from Pro230 to the carboxyl-terminus of the heavy chain. However, the C-terminal lysine (Lys447) of the Fc region may or may not be present. Unless otherwise specified herein, numbering of amino acid residues in the Fe-region or constant region is according to the EU numbering system, also called the EU index, as described in Kabat et al., Sequences of Proteins of Immunological Interest. 5th ed., Public Health Service, National Institutes of Health, Bethesda, Md., 1991.

    [0166] The “immunoglobulin Fc domain” in the fusion protein of the present invention comprises all the amino acid residues of the naturally occurring immunoglobulin Fc domain or a part of the amino acid residues of the naturally occurring immunoglobulin Fc domain. The immunoglobulin Fc domain provides favorable pharmacokinetic properties for the fusion protein of the present invention, including but not limited to long serum half-life. In addition, the immunoglobulin Fc domain also makes it possible to purify the fusion protein of the present invention by, for example, protein A affinity chromatography.

    [0167] An immunoglobulin Fc domain is usually a dimeric molecule, which can be produced by papain digestion or trypsin digestion of an intact (full-length) immunoglobulin or can be recombinantly produced, comprising CH2 domain, CH3 domain and optional CH4 domain. Examples of the amino acid sequence of the heavy chain Fc in the antigen-binding fragment of the anti-IL-17 antibody comprised in the fusion protein of the present invention are provided in Table 4 below.

    TABLE-US-00005 TABLE 4 Examples of the amino acid sequence of the heavy chain Fc in the antigen-binding fragment of the anti-IL-17 antibody comprised in the fusion protein of the present invention Class of SEQ heavy Amino acid sequence of ID chain the heavy chain Fc NO: IgG1 DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV 75 TCVWDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQDWLNGKEYKCKVSMCAEPAPIEKTISK AKGQPREPQVTTLPPSREEMTKNQVSLTCLVKGFYPSDI AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR VVQQGNVFSCSVMHEALHNHYTQKSLSLSPGK IgG2 DKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMIS 76 RTPEVTCVWDVSHEDPEVQFNWYVDGVEVHNAKTKPREE QFNSTFRWSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEK TISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY PSDIAVEWESNGQPENNYKTTPPMEDSDGSFFLYSKLTV DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK IgG4 DKRVESKYGPPGPPCPAPEFLGGPSVFLFPPKPKDTLMI 77 SRTPEVTCVWDVSQEDPEVQFNWYVDGVEVHNAKTKPRE EQFNSTYRWSVLTVLHQDWLNGKEYKCKVSNKGLPSSIE KTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGF YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLT VDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK

    [0168] II-3 TNFR Extracellular Region

    [0169] The term “TNFR” as used herein refers to a receptor for tumor necrosis factor (TNF), which is a glycoprotein. The term “extracellular region” as used herein refers to a part of TNFR that is outside the cell membrane in the natural environment.

    [0170] The TNFR functional region in the fusion protein of the anti-IL-17 antibody and the TNFR extracellular domain may comprise the full length of the TNFR extracellular domain, i.e. CRD1-CRD2-CRD3-CRD4, or a part of the extracellular domain, i.e. a fragment of CRD1-CRD2-CRD3-CRD4.

    [0171] Examples of the amino acid sequences of the TNFR extracellular region and of a part thereof comprised in the fusion protein of the present invention are provided in Table 5 below.

    TABLE-US-00006 TABLE 5 Examples of amino acid sequences of the TNFR extracellular region and of a part thereof comprised in the fusion protein of the present invention. Functional SEQ ID region Amino acid sequence  NO: TNFR 2 Full length LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVF 22 of TNFR2 CTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQAC extracellular TREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGT region ETSDWCKPCAPGTFSNTTSSTDICRPHQICNWAIPGNASMDAVC TSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLP MGPSPPAEGSTGD Part of LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVF 23 TNFR2 CTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQAC extracellular TREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGT region ETSDWCKPCAPGTFSNTTSSTDICRPHQI TNFR 1 Full length LVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCP 24 of TNFR1 GPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSC extracellular TVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEK region QNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGT EDSGTT Part of LVPHLGDREKRDSVCPQGKYTHPQNNSICCTKCHKGTYLYNDCP 25 TNFR1 GPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSC extracellular TVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEK region QNTVCTCHAGFFLRENECVSCSNCKKSLE

    [0172] II-4 Linker Peptide

    [0173] The term “linker peptide” as used herein refers to a short peptide that can link two polypeptide sequences, and is about 1-100 amino acid residues in length.

    [0174] The anti-IL-17 antibody and the TNFR extracellular region in the fusion protein of the present invention are linked via a linker peptide, wherein the amino acid sequence of the linker peptide may be selected from any one of

    TABLE-US-00007 (SEQ ID NO: 30) AKTTPKLEEGEFSEAR; (SEQ ID NO: 31) AKTTPKLEEGEFSEARV; (SEQ ID NO: 32) AKTTPKLGG; (SEQ ID NO: 33) SAKTTPKLGG; (SEQ ID NO: 34) SAKTTP; (SEQ ID NO: 35) RADAAP; (SEQ ID NO: 36) RADAAPTVS; (SEQ ID NO: 37) RADAAAAGGPGS; (SEQ ID NO: 38) RADAAAA; (SEQ ID NO: 39) SAKTTPKTEEGEFSEARV; (SEQ ID NO: 40) ADAAP; (SEQ ID NO: 41) DAAPTVSIFPP; (SEQ ID NO: 42) TVAAP; (SEQ ID NO: 43) TVAAPSVFIFPP; (SEQ ID NO: 44) QPKAAP; (SEQ ID NO: 45) QPKAAPSVTLFPP; (SEQ ID NO: 46) AKTTPP; (SEQ ID NO: 47) AKTTPPSVTPLAP; (SEQ ID NO: 48) AKTTAP; (SEQ ID NO: 49) AKTTAPSVYPLAP; (SEQ ID NO: 50) ASTKGP; (SEQ ID NO: 51) ASTKGPSVFPLAP; (SEQ ID NO: 52) GGGGSGGGGSGGGGS; (SEQ ID NO: 53) GENKVEYAPALMALS; (SEQ ID NO: 54) GPAKELTPLKEAKVS; (SEQ ID NO: 55) GHEAAAVMQVQYPAS; (SEQ ID NO: 56) GGGGSGGGGSGGGGSA; (SEQ ID NO: 57) GQGTKVEIKRGGSGGGGSG; (SEQ ID NO: 58) GQGTLVTVSSGGGGSGGGGS.

    [0175] The fusion protein of the present invention, comprising anti-IL-17 antibody and TNFR, has the function of binding IL-17 and TNF-α, that is, upon binding either IL-17 or TNF-α, the fusion protein can still bind another target.

    [0176] The fusion protein of the present invention, comprising anti-IL-17 antibody and TNFR, can synergistically inhibit the biological functions of IL-17 and TNF-α, inhibit the release of inflammatory mediators such as chemokines and lymphokines, and the inhibitory effects are comparable to those derived from the combination of the anti-IL-17 antibody and the TNF-α inhibitor, more potent than the anti-IL-17antibody alone or the TNF-α inhibitor alone.

    [0177] The fusion protein of the present invention, comprising anti-IL-17 antibody and TNFR, can be used for the treatment of autoimmune diseases such as rheumatoid arthritis, ankylosing spondylitis, psoriasis and ulcerative colitis.

    [0178] III. Production and Purification of the Fusion Protein of the Present Invention

    [0179] The fusion protein of the present invention can be obtained, for example, by solid-state peptide synthesis (for example, Merrifield solid-phase synthesis) or recombinant production. For recombinant production, the polynucleotide encoding the first subunit of the fusion protein and/or the polynucleotide encoding the second subunit of the fusion protein are isolated and inserted into one or more vectors for further cloning and/or expressing in a host cellon. Using conventional methods, the polynucleotides can be easily isolated and sequenced. In one embodiment, a vector, preferably an expression vector, comprising one or more polynucleotides of the invention is provided.

    [0180] The expression vector can be constructed using methods well known to those skilled in the art. Expression vectors include but are not limited to viruse vectors, plasmids, cosmids, lambda phage, or yeast artificial chromosomes (YAC). In a preferred embodiment, a glutamine synthetase high-efficiency expression vector with dual expression cassettes is used.

    [0181] Once an expression vector comprising one or more polynucleotides of the invention has been prepared for expression, the expression vector can be transfected or introduced into a suitable host cell. Various techniques can be used for this purpose, for example, protoplast fusion, calcium phosphate precipitation, electroporation, retrovirus transduction, viral transfection, gene gun, liposome-based transfection, or other conventional techniques.

    [0182] Standard techniques for expressing foreign genes in these host cell systems are known in the art. In one embodiment, a method of producing a fusion protein of the invention is provided, comprising culturing a host cell as provided herein comprising polynucleotide(s) encoding the fusion protein under conditions suitable for expression of the fusion protein, and recovering the fusion protein from the host cell (or the host cell culture medium).

    [0183] Fusion proteins prepared as described herein may be purified by art-known techniques such as high performance liquid chromatography, ion exchange chromatography, gel electrophoresis, affinity chromatography, size exclusion chromatography, and the like. The actual conditions used to purify a particular protein will also depend on factors such as net charge, hydrophobicity, hydrophilicity etc., and will be apparent to those having skill in the art.

    [0184] The purity of the fusion protein of the present invention can be determined by any of a variety of well-known analysis methods including gel electrophoresis, high-performance liquid chromatography, and the like. The physical/chemical properties and/or biological activities of the fusion proteins provided herein can be identified, screened, or characterized by various assays known in the art.

    [0185] IV. Pharmaceutical Composition and Kit

    [0186] As used herein, the term “pharmaceutical composition” refers to a formulation that exists in a form allowing the biological activity of the active ingredient contained therein to be effective, and does not include additional ingredients with unacceptable toxicity to the individual to whom the formulation is administered. The pharmaceutical composition of the present invention is suitable for intravenous, intramuscular, subcutaneous, parenteral, rectal, spinal or epidermal administration (for example, by injection or infusion).

    [0187] The term “pharmaceutically acceptable carrier” as used herein includes any and all solvents, dispersion media, isotonic agents and absorption delaying agents, etc. that are physiologically compatible.

    [0188] The pharmaceutical composition of the present invention can comprise the fusion protein of the present invention and a pharmaceutically acceptable carrier. These pharmaceutical compositions may be included in kits, such as diagnostic kits.

    [0189] Pharmaceutically acceptable carriers suitable for use in the present invention may be sterile liquids, such as water and oil, including those of petroleum, animal, vegetable or synthetic source, such as peanut oil, soybean oil, mineral oil, sesame oil, and the like. When the pharmaceutical composition is administered intravenously, water is the preferred carrier. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions. Suitable pharmaceutical excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like. For the use of excipients, see also “Handbook of Pharmaceutical Excipients”, Fifth Edition, R. C. Rowe, P. J. Seskey and S. C. Owen, Pharmaceutical Press, London, Chicago. The compositions, if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents. These compositions can take the form of solutions, suspensions, emulsions, tablets, pills, capsules, powders, sustained release formulations and the like. Oral formulations may contain standard carriers such as pharmaceutical grade mannitol, lactose, starch, magnesium stearate, saccharin.

    [0190] The pharmaceutical formulation comprising the fusion protein of the invention can be prepared by mixing the fusion protein of the invention having the desired purity with one or more optional pharmaceutical carriers (Remington's Pharmaceutical Sciences, 16th edition. Osol, A. Ed. (1980)). Preferably, the pharmaceutical formulation is in a lyophilized or aqueous solution form.

    [0191] An exemplary lyophilized antibody formulation is described in U.S. Pat. No. 6,267,958. Aqueous antibody formulations include those described in U.S. Pat. No. 6,171,586 and WO2006/044908, the latter formulation comprises a histidine-acetate buffer.

    [0192] The pharmaceutical composition or formulation of the present invention may comprise more than one active ingredient that is required for the specific indication being treated, preferably those active ingredients that do not adversely affect each other's complementary activities, and suitably present in combination in an amount effective for the intended use.

    [0193] Sustained-release formulations can be prepared. Suitable examples of sustained-release formulations include semipermeable matrices of antibody-comprising solid hydrophobic polymers, which matrices are in the form of shaped articles, such as films or microcapsules.

    [0194] The composition of the present invention may be in various forms, including for example, liquid, semi-solid, and solid dosage forms, such as liquid solutions (eg, injectable solutions and infusible solutions), dispersions or suspensions, liposomes, and suppositories. The preferred form depends on the intended mode of administration and therapeutic use. Commonly preferred compositions are in the form of injectable solutions or infusible solutions. The preferred mode of administration is parenteral (eg, intravenous, subcutaneous, intraperitoneal (i.p.), intramuscular) injection. In a preferred embodiment, the fusion protein is administered by intravenous infusion or injection. In another preferred embodiment, the fusion protein is administered by intramuscular, intraperitoneal or subcutaneous injection.

    [0195] The phrases “parenteral administration” and “administered parenterally” as used herein mean a mode of administration other than enteral and local administration, usually by injection, and include but are not limited to intravenous, intramuscular, intraarterial, intradermal, intraperitoneal, transtracheal, subcutaneous injection and infusion.

    [0196] Therapeutic compositions should generally be sterile and stable under the conditions of manufacture and storage. The composition can be formulated as a solution, microemulsion, dispersion, liposome, or lyophilized form. Sterile injectable solutions can be prepared by incorporating the required amount of the active compound (ie, fusion protein) into a suitable solvent followed by filter sterilization. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and other ingredients. Coating agents such as lecithin and the like can be used. In the case of dispersions, the proper fluidity of the solution can be maintained by using surfactants. Prolonged absorption of the injectable composition can be achieved by including substances that delay absorption in the composition, such as monostearate and gelatin.

    [0197] In certain embodiments, the fusion protein of the present invention can be administered orally, for example, in an inert diluent or an edible carrier. The fusion protein of the present invention can also be enclosed in hard or soft shell gelatin capsules, compressed into tablets or directly incorporated into an individual's diet. For oral therapeutic administration, the compound can be incorporated with excipients and taken as ingestible tablets, buccal tablets, troches, capsules, elixirs, suspensions, syrups, wafer or the like form. In order to administer the fusion protein of the present invention by a non-parenteral administration method, it may be necessary to coat or co-administer the fusion protein with a material that prevents its inactivation. Therapeutic compositions can also be administered via medical devices known in the art.

    [0198] The pharmaceutical composition of the present invention can comprise a “therapeutically effective amount” or “prophylactically effective amount” of the fusion protein of the present invention. “Therapeutically effective amount” refers to an amount that is effective to achieve the desired therapeutic result at the required dose for the required period of time. The therapeutically effective amount can be varied according to various factors such as disease state, individual's age, sex, and weight. A therapeutically effective amount is any amount that is less toxic or harmful than the beneficial effect of treatment. The “therapeutically effective amount” preferably inhibits measurable parameters (eg, tumor growth rate) by at least about 20%, more preferably at least about 40%, even more preferably at least about 60%, and still more preferably at least about 80% relative to untreated individuals. The ability of the fusion protein of the invention to inhibit measurable parameters (eg, tumor volume) can be evaluated in animal model systems that predict efficacy on human tumors.

    [0199] “Prophylactically effective amount” refers to an amount that is effective to achieve the desired preventive result at the required dose for the required period of time. Generally, because the prophylactic dose is used in an individual before or at an earlier stage of the disease, the prophylactically effective amount is less than the therapeutically effective amount.

    [0200] Kits comprising the fusion proteins herein are also within the scope of the present invention. The kit may contain one or more other elements, including, for example, instructions for use; other reagents, such as labels or coupling reagents; pharmaceutically acceptable carriers; and devices helpful for administration to individuals or other materials.

    [0201] V. Uses of Fusion Protein

    [0202] The fusion protein disclosed herein have in vitro and in vivo diagnostic uses as well as therapeutic and prophylactic uses. For example, these molecules can be administered to cultured cells in vitro or ex vivo or to an individual, for example, a human individual, to treat, prevent and/or diagnose various diseases related to the biological activities of IL-17 and TNF-α, for example, autoimmune diseases.

    [0203] In one aspect, the present invention provides diagnostic methods for detecting the presence of IL-17 and TNF-α in biological samples in vitro or in vivo, such as serum, semen, or urine or tissue biopsy samples (eg, from hyperproliferative or cancerous lesions). The diagnostic method includes: (i) contacting a sample (and optionally, a control sample) with a fusion protein as described herein or administering the fusion protein to an individual under conditions allowing interaction to occur, and (ii) detecting the formation of complex between the fusion protein and the sample (and optionally, control sample). The formation of the complex indicates the presence of IL-17 and TNF-α, and may show the applicability or need for the treatment and/or prevention described herein.

    [0204] In some embodiments, IL-17 and TNF-α are assayed before treatment, for example, before initiating treatment or before a certain treatment after a treatment interval. Assays that can be used include immunohistochemistry, immunocytochemistry, FACS, ELISA assays, PCR-technologies (eg, RT-PCR) or in vivo imaging techniques. Generally, fusion proteins used in in vivo and in vitro detection methods are directly or indirectly labeled with a detectable substance to facilitate detection of bound or unbound bindets. Suitable detectable substances include various biologically active enzymes, prosthetic groups, fluorescent substances, luminescent substances, paramagnetic (eg, nuclear magnetic resonance active) substances, and radioactive substances.

    [0205] In some embodiments, the levels and/or distribution of IL-17 and TNF-α are determined in vivo, for example, in a non-invasive manner (eg, by using suitable imaging techniques (eg, positron emission tomography (PET) Scanning.) to detect the fusion protein of the present invention labeled with a detectable substance. In one embodiment, for example, by detecting the fusion protein of the present invention labeled with a PET reagent (eg, .sup.18F-fluorodeoxyglucose (FDG)) in a detectable manner, to determine the levels and/or distributions of IL-17 and TNF-α.

    [0206] In one embodiment, the present invention provides a diagnostic kit comprising the fusion protein described herein and instructions for use.

    [0207] In another aspect, the present invention relates to the use of fusion proteins in vivo to treat or prevent diseases that require enhanced biological activities of IL-17 and TNF-α in an individual, thereby inhibiting or reducing the occurrence or relapse of related diseases such as autoimmune diseases. The fusion protein can be used alone to suppress or prevent the occurrence of autoimmune diseases. Alternatively, the fusion protein may be administered in combination with other autoimmune disease treatment/preventive agents. When the fusion protein of the present invention is administered in combination with one or more other drugs, the components in this combination can be administered in any order or simultaneously

    [0208] Thus, in one embodiment, the present invention provides a method of inhibiting the occurrence of autoimmune diseases in an individual, comprising administering to the individual a therapeutically effective amount of the fusion protein described herein. In another embodiment, the present invention provides a method of preventing the occurrence or recurrence of an autoimmune disease in an individual, comprising administering to the individual a prophylactically effective amount of the fusion protein described herein.

    [0209] In some embodiments, autoimmune diseases treated and/or prevented with the fusion protein of the present invention include, but are not limited to: autoimmune rheumatoid arthritis, lupus, myasthenia gravis, ankylosing spondylitis, hyperthyroidism, hypothyroidism, ulcerative colitis, Crohn's disease, heart valve disease, multiple sclerosis, scleroderma, and autoimmune hepatitis, more preferably rheumatoid arthritis, ankylosing spondylitis, psoriasis, and ulcerative colitis.

    [0210] The disease related to the biological activity of IL-17 in the present invention means a disease related to excessive level or activity of IL-17, wherein atypical symptoms may be manifested locally and/or systemically in the body due to the level or activity of IL-17. Examples of diseases related to IL-17 biological activity include: atopic dermatitis, allergic rhinitis, asthma, fibrosis, inflammatory bowel disease, Crohn's disease, pneumonic disease, pulmonary fibrosis, idiopathic pulmonary fiber (IPF), chronic obstructive pulmonary disease (COPD), liver fibrosis, respiratory diseases, cancer, glioblastoma, and non-Hodgkin's lymphoma. In any of the embodiments described herein, respiratory diseases may be selected from the group consisting of asthma, allergic asthma, non-allergic asthma, bronchitis, chronic bronchitis, chronic obstructive pulmonary disease (COPD), emphysema, cigarette-induced emphysema, airway inflammation, cystic fibrosis, pulmonary fibrosis, allergic rhinitis, and bronchiectasis.

    [0211] The following Examples are described to assist in the understanding of the present invention. It is not intended and should not be construed in any way to limit the scope of protection of the present invention.

    [0212] All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In addition, the materials, methods, and examples described herein are illustrative only and are not intended to be limiting. Other features, objects, and advantages of the invention will be derived from the description and drawings, and from the appended claims.

    Specific Embodiments

    EXAMPLE 1

    Construction of a Glutamine Synthetase High-Efficiency Expression Vector Comprising the Gene of Interest

    [0213] (1) Synthesis of a Nucleotide Encoding Anti-IL-17A Antibody BY19.4 as Conrol and Construction of an Expression Vector

    [0214] After optimizing the amino acid sequence of ixekizumab monoclonal antibody under accession number 9467 in the International Nonproprietary Name (INN) database, to suitable for expression in Chinese hamster ovary cancer cells (CHO), the following nucleotide sequences were chosen and entrusted to Shanghai Generay Biotech. Co. Ltd. to synthesize. The anti-IL-17A antibody produced after the expression of the nucleotide sequences is designated herein as antibody BY19.4.

    TABLE-US-00008 BY19.4 light chain (BY19.4L) nucleotide sequence (SEQ ID NO: 26):  TCTAGAGCCACCATGGAGACCGACACCCTCCTCCTGTGGGTGCTGCTGCT GTGGGTGCCCGGCTCTACCGGCGACATCGTGATGACTCAGACACCACTGA GCCTGTCTGTGACCCCAGGCCAGCCCGCTTCGATTTCTTGCCGGTCCTCT CGCAGCCTGGTGCACTCTAGGGGCAACACATACCTCCACTGGTATCTACA GAAGCCCGGCCAGTCCCCTCAGCTGCTGATCTACAAGGTGTCTAACAGGT TCATTGGCGTGCCCGACCGCTTCTCCGGCTCTGGCAGCGGCACCGACTTC ACACTCAAGATTAGCAGAGTGGAGGCTGAGGACGTGGGCGTGTACTACTG CTCTCAGTCTACCCACCTCCCTTTCACATTCGGCCAGGGCACAAAGGTGG AGATCAAGCGGACCGTGGCCGCCCCATCCGTGTTCATTTTCCCACCTTCC GACGAGCAGCTGAAGTCTGGCACCGCCAGCGTGGTGTGCCTGCTGAACAA CTTCTACCCCCGCGAGGCCAAGGTGCAGTGGAAGGTGGACAACGCCCTGC AGAGCGGCAACAGCCAGGAGAGCGTGACCGAGCAGGACTCCAAGGACAGC ACCTACAGCCTGAGCAGCACCCTGACCCTGAGCAAGGCCGACTACGAGAA GCACAAGGTGTACGCCTGCGAGGTGACCCACCAGGGACTGTCTAGCCCCG TGACCAAGAGCTTCAACCGGGGCGAGTGCTAAGAATTGTCGAC BY19.4 light chain (BY19.4L) amino acid sequence (SEQ ID NO: 27), as first subunit:  METDTLLLWVLLLWVPGSTGDIVMTQTPLSLSVTPGQPASISCRSSRSLV HSRGNTYLHWYLQKPGQSPQLLINKVSNRFIGVPDRITSGSGSGTDFTLK ISRVEAEDVGVYYCSQSTHLPFTFGQGTKVEIKRTVAAPSVFIFPPSDEQ LKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYS LSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC BY19.4 heavy chain (BY19.4H) nucleotide sequence (SEQ ID NO: 28):  CTCGAGGCCACCATGGAGACCGACACACTCCTCCTGTGGGTGCTGCTGCT CTGGGTGCCAGGCAGCACCGGCCAGGTGCAGCTCGTGCAGAGCGGCGCCG AGGTGAAGAAGCCCGGCTCTTCTGTGAAGGTGTCTTGCAAGGCTTCCGGC TACTCTTTCACCGACTACCACATTCACTGGGTGCGCCAGGCTCCTGGCCA GGGCCTTGAGTGGATGGGCGTGATTAACCCFATGTACGGCACAACAGACT ACAACCAGCGGTTCAAGGGCAGAGTGACCATTACAGCCGACGAGTCCACA TCCACCGCTTACATGGAGCTGTCCTCCCTGCGTTCTGAGGACACTGCTGT GTACTACTGCGCTAGATACGACTACTTCACCGGCACTGGCGTGTACTGGG GCCAGGGCACACTCGTGACCGTGTCTAGCGCATCAACAAAGGGCCCATCT GTGTTCCCACTCGCCCCATGCTCCCGCTCCACCTCCGAGTCCACCGCCGC CCTGGGCTGCCTGGTGAAGGACTACTTCCCTGAGCCTGTGACCGTGTCCT GGAACTCCGGCGCCCTGACCTCCGGCGTGCACACCTTCCCTGCCGTGCTG CAGTCCTCCGGCCTGTACTCCCTGTCCTCCGTGGTGACCGTGCCTTCCTC CTCCCTGGGCACCAAGACCTACACCTGCAACGTGGACCACAAGCCTTCCA ACACCAAGGTGGACAAGCGCGTGGAGTCCAAGTACGGCCCTCCTTGCCCT CCTTGCCCTGCCCCTGAGTTCCTGGGCGGCCCTTCCGTGTTCCTGTTCCC TCCTAAGCCTAAGGACACCCTGATGATCTCCCGCACCCCTGAGGTGACCT GCGTGGTGGTGGACGTGTCCCAGGAGGACCCTGAGGTGCAGTTCAACTGG TACGTGGACGGCGTGGAGGTGCACAACGCCAAGACCAAGCCTCGCGAGGA GCAGTTCAACTCCACCTACCGCGTGGTGTCCGTGCTGACCGTGCTGCACC AGGACTGGCTGAACGGCAAGGAGTACAAGTGCAAGGTGTCCAACAAGGGC CTGCCTTCCTCCATCGAGAAGACCATCTCCAAGGCCAAGGGCCAGCCTCG CGAGCCTCAGGTGTACACCCTGCCTCCTTCCCAGGAGGAGATGACCAAGA ACCAGGMTCCCTGACCTGCCTGGTGAAGGGCTTCTACCCTTCCGACATCG CCGTGGAGTGGGAGTCCAACGGCCAGCCTGAGAACAACTACAAGACCACC CCTCCTGTGCTGGACTCCGACGGCTCCTTCTTCCTGTACTCCCGCCTGAC CGTGGACAAGTCCCGCTGGCAGGAGGGCAACGTGTTCTCCTGCTCCGTGA TGCACGAGGCCCTGCACAACCACTACACCCAGAAGTCCCTGTCCCTGTCC CTGGGCTAAGAATTC BY19.4 heavy chain (BY19.4H) amino acid sequence (SEQ ID NO: 29), as second subunit:  METDTLLLWVLLLWVPGSTGQVQLVQSGAENTIKKPGSSVKVSCIKASGY SFTDYHIFIWVRQAPGQGLEWMGVINPMYGTIDYNQRFKGRVMTADESTS TAYMELSSLRSEDTAVYYCARYDYFTGTGVYWGQGTLVTVSSASTKGPSV FPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTIFPAVL QSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCP PCPAPEFLGGPSVFLYPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNW YVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKG LPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDI AVENVESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNWSCSV MHEALENHYTQKSLSLSLG wherein the underlined “METDTLLLWVLLLWVPGSTG” is the signal peptide sequence. 

    [0215] Shanghai Generay Biotech. Co. Ltd. synthesized the above BY19.4 light chain (BY19.4L) encoding nucleotide sequence, and BY19.4 heavy chain (BY19.4H) encoding nucleotide sequence. The BY19.4L encoding nucleotide sequence and a glutamine synthetase high-efficiency expression vector with dual expression cassettes(Chinese patent No. CN104195173B, obtained from Beijing Beyond Biotechnology Co., Ltd) were double digested with XbaI-SalI respectively. Then, the XbaI-SalI double-digested BY19.4H encoding nucleotide was ligated into the XbaI-SalI double-digested expression vector by using ligase, to introduce BY19.4L encoding nucleotide into the expression vector. The BY19.4H encoding nucleotide sequence and the expression vector with introduced BY19.4L encoding nucleotide were double digested with XhoI-EcoRI respectively. Then, the XhoI-EcoRI double-digested BY19.4H encoding nucleotide was ligated into the XhoI-EcoRI double-digested expression vector by using ligase, to introduce BY19.4H encoding nucleotide into the expression vector, thus both BY19.4L encoding nucleotide and BY19.4H encoding nucleotide were introduced into the glutamine synthetase high-efficiency expression vector with dual expression cassettes. After sequencing to confirm a correct expression would be achieved, the expression vector of anti-IL-17 antibody BY19.4 was obtained.

    [0216] Alternatively, the expression vector of anti-IL-17 antibody BY19.4 can be obtained by ligating BY19.4L encoding nucleotide into a glutamine synthetase high-efficiency expression vector with dual expression cassettes having BY19.4H encoding nucleotide introduced therein, to express and obtain antibody BY19.4.

    [0217] (2) Synthesis of Exemplary Fusion Protein Encoding Nucleotides and Construction of Expression Vectors

    [0218] After optimizing the heavy chain variable region and light chain variable region sequences of the anti-IL-17 antibody in Table 1, the light chain constant region sequences of the antibody in Table 2, the heavy chain constant region sequences of the antibody in Table 3, the TNFR extracellular region sequences in Table 4, and the linker peptide sequences of SEQ ID NOs: 30-58, to suitable for expression in Chinese hamster ovary cancer cells (CHO), the following polynucleotide sequences of SEQ ID NOs: 59, 61, 63, 65, 67, 69, 71, 73 were chosen and entrusted to Shanghai Generay Biotech. Co. Ltd. to synthesize.

    TABLE-US-00009 First subunit nucleotide sequence of fusion protein BY19.3(κ, IgG4):  (SEQ ID NO: 59) TCTAGAGCCACCATGGAGACCGACACCCTCCTCCTGTGGGTGCTGCTGCTGTGGGTGCCCGGCTCTA CCGGCGACATCGTGATGACTCAGACACCACTGAGCCTGTCTGTGACCCCAGGCCAGCCCGCTTCGAT TTCITGCCGGTCCTCTCGCAGCCTGGTGCACTCTAGGGGCAACACATACCTCCACTGGTATCTACAG AAGCCCGGCCAGTCCCCTCAGCTGCTGATCTACAAGGTGTCTAACAGGTTCATTGGCGTGCCCGACC GCTTCTCCGGCTCTGGCAGCGGCACCGACTTCACACTCAAGATTAGCAGAGTGGAGGCTGAGGACGT GGGCGTGTACTACTGCTCTCAGTCTACCCACCTCCCTTTCACATTCGGCCAGGGCACAAAGGTGGAG ATCAAGCGGACCGTGGCCGCCCCATCCGTGTTCATTTTCCCACCTTCCGACGAGCAGCTGAAGTCTG GCACCGCCAGCGTGGTGTGCCTGCTGAACAACTTCTACCCCCGCGAGGCCAAGGTGCAGTGGAAGGT GGACAACGCCCTGCAGAGCGGCAACAGCCAGGAGAGCGTGACCGAGCAGGACTCCAAGGACAGCACC TACAGCCTGAGCAGCACCCTGACCCTGAGCAAGGCCGACTACGAGAAGCACAAGGTGTACGCCTGCG AGGTGACCCACCAGGGACTGTCTAGCCCCGTGACCAAGAGCTTCAACCGGGGCGAGTGCTAAGAATT GTCGAC First subunit amino acid sequence of fusion protein BY19.3(κ, IgG4):  (SEQ ID NO: 60 = SEQ ID NO: 27) METDTLLLWVLLLWVPGSTGDWMTQTPLSLSVTPGQPASISCRSSRSLVHSRGNTYLHWYLQKPGQS PQLIAYKVSNRFIGVPDRFSGSGSGMFTLKISRVEAEDVGWYCSQSTHLPFItGQGTKVEIKRTVAA PSWIFPPSDEQLKSGTASVVCLLINNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL TLLSKADYEKHKVYACENTTHQGLSSPVTKSFNRGEC Second subunit nucleotide sequence of fusion protein BY19.3(κ, IgG4):  (SEQ ID NO: 61) CTCGAGGCCACCATGGAGACCGACACACTCCTCCTGTGGGTGCTGCTGCTCTGGGTGCCAGGCAGCA CCGGCCAGGTGCAGCTCGTGCAGAGCGGCGCCGAGGTGAAGAAGCCCGGCTCTTCTGTGAAGGTGTC TTGCAAGGCTTCCGGCTACTCTTTCACCGACTACCACATTCACTGGGTGCGCCAGGCTCCTGGCCAG GGCCTTGAGTGGATGGGCGTGATTAACCCTATGTACGGCACAACAGACTACAACCAGCGGTTCAAGG GCAGAGTGACCATTACAGCCGACGAGTCCACATCCACCGCTTACATGGAGCTGTCCTCCCTGCGTTC TGAGGACACTGCTGTGTACTACTGCGCTAGATACGACTACTTCACCGGCACTGGCGTGTACTGGGGC CAGGGCACACTCGTGACCGTGTCTAGCGCATCAACAAAGGGCCCATCTGTGTTCCCACTCGCCCCAT GCTCCCGCTCCACCTCCGAGTCCACCGCCGCCCTGGGCTGCCTGGTGAAGGACTACTTCCCTGAGCC TGTGACCGTGTCCTGGAACTCCGGCGCCCTGACCTCCGGCGTGCACACCTTCCCTGCCGTGCTGCAG TCCTCCGGCCTGTACTCCCTGTCCTCCGTGGTGACCGTGCCTTCCTCCTCCCTGGGCACCAAGACCT ACACCTGCAACGTGGACCACAAGCCTTCCAACACCAAGGTGGACAAGCGCGTGGAGTCCAAGTACGG CCCTCCTTGCCCTCCTTGCCCTGCCCCTGAGTTCCTGGGCGGCCCTTCCGTGTTCCTGTTCCCTCCT AAGCCTAAGGACACCCTGATGATCTCCCGCACCCCTGAGGTGACCTGCGTGGTGGTGGACGTGTCCC AGGAGGACCCTGAGGTGCAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCACAACGCCAAGACCAA GTCCTCGCGAGGAGCAGTTCAACTCCACCTACCGCGTGGTGTCCGTGCTGACCGTGCTGCACCAGGA CTGGCTGAACGGCAAGGAGTACAAGTGCAAGGTGTCCAACAAGGGCCTGCCTTCCTCCATCGAGAAG ACCATCTCCAAGGCCAAGGGCCAGCCTCGCGAGCCTCAGGTGTACACCCTGCCTCCTTCCCAGGAGG AGATGACCAAGAACCAGGTGTCCCTGACCTGCCTGGTGAAGGGCTTCTACCCTTCCGACATCGCCGT GGAGTGGGAGTCCAACGGCCAGCCTGAGAACAACTACAAGACCACCCCTCCTGTGCTGGACTCCGAC GGCTCCTTCTTCCTGTACTCCCGCCTGACCGTGGACAAGTCCCGCTGGCAGGAGGGCAACGTGTTCT CCTGCTCCGTGATGCACGAGGCCCTGCACAACCACTACACCCAGAAGTCCCTGTCCCTGTCCCTGGG CGGCGGAGGATCTGGCGGCGGAGGCAGTGGAGGCGGCGGAAGCCTGCCCGCACAAGTGGCCTTCACC CCCTACGCCCCAGAGCCCGGCTCTACTTGTAGGCTGAGGGAGTACTACGACCAGACCGCCCAGATGT GCTGCTCCAAGTGTAGCCCCGGACAGCACGCCAAGGTGTTCTGTACAAAGACCTCCGACACCGTGTG CGACTCCTGCGAGGACTCCACCTACACCCAGCTGTGGAACTGGGTGCCCGAGTGCCTGTCCTGCGGC TCCAGGTGCTCCTCTGACCAGGTCGAGACCCAAGCCTGTACCAGGGAGCAGAACAGGATCTGCACTT GCAGGCCAGGCTGGTATTGCGCCCTGTCCAAGCAGGAAGGCTGCAGGCTGTGCGCCCCACTGAGGAA ATGTAGGCCTGGGTTCGGCGTGGCTAGGCCCGGAACCGAGACTTCCGACGTGGTGTGCAAGCCCTGT GCCCCTGGCACCTTTTCCAACACCACCTCCTCCACCGACATCTGTAGGCCACACCAGATTTAAGAAT TC Second subunit amino acid sequence of fusion protein BY193(κ, IgG4):  (SEQ ID NO: 62) METDTLLLWVLLLWVPGSTGQVQLVQSGAENTICKPGSSVKVSCKASGYSFIDYHIHATVRQAPGQG LEWMGVINPMYGTIDYNQRFKGRVITITADESTSTAYMELSSLRSEDTAVYYCARYDYFTGTGVYWG QGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLNKMTPEPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSVVTVPSSSLGTKTYTCNNTDFIKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFP PMPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQPNSTYRVVSVLTVLHQ DWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLNKGFYPSDIA VEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSL GGGGSGGGGSGGGGSLPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTV CDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLR KCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQI First subunit nucleotide sequence of fusion protein BY19.5(κ, IgG1):  (SEQ ID NO: 63) TCTAGAGCCACCATGGAGACCGACACCCTCCTCCTGTGGGTGCTGCTGCTGTGGGTGCCCGGCTCTA CCGGCGAGATCGTGCTGACTCAGTCTCCAGGCACACTGTCTCTGTCCCCTGGCGAGCGCGCfACACT GTCTTGCAGAGCTTCTCAGTCCGTGAGCAGCTCTTACCTCGCTTGGTATCAGCAGAAGCCTGGCCAG GCCCCTAGACTCCTGATATACCGCGCCTCGTCTAGGGCTACAGGCATTCCCGACAGGTTCTCCGGCT CTGGCAGCGGCACCGACTTCACACTCACTATTAGCCGCCTAGAACCTGAGGACTTCGCCGTGTACTA CTGCCAGCAGTACGGCTCTAGCCCATGCACATTCGGCCAGGGCACAAGACTTGAGATCAAGAGGACC GTGGCCGCCCCCAGCGTGTTCATCTTCCCTCCCAGCGACGAGCAGCTGAAGTCTGGCACCGCCAgCG TGGTGTGCCTGCTGAACAACTTCTACCCCCGCGAGGCCAAGGTGCAGTGGAAGGTGGACAACGCCCT GCAgAGCGGCAACAGCCAGGAGAGCGTGACCGAGCAGGACTCCAAGGACAGCACCTACAGCCTGAGC AGCACCCTGACCCTGAGCAAGGCCGACTACGAGAAGCACAAGGTGTACGCCTGCGAGGTGACCCACC AGGGACTGTCTAGCCCCGTGACCAAGAGCTTCAACCGGGGCGAGTGCTAAGTCGAC First subunit amino acid sequence of fusion protein  BY19.5(κ, IgG1):  (SEQ ID NO: 64) METDTLLLWVLLLWVPGSTGEIVLTQSPGTLSLSPGERATLSCRASQSVSSSVLAWYQQKPGQAPRL LIYGASSRATGIPDRFSGSGSGTDFILTISRLEPEDFAVYYCQQYGSSPCTFGQGTRLEIKRTVAAP SWIFPPSDEQLKSGTASVVCLLNNTYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Second subunit nucleotide sequence of fusion protein BY19.5(κ, IgG1):  (SEQ ID NO: 65) CTCGAGGCCACCATGGAGACCGACACACTCCTCCTGTGGGTGCTGCTGCTCTGGGTGCCAGGCAGCA CCGGCGAGGTGCAGTTGGTGGAGTCCGGCGGCGGCCTCGTGCAGCCAGGCGGCTCCCTGAGACTGTC TTGCGCCGCTTCCGGCTTCACTTTCTCTAACTACTGGATGAACTGGGTGAGACAGGCTCCAGGCAAG GGCCTTGAGTGGGTGGCCGCTATCAACCAGGACGGCTCCGAGAAGTACTATGTGGGCTCTGTGAAGG GCAGATTCACAATTAGCCGCGACAACGCTAAGAACAGCCTGTACTTACAGATGAACTCTCTCAGAGT GGAGGACACAGCTGTGTACTACTGCGTGCGGGACTACTACGACATCCTGACCGACTACTACATTCAC TACTGGTACTTCGACCTCTGGGGCAGAGGCACTCTGGTCACCGTGAGCTCCGCCAGCACCAAGGGCC CCAGCGTCTTCCCACTGGCTCCTTCCTCTAAAAGCACTAGCGGAGGGACCGCAGCCCTGGGCTGTCT GGTGAAAGACTACTTTCCCCGAGCCCGTGACCGTCTCCTGGAACTCTGGAGCCCTGACCTCCGGGGT GCACACCTTTCCCGCCGTGCTGCAGTCTTCTGGACTGTACTCCCTGTCCTCCGTCGTGACTGTGCCC AGCTCCTCCCTGGGAACTCAGACATACATCTGCAACGTGAACCACAAGCCTTCCAACACAAAGGTGG ACAAGAGAGTCGAGCCCAAGAGCTGTGATAAGACCCATACATGTCCCCCATGCCCCGCTCCAGAACT GCTGGGCGGACCTTCCGTGTTTCTGTTCCCACCCAAACCAAAGGACACACTGATGATCAGCAGAACC CCTGAGGTGACTTGCGTGGTCGTGGACGTGAGCCATGAGGACCCCGAGGTGAAGTTCAACTGGTATG TGGATGGCGTGGAAGTGCATAATGCCAAGAGAAAACCTAGGGAAGAGCAGTACAACAGCACCTACAG GGTGGTGAGCGTGCTGACCGTGCTGCACCAGGATTGGCTGAACGGCAAGGAATACAAGTGCAAGGTG TCCAATAAGGCTCTGCCTGCACCTATCGAGAAGACCATCAGCAAAGCCAAGGGCCAACCCAGAGAGC CTCAAGTCTACACCCTGCCCCCAAGCAGGGAGGAGATGACCAAAAATCAAGTGAGCCTGACATGCCT GGTCAAAGGCTTCTACCCTAGCGACATCGCCGTGGAGTGGGAGAGCAATGGCCAGCCTGAGAACAAC TACAAGACCACTCCCCCCGTCCTGGATAGCGACGGCAGCTTCTTCCTGTACTCCAAACTGACAGTCG ATAAAAGCAGGTGGCAGCAAGGCAATGTCTTTAGCTGTAGCGTGATGCACGAGGCCCTGCATAACCA CTACACTCAAAAGTCCCTGTCCCTGAGCCCCGGAGGCGGAGGATCTGGCGGCGGAGGCAGTGGAGGC GGCGGAAGCCTGCCTGCTCAGGTGGCATTCACCCCATACGCTCCTGAGCCTGGCTCAACTTGTAGGC TGAGAGAGTACTACGACCAGACCGCCCAGATGTGCTGTTCCAAGTGCAGTCCTGGACAGCACGCTAA GGTGTTTTGCACAAAGACTTCCGATACCGTGTGCGATAGTTGTGAGGACAGTACTTACACTCAGCTG TGGAATTGGGTGCCAGAGTGTCTCTCTTGCGGCAGTAGATGTTCTTCCGATCAGGTCGAGACACAGG CTTGCACTCGCGAGCAGAATCGCATTTGCACATGTCGGCCAGGATGGTACTGCGCTCTGTCTAAGCA GGAGGGCTGTAGACTCTGCGCCCCTCTCCGCAAGTGCCGCCCCGGATTCGGCGTCGCACGGCCCGGA ACCGAGACTAGCGACGTCGTCTGCAAGCCATGCGCTCCCGGAACCTTTAGTAATACAACATCTTCTA CTGATATTTGTAGGCCTCACCAGATTTGTAACGTGGTGGCAATTCCTGGAAATGCCTCTATGGACGC CGTGTGTACATCTACATCCCCAACTAGAAGTATGGCTCCCGGCGCCGTCCACCTCCCTCAGCCCGTG AGTACTCGGAGTCAGCACACTCAGCCAACACCCGAGCCATCTACCGCACCTTCTACCTCTTTTCTGC TCCCTATGGGACCTAGTCCACCAGCTGAGGGTAGTACTGGCGACTAAGAATTC Second subunit amino acid sequence of fusion protein BY19.5(κ, IgG1):  (SEQ ID NO: 66) METDTLLLWVLLLWVPGSTGEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMNWVRQAPGKGLEW VAAINQDGSEKYYVGSVKGRFTISRDNAKNSLYLQMNSLRVEDTAVYYCVRDYYDILTDYYHTYWYF DLWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGP SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSPCRVVSV LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGF YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQK SLSLSPGGGGSGGGGSGGGGSLPAQVAFTPYAPEPGSTCALREYYDQTAQMCCSKCSPGQHAKVFCT KTSDTVCDSCEDSTYTQLWNWVPECLSCGSRESSDQVETQACTREQNRICTCRPGWYCALSKQEGCR LCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTESNTTSSIDICRPHQICNVVAIPGNASMDAVCTS TSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD First subunit nucleotide sequence of fusion protein BY19.6(κ, IgG1):  (SEQ ID NO: 67) TCTAGAGCCACCATGGAGACCGACACCCTCCTCCTGTGGGTGCTGCTGCTGTGGGTGCCCGGCTCTA CCGGCGACATCGTGATGACTCAGACACCACTGAGCCTGTCTGTGACCCCAGGCCAGCCCGCTTCGAT TTCTTGCCGGTCCTCTCGCAGCCTGGTGCACTCTAGGGGCAACACATACCTCCACTGGTATCTACAG AAGCCCGGCCAGTCCCCTCAGCTGCTGATCTACAAGGTGTCTAACAGGTTCATTGGCGTGCCCGACC GCTTCTCCGGCTCTGGCAGCGGCACCGACTTCACACTCAAGATTAGCAGAGTGGAGGCTGAGGACGT GGGCGTGTACTACTGCTCTCAGTCTACCCACCTCCCTTTCACATTCGGCCAGGGCACAAAGGTGGAG ATCAACTCGGACCGTCTGCCGCCCCATCCGTGTTCATTTTCCCACCTTCCGACGAGCAGCTGAAGTC TGGCACCGCCAGCGTGGTGTGCCTGCTGAACAACTTCTACCCCCGCGAGGCCAAGGTGCAGTGGAAG GTGGACAACGCCCTGCAGAGCGGCAACAGCCAGGAGAGCGTGACCGAGCAGGACTCCAAGGACAGCA CCTACAGCCTGAGCAGCACCCTGACCCTGAGCAAGGCCGACTACGAGAAGCACAAGGTGTACGCCTG CGAGGTGACCCACCAGGGACTGTCTAGCCCCGTGACCAAGAGCTTCAACCGGGGCGAGTGCTAAGAA TTGTCGAC First subunit amino acid sequence of fusion protein BYI9.6(κ, IgG1):  (SEQ ID NO: 68 = SEQ ID NO: 27) METDTLLLWVLLLWVPGSTGDIVMTQTPLSLSVTPGQPASISCRSSRSINHSRGNTYLEIWYLQKPG QSPQLLIYKVSNRHGVPDRFSGSGSGTDFTLKISRVEAEDVGVYNCSQSTHLPFTFGQGTKVEIKRT VAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Second subunit nucleotide sequence of fusion protein  BY19.6(κ, IgG1):  (SEQ ID NO: 69) CTCGAGGCCACCATGGAGACCGACACACTCCTCCTGTGGGTGCTGCTGCTCTGGGTGCCAGGCAGCA CCGGCCTGCCCGCACAAGTGGCCTTCACCCCCTACGCCCCAGAGCCCGGCTCTACTTGTAGGCTGAG GGAGTACTACGACCAGACCGCCCAGATGTGCTGCTCCAAGTGTAGCCCCGGACAGCACGCCAAGGTG TTCTGTACAAAGACCTCCGACACCGTGTGCGACTCCTGCGAGGACTCCACCTACACCCAGCTGTGGA ACTGGGTGCCCGAGTGCCTGTCCTGCGGCTCCAGGTGCTCCTCFGACCAGGTCGAGACCCAAGCCTG TACCAGGGAGCAGAACAGGATCTGCACTTGCAGGCCAGGCTGGTATTGCGCCCTGTCCAAGCAGGAA GGCTGCAGGCTGTGCGCCCCACTGAGGAAATGTAGGCCTGGGTTCGGCGTGGCTAGGCCCGGAACCG AGACTTCCGACGTGGTGTGCAAGCCCTGTGCCCCTGGCACCTTTTCCAACACCACCTCCTCCACCGA CATCTGTAGGCCACACCAGATTGACAAGCGCGTGGAGTCCAAGTACGGCCCTCCTTGCCCTCCTTGC CCTGCCCCTGAGTTCCTGGGCGGCCCTTCCGTGTTCCTGTTCCCTCCTAAGCCTAAGGACACCCTGA TGATCTCCCGCACCCCTGAGGTGACCTGCGTGGTGGTGGACGTGTCCCAGGAGGACCCTGAGGTGCA GTTCAACTGGTACGTGGACGGCGTGGAGGTGCACAACGCCAAGACCAAGCCTCGCGAGGAGCAGTTC AACTCCACCTACCGCGTGGTGTCCGTGCTGACCGTGCTGCACCAGGACTGGCTGAACGGCAAGGAGT ACAAGTGCAAGGTGTCCAACAAGGGCCTGCCTTCCTCCATCGAGAAGACCATCTCCAAGGCCAAGGG CCAGCCTCGCGAGCCTCAGGTGTACACCCTGCCTCCTTCCCAGGAGGAGATGACCAAGAACCAGGTG TCCCTGACCTGCCTGGTGAAGGGCTTCTACCCTTCCGACATCGCCGTGGAGTGGGAGTCCAACGGCC AGCCTGAGAACAACTACAAGACCACCCCTCCTGTGCTGGACTCCGACGGCTCCTTCTTCCTGTACTC CCGCCTGACCGTGGACAAGTCCCGCTGGCAGGAGGGCAACGTGTTCTCCTGCTCCGTGATGCACGAG GCCCTGCACAACCACTACACCCAGAAGTCCCTGTCCCTGTCCCTGGGCGGCGGAGGATCTGGCGGCG GAGGCAGTGGAGGCGGCGGAAGCCAGGTGCAGCTCGTGCAGAGCGGCGCCGAGGTGAAGAAGCCCGG CTCTTCTGTGAAGGTGTCTTGCAAGGCTTCCGGCTACTCTTTCACCGACTACCACATTCACTGGGTG CGCCAGGCTCCTGGCCAGGGCCTTGAGTGGATGGGCGTGATTAACCCTATGTACGGCACAACAGACT ACAACCAGCGGTTCAAGGGCAGAGTGACCATTACAGCCGACGAGTCCACATCCACCGCTTACATGGA GCTGTCCTCCCTGCGTTCTGAGGACACTGCTGTGTACTACTGCGCTAGATACGACTACTTCACCGGC ACTGGCGTGTACTGGGGCCAGGGCACACTCGTGACCGTGTCTAGCGCATCAACAAAGGGCCCATCTG TGTTCCCACTCGCCCCATGCTCCCGCTCCACCTCCGAGTCCACCGCCGCCCTGGGCTGCCTGGTGAA GGACTACTTCCCTGAGCCTGTGACCGTGTCCTGGAACTCCGGCGCCCTGACCTCCGGCGTGCACACC TTCCCTGCCGTGCTGCAGTCCTCCGGCCTGTACTCCCTGTCCTCCGTGGTGACCGTGCCTTCCTCCT CCCTGGGCACCAAGACCTACACCTGCAACGTGGACCACAAGCCTTCCAACACCAAGGTGGACAAGCG CGTGGAGTCCTAAGAATTC Second subunit amino acid sequence of fusion protein  BY19.6(κ, IgG1):  (SEQ. ID NO: 70) METDTLLLWVLLLWVPGSTGLPAQVAFTPLAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTK TSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRL CAPIRKCRPGFGVARPGTETSDVVCKPCAPGEtSNTTSSTDICRPHQIDKRVESKYGPPCPPCPAPE FLGGPSWLITPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTTT VVSVLTVLHQDWINGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTUTSQEEMTKNQVSLTCLN KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVIFSCSVMHEALHNH YTQKSLKSLGGGGSGGGGSGGGGSQVQLVQSGAEVKKPGSSVKVSCKASGYSFTDYHIHWVRQAPGQ GLEWMGVINPMYGTTDYNQRFKGRVTITADESTSTAYMELSSLRSEDTAWYCARYDYFTGTGVYWGQ GTLNTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVES Second subunit nucleotide sequence of fusion protein BY19.7(κ, IgG1):  (SEQ ID NO: 71) TCTAGAGCCACCATGGAGACCGACACACTCCTCCTGTGGGTGCTGCFGCTCTGGGTGCCAGGCAGCA CCGGCCAGGTGCAGCTCGTGCAGAGCGGCGCCGAGGTGAAGAAGCCCGGCTCTTCTGTGAAGGTGTC TTGCAAGGCTTCCGGCTACTCTTTCACCGACTACCACATTCACTGGGTGCGCCAGGCTCCTGGCCAG GGCCTTGAGTGGATGGGCGTGATTAACCCTATGTACGGCACAACAGACTACAACCAGCGGTTCAAGG GCAGAGTGACCATTACAGCCGACGAGTCCACATCCACCGCTTACATGGAGCTGTCCTCCCTGCGTTC TGAGGACACTGCTGTGTACTACTGCGCTAGATACGACTACTTCACCGGCACTGGCGTGTACTGGGGC CAGGGCACACTCGTGACCGTGTCTAGCGCATCAACAAAGGGCCCATCTGTGTTCCCACTCGCCCCAT GCTCCCGCTCCACCTCCGAGTCCACCGCCGCCCTGGGCTGCCTGGTGAAGGACTACTTCCCTGAGCC TGTGACCGTGTCCTGGAACTCCGGCGCCCTGACCTCCGGCGTGCACACCTTCCCTGCCGTGCTGCAG TCCTCCGGCCTGTACTCCCTGTCCTCCGTGGTGACCGTGCCTTCCTCCTCCCTGGGCACCAAGACCT ACACCTGCAACGTGGACCACAAGCCTTCCAACACCAAGGTGGACAAGCGCGTGGAGTCCTAAGTCGA C Second subunit amino acid sequence of fusion protein BY19.7(κ, IgG1):  (SEQ ID NO: 72) METDTLLLWVLLLWVPGSTGQVQLVQSGAEVKKPGSSVKVSCKASGYSFTDYHIHNVVRQAPGQGLE WMGVINPMYGTTDYNQRFKGRVTITADESTSTAYMELSSLRSEDTAVYYCARYDYFIGTGVYWCQGT LVTVSSASTKGPSWPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTPAVLQSSGLY SLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVES First subunit nucleotide sequence of fusion protein BY19.7(κ, IgG1):  (SEQ ID NO: 73) CTCGAGGCCACCATGGAGACCGACACACTCCTCCTGTGGGTGCTGCTGCTCTGGGTGCCAGGCAGCA CCGGCCTGCCCGCACAAGTGGCCTTCACCCCCTACGCCCCAGAGCCCGGCTCTACTTGTAGGCTGAG GGAGTACTACGACCAGACCGCCCAGATGTGCTGCTCCAAGTGTAGCCCCGGACAGCACGCCAAGGTG TTCTGTACAAAGACCTCCGACACCGTGTGCGACTCCTGCGAGGACTCCACCTACACCCAGCTGTGGA ACTGGGTGCCCGAGTGCCTGTCCTGCGGCTCCAGGTGCTCCTCTGACCAGGTCGAGACCCAAGCCTG TACCAGGGAGCAGAACAGGATCTGCACTTGCAGGCCAGGCTGGTATTGCGCCCTGTCCAAGCAGGAA GGCTGCAGGCTGTGCGCCCCACTGAGGAAATGTAGGCCTGGGTTCGGCGTGGCTAGGCCCGGAACCG AGACTTCCGACGTGGTGTGCAAGCCCTGTGCCCCTGGCACCTTTTCCAACACCACCTCCTCCACCGA CATCTGTAGGCCACACCAGATTGACAAGCGCGTGGAGTCCAAGTACGGCCCTCCTTGCCCTCCTTGC CCTGCCCCTGAGTTCCTGGGCGGCCCTTCCGTGTTCCTGTTCCCTCCTAAGCCTAAGGACACCCTGA TGATCTCCCGCACCCCTGAGGTGACCTGCGTGGTGGTGGACGTGTCCCAGGAGGACCCTGAGGTGCA GTCAACTGGTACGTGGACGGCGTGGAGGTGCACAACGCCAAGACCAAGCCTCGCGAGGAGCAGTTCA ACTCCACCTACCGCGTGGTGTCCGTGCTGACCGTGCTGCACCAGGACTGGCTGAACGGCAAGGAGTA CAAGTGCAAGGTGTCCAACAAGGGCCTGCCTTCCTCCATCGAGAAGACCATCTCCAAGGCCAAGGGC CAGCCTCGCGAGCCTCAGGTGTACACCCTGCCTCCTTCCCAGGAGGAGATGACCAAGAACCAGGTGT CCCTGACCTGCCTGGTGAAGGGCTTCTACCCTTCCGACATCGCCGTGGAGTGGGAGTCCAACGGCCA GCCTGAGAACAACTACAAGACCACCCCTCCTGTGCTGGACTCCGACGGCTCCTTCTTCCTGTACTCC CGCCTGACCGTGGACAAGTCCCGCTGGCAGGAGGGCAACGTGTTCTCCTGCFCCGTGATGCACGAGG CCCTGCACAACCACTACACCCAGAAGTCCCTGTCCCTGTCCCTGGGCGGCGGAGGATCTGGCGGCGG AGGCAGTGGAGGCGGCGGAAGCGACATCGTGATGACTCAGACACCACTGAGCCTGTCTGTGACCCCA GGCCAGCCCGCTTCGATTTCTTGCCGGTCCTCTCGCAGCCTGGTGCACTCTAGGGGCAACACATACC TCCACTGGTATCTACAGAAGCCCGGCCAGTCCCCTCAGCTGCTGATCTACAAGGTGTCTAACAGGTT CATTGGCGTGCCCGACCGCTTCTCCGGCTCTGGCAGCGGCACCGACTTCACACTCAAGATTAGCAGA GTGGAGGCTGACTGACGTGGGCGTGTACTACTGCTCTCAGTCTACCCACCTCCCTTTCACATTCGGC CAGGGCACAAAGGTGGAGATCAAGCGGACCGTGGCCGCCCCATCCGTGTTCATTTTCCCACCTTCCG ACGAGCAGCTGAAGTCTGGCACCGCCAGCGTGGTGTGCCTGCTGAACAACTTCTACCCCCGCGAGGC CAAGGTGCAGTGGAAGGTGGACAACGCCCTGCAGAGCGGCAACAGCCAGGAGAGCGTGACCGAGCAG GACTCCAAGGACAGCACCTACAGCCTGAGCAGCACCCTGACCCTGAGCAAGGCCGACTACGAGAAGC ACAAGGTGTACGCCTGCGAGGTGACCCACCAGGGACTGTCTAGCCCCGTGACCAAGAGCTTCAACCG GGGCGAGTGCTAAGAATTC First subunit amino acid sequence of fusion protein BY19.7(κ, IgG1):  (SEQ ID NO: 74) METDTLLLWVLLLWVPGSTGLPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTK TSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRL CAPLRKCRPGFGVARPGIETSDVVCKPCAPGTFSNTTSSTDICRPHQIDKRVESKYGPPCPPCPAPE FLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTY RVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFELYSRLTVDKSRWQEGNVFSCSVMHEALHN HYTQKSLSLSLGGGGSGGGGSGGGGSDIVMTQTPLSLSVTPGQPASISCRSSRSLVHSRGNTYLHWY LQKPGQSPQLLIYKVSNRFIGVPDRFSGSGSGIDFTLKISRVEAEDVGVYYCSQSTHLPFTFGQGTK VEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKD STYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

    [0219] Using the similar method as in Example 1(1) above, each of the nucleotides encoding the above first subunits (SEQ ID NOs: 59, 63, 67, 73) and a glutamine synthetase high-efficiency expression vector with dual expression cassettes(Chinese patent No. CN104195173B, obtained from Beijing Beyond Biotechnology Co., Ltd) were double digested with XbaI-SalI respectively and linked together. Then each of the XhoI-EcoRI double-digested second subunit encoding nucleotide (SEQ ID NO: 61, 65, 69, or 71) was respectively cloned into the expression vector previously linked with the corresponding nucleotide encoding the first subunit; or vice versa. After sequenced, the recombinant vectors were to be expressed. The expressed fusion proteins were designated as fusion proteins BY19.3, BY19.5, BY 19.6, BY19.7.

    EXAMPLE 2

    Expression and Purification of Fusion Proteins

    [0220] (1) Transient Expression of Fusion Protein

    [0221] 293F cell (purchased from Invitrogen, catalog number: 11625-019) was suspended and cultured in serum-free CD 293 medium (purchased from Invitrogen, catalog number: 11913-019). Before transfection, the cultured cell was centrifuged to obtain a cell pellet, suspended and adjusted the cell concentration to 1×10.sup.6 cells/ml in a fresh serum-free CD 293 medium, then placed in a shake flask. Taking 100 ml of cell suspension as an example, 250 ug of each of the recombinant expression vectors of fusion proteins BY19.3-BY19.7 prepared in Example 1 as plasmid DNA and 500 ug of polyethylenimine (PEI) (Sigma, catalog number: 408727) were added to 1 ml serum-free CD 293 medium and mixed well. After at room temperature for 8 minutes, the PEI/DNA suspension was added dropwise to the shake flask with 100 ml cell suspension. Mixed gently and placed at 37° C., 5% CO.sub.2 for shaking (120 rpm) culture. 5 days later, the culture supernatant was collected.

    [0222] In this way, antibodies BY19.3 (as control), BY19.4, BY19.5, BY19.6, BY19.7 were transiently expressed.

    [0223] (2) Purification of the Expressed Proteins

    [0224] The fusion protein in the culture supernatant collected in above Example 2 (1) was purified using 1 ml HiTrap MabSelect SuRe column (GE Healthcare Life Sciences, catalog number: 11-0034-93) equilibrated with pH 7.4 PBS solution. Briefly, the 1 ml HiTrap MabSelect SuRe column was equilibrated with 10 column volumes of PBS solution, pH 7.4 at a flow rate of 0.5 ml/min; the culture supernatant collected in above Example 2 (1) was filtered through a 0.45 μm filter membrane and loaded onto the firm HiTrap MabSelect SuRe column equilibrated with PBS solution, pH 7.4; after loading the supernatant, the column was firstly washed with 5-10 column volumes of PBS solution, pH 7.4 at a flow rate of 0.5 ml/min. The expressed protein was then eluted with 100 mM citrate buffer (pH 4.0) at a flow rate of 0.5 ml/min. The fractions in the elution peak was collected, which contained the protein of interest.

    [0225] The purity and molecular weight of the fusion protein were analyzed by SDS-PAGE in the presence of a reducing agent (5 mM 1,4-dithiothreitol) and Coomassie blue staining. The result was shown in FIG. 2. The theoretical predicted and actual measured molecular weights were shown in Table 6. Due to the glycosylation of proteins in the eukaryotic expression system, the actual measured molecular weight was slightly larger than the theoretically predicted one.

    TABLE-US-00010 TABLE 6 The molecular weights of the purified expressed proteins Theoretical Actual predicted measured molecular molecular (Nucleotide) (Amino acid) Protein name Subunit weight (kDa) weight (kDa) SEQ ID NO SEQ ID NO Fusion first subunit 23 25 59 60 protein second 68 75 61 62 BY19.3 subunit Fusion first subunit 23 25 63 64 protein second 76 83 65 66 BY19.5 subunit Fusion first subunit 23 25 67 68 protein second 68 75 69 70 BY19.6 subunit Fusion second 23 75 71 72 protein subunit BY19.7 first subunit 68 25 73 74 Antibody first subunit 23 25 26 27 BY19.4 second 48 50 28 29 subunit

    EXAMPLE 3

    Using Biacore T100 to Determine the Affinities of the Fusion Protein of the Present Invention for TNF-α and IL-17

    [0226] Surface plasmon resonance assay was performed on a BIAcore® T100 instrument (GE Healthcare Biosciences AB, Sweden) at 25° C.

    [0227] First, anti-IgG antibody (GE Healthcare Life Sciences, catalog number: BR-1008-39) was covalently immobilized on the CM5 chip by amide coupling. Briefly, 60 μl N-ethyl-N′-(3-dimethylaminopropyl)carbodiimide hydrochloride (EDC) and 60 μl N-hydroxysuccinimide (NHS) were used to activate the CM5 chip. The anti-NG antibody was diluted by adding 95 μl HBST (0.1M HEPES, 1.5M NaCl, pH7.4, supplemented with 0.005% Tween 20, filtered through 0.2 um filter) as dilution buffer, and covalently fixed on the CM5 chip by amide coupling, to generate a capture system of about 9000-14000 resonance units (RU). The CM5 chip was blocked with 120 μl ethanolamine.

    [0228] Next, the fusion protein (BY19.3, BY19.5, BY19.6, BY19.7) and Yisaipu (TNFR2-Fc fusion protein, Shanghai CITIC Guojian Pharmaceutical Co., Ltd.) and the control antibody BY19.4 were diluted to 5 μg/ml, and injected at a flow rate of 10 μL/min for 2 minutes, respectively, so that the above-mentioned fusion proteins of the invention and antibody BY19.4 were bound to the anti-IgG antibody non-covalently through their respective Fc regions, thus captured on the CM5 chip, generating about 1600RU.

    [0229] Recombinant human TNF-α (Sino Biological Inc., catalog number: 10602-HNAE) and recombinant human IL-17A Sino Biological Inc., catalog number: 12047-H07Y) as antigen for binding were prepared at concentration gradients of 7 nM, 22 nM, 66 nM, 200 nM, 600 nM. Binding was measured by injecting each concentration at a flow rate of 30 μl/min for 180 seconds, then a dissociation time of 600 seconds. The surface was regenerated by washing with 3M MgCl.sub.2 solution at a flow rate of 10 μL/min for 30 seconds. Data analysis was performed using BIA evaluation software (BIAevaluation 4.1 software, from GE Healthcare Biosciences AB, Sweden). The obtained affinity data was in Table 7 below.

    TABLE-US-00011 TABLE 7 Binding of each protein to antigens Protein name Antigen ka (1/Ms) kd (1/s) KD (M) fusion protein TNF-α 9.99E+06 4.77E−04 4.78E−11 BY19.3 IL-17A 7.04E+06 7.67E−05 1.09E−11 fusion protein TNF-α 3.76E+06 7.91E−04 2.11E−10 BY19.5 IL-17A 9.83E+06 1.63E−04 1.66 E−11 Antibody TNF-α — — — BY19.4 IL-17A 7.89E+06 6.79E−04 8.60E−11 fusion protein TNF-α 4.58E+06 3.33E−05 7.27E−12 BY19.6 IL-17/1 6.21E+05 8.36E−04 1.35E−9  fusion protein TNF-α 6.63E+06 4.81E−05 7.25E−12 BY19.7 IL-17A 8.59E+04 7.52E−04 8.75E−9  Yisaipu TNF-α 3.98E+06 2.67E−05 6.70E−12 IL-17A — — —

    [0230] From the data shown in Table 7, the fusion proteins BY19.3 and BY19.5 of the present invention, with TNFR2 at the C-terminus, bound TNF-α and IL-17A with high affinity. Antibody BY19.4 did not bind TNF-α.

    [0231] The fusion protein BY19.3 and antibody BY19.4 have the same N-terminal structure. Biacore results showed that the fusion protein BY19.3 and antibody BY19.4 bound IL-17A with similar affinity (with a difference less than 1 fold).

    [0232] The C-terminus of the fusion protein BY19.5 was the full length of the extracellular domain of TNFR2, while the C-terminus of the fusion protein BY19.3 was the N-terminal fragment of CRD1-CRD2-CRD3-CRD4 (i.e. truncated TNFR2). The binding affinities of the two fusion proteins to TNF-α were similar (with a difference less than 1 fold). It suggested that the truncated form of TNFR2 which was easier to express and purify in the present invention did not affect the affinity for TNF-α.

    [0233] The fusion proteins Yisaipu, BY19.6 and BY19.7, with TNFR2 at N-terminus, had a higher affinity for TNF-α (up to 10.sup.−12M) as compared with those of BY19.3 and BY19.5. However, the fusion proteins BY19.6 and BY19.7 had a lower affinity for IL-17A (10.sup.−9M) as compared with those of BY19.4, BY19.3 and BY19.5. This may be due to the Fab structures in BY19.6 and BY19.7, and the affinity of the Fab structure for IL-17 is lower than that of the full-length antibody to IL-17.

    EXAMPLE 4

    Using Biacore T100 to Determine the Binding Interaction Between Anti-IL 17/TNFR Fusion Protein and TNF-α & IL-17

    [0234] The CM5 chip pretreatment was the same as in Example 3. The anti-IgG antibody (GE Healthcare Life Sciences, catalog number: BR-1008-39) was covalently fixed on the CM5 chip. The BY19.3 protein was diluted to 10 μg/ml, and injected at a flow rate of 10 μL/min for 1 minute. The anti-IgG antibody captured the BY19.3 protein to produce 1600RU; recombinant human TNF-α (Sino Biological Inc., catalog number: 10602-HNAE) was diluted to 80 nM, injected at a flow rate of 20 μL/min for 2 minutes. BY19.3 protein captured recombinant human TNF-α protein, produced 361RU, and reached saturation; then recombinant human IL-17A (Sino Biological Inc., catalog number: 12047-H07Y) was diluted to 80 nM, injected at a flow rate of 20 μL/min for 2 minutes, the chip having hound TNF-α protein and reached saturation state further captured recombinant human IL-17A protein, producing 290RU and reaching saturation. The surface was regenerated by washing with 3M MgCl.sub.2 solution at a flow rate of 10 μL/min for 2 minutes.

    [0235] Results: Biacore T100 detection showed that BY19.3 protein captured by anti-IgG antibody could further bind to IL-17A and reach saturation after binding to TNF-α and reach saturation. It can be seen that with respect to BY19.3 protein, its binding to TNF-α and IL-17A does not interfere with each other.

    EXAMPLE 5

    Synergy of TNF-α and IL-17 on the Expression of CXCL1 and IL-8

    [0236] On the day before the experiment, the cultured HT-29 cells (purchased from the Cell Bank of the Chinese Academy of Sciences) were digested with trypsin-EDTA (purchased from Hyclone), and the digested product was collected. Centrifuged at 1500 rpm for 5 min, discarded the supernatant; then resuspended the cells in 10 ml DMEM/F12 medium (purchased from Hyclone); counted cell density; planted 96-well plate at 100 μl/well (2×10 cells/well); placed in 37° C., 5% CO.sub.2 incubator for overnight cultivation.

    [0237] Recombinant human TNF-α (Sino Biological Inc., catalog number: 10602-HNAE) and recombinant human IL-17A (Sino Biological Inc., catalog number: 12047-H07Y) were freshly prepared on the day of the experiment, respectively. Add to the wells of HT-29 cells planted the day before, and set up 4 groups in the experiment: TNF-α, IL-17A, TNF-α plus IL-17A, and negative control groups, with 6 replicate wells in each group. The final concentration of recombinant human TNF-α is 300 pM, and the final concentration of recombinant human IL-17A is 10 nM, except for the negative control group. Place in an incubator (37° C., 5% CO.sub.2) for 48 h.

    [0238] After the cultivation, the supernatant was collected, and the expression levels of CXCL1 and IL-8 in the supernatant were detected using the CXCL1 ELISA kit (Cat. No: EK0722) and IL-8 kit (Cat. No: EK0413) from Boster Biological Technology co. Ltd.

    [0239] Results:

    [0240] The CXCL1 concentration in the negative control group was 10.6±0.6 pg/ml, in the TNF-α group was 93.2±22.8 pg/ml, in the IL-17 group was 127.2±30.8 pg/ml, and in the TNF-α plus IL-17 group was 1111.4±223.8 pg/ml. The concentrations of CXCL1 in TNF-α group, IL-17 group, and TNF-α plus IL-17 group were significantly higher than that of negative control group (p<0.05). The concentration of CXCL1 in TNF-α plus IL-17 group was significantly higher than those of TNF-α group and IL-17 group (p<0.05).

    [0241] The IL-8 concentration in the negative control group was 29.0±3.6 pg/ml, in the TNF-α group was 223.0±41.3 pg/ml, in the IL-17 group was 43.7±5.2 pg/ml, and in the TNF-α plus IL-17 group was 442.9±56.9 pg/ml. The concentrations of IL-8 in the TNF-α group, IL-17 group, and TNF-α plus IL-17 group were significantly higher than that of negative control group (p<0.05). The concentration of IL-8 in TNF-α plus IL-17 group was significantly higher than those of TNF-α group and IL-17 group (p<0.05).

    [0242] The above results showed that TNF-α alone or IL-17 alone can promote the secretions of CXCL1 and IL-8 by HT-29 cells, and coexistence of TNF-α and IL-17 can significantly and synergistically promote the secretions of of CXCL1 and IL-8 by HT-29 cells.

    [0243] TNF-α, IL-17, CXCL1, and IL-8 are all immune promoting factors that promote the activation of lymphocytes, the chemotaxis of neutrophil granulocytes, and the release of inflammatory factors, which are all closely related to the occurrence and development of autoimmune diseases. This provides a basis for the clinical development of the invention.

    EXAMPLE 6

    Inhibition of Anti-IL-17/TNFR Fusion Protein on the Expression of CXCL1 and IL-8

    [0244] The main reagents and materials of the experiment were basically the same as those in Example 5. The experiment set up 7 groups: BY19.3, BY19.6, BY19.7, BY19.4, Yisaipu (Shanghai CITIC Guojian Pharmaceutical Co., Ltd.), BY19.4+Yisaipu, and negative control groups, with 6 replicate wells in each group. In each group, the final concentration of recombinant human TNF-α was 300 pM, the final concentration of recombinant human IL-17A was 10 nM, the final concentration of BY19.3, BY19.6, BY19.7, BY19.4, and Yisaipu was 40 nM, except for the negative control group. Mixed and placed the plate in an incubator (37° C., 5% CO.sub.2) for 48 h.

    [0245] After the cultivation, the supernatant was collected, and the expression levels of CXCL1 and IL-8 in the supernatant were detected using the CXCL1 ELISA kit (Cat. No: EK0722) and IL-8 kit (Cat. No: EK0413) from Boster Biological Technology co. Ltd.

    [0246] Results:

    [0247] In the presence of both TNF-α and IL-17A, the concentrations of CXCL1 in each group were: 12.4±0.6 pg/ml in BY19.3 group, 14.7±1.23 pg/ml in BY19.6 group, 15.4±3.22 in BY19.7 group, 10.7±0.58 pg/ml in BY19.4+Yisaipu group, 42.1±5.6 pg/ml in BY19.4 (ixekizumab) group, 118.6±38.9 pg/ml in Yisaipu group, 10.6±0.6 pg/ml in negative control group. CXCL1 concentration in BY19.4 group or in Yisaipu group was significantly higher than that of negative control group (p<0.05). There was no significant difference in CXCL1 concentration among negative control group, BY19.3 group, BY19.6 group, BY19.7 group, and BY19.4+Yisaipu group (p>0.05).

    [0248] The above results showed that BY19.4 alone or Yisaipu alone, especially Yisaipu alone, had an inhibitory effect on CXCL1 expression not as good as those from BY19.3, BY19.6, and BY19.7 groups. Use of the combination of BY19.4 and Yisaipu, or use of BY19.3, BY19.6, or BY19.7, significantly inhibited the expression of CXCL1.

    [0249] In the presence of both TNF-α and IL-17A, the concentrations of IL-8 in each group were: 35.9±1.9 pg/ml in BY19.3 group, 37.9±3.7 pg/ml in BY19.6 group, 30.6±2.9 pg/ml in BY19.7 group, 34.6±2.2 pg/ml in BY19.4+Yisaipu group, 185.1±21.4 pg/ml in BY19.4 (ixekizumab) group, 40.3±3.4pg/ml in Yisaipu group, 29.0±3.6 pg/ml in negative control group. BY19.3 group, BY19.6 group, BY19.7 group, and BY19.4 Yisaipu group, and Yisaipu group had no significant difference in IL-8 concentration compared with the negative control group (p>0.05). The concentration of IL-8 in BY19.4 alone group was significantly higher than those in other groups (p<0.05).

    [0250] The above results showed that when used alone, BY19.4 inhibited IL-8 expression less effectively than those of Yisaipu, BY19.4+Yisaipu, or BY19.3, BY19.6, or BY19.7.

    [0251] In summary, BY19.3, BY19.6, and BY19.7 had a significant inhibitory effect on the expression of CXCL1 and IL-8 in HT-29 cells, which were comparable to the effect of the combination of BY19.4 and Yisaipu, with the inhibition efficiency better than BY19.4 alone group or Yisaipu alone group. It could be seen that the fusion protein of the present invention comprising anti-IL-17antibody and TNFR was potent for the treatment of rheumatoid arthritis, ankylosing spondylitis, psoriasis, and ulcerative colitis and other autoimmunity diseases.

    [0252] Further, human anti-IL-17 antibody in the prior art, such as human IL-17scfv, cannot bind IL-17 in murine model. Neither human TNFR1 nor human TNFR2 can bind TNF-α in murine model. Therefore, the inventors cannot find a suitable animal to provide experimental data of the fusion protein of the present invention in animals. This is also an unresolved problem in the field.