TREATMENT OF PROSTATE CANCER USING CHIMERIC ANTIGEN RECEPTORS
20210236548 · 2021-08-05
Inventors
- Owen N. Witte (Sherman Oaks, CA)
- John K. LEE (Santa Clarita, CA, US)
- Nathanael J. BANGAYAN (Los Angeles, CA, US)
Cpc classification
A61K35/17
HUMAN NECESSITIES
International classification
A61K35/17
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
Abstract
Provided herein are methods of treating neuroendocrine prostate cancer (NEPC) with immune cells comprising a CEA-CAM5 chimeric antigen receptor (CAR). Also provided are methods of reducing or eliminating NEPC cancer cells with immune cells comprising a CEACAM5 CAR. Also provided are methods of treating a cancer with a molecular signature that is similar to a molecular signature of NEPC (e.g., small cell lung cancer (SCLC), small cell carcinoma of the pancreas (SCCP), or small cell prostate cancer).
Claims
1. A method of treating a subject having neuroendocrine prostate cancer (NEPC), comprising administering to the subject an infusion of immune cells comprising a chimeric antigen receptor (CAR) comprising a CEACAM5 antigen-binding moiety, a transmembrane domain, and an immune cell activation moiety, wherein the immune cell activation moiety comprises one or more signaling domains.
2. The method of claim 1, wherein the neuroendocrine prostate cancer is CEACAM5.sup.+ neuroendocrine prostate cancer, the immune cells are CD8.sup.+ T cells, and the immune cells comprise a CAR comprising a CEACAM5 scFv antigen-binding moiety, a spacer domain having a length of 200 to 300 amino acids, a transmembrane domain, and an immune cell activation moiety comprising one or more signaling domains.
3. The method of claim 1, wherein the neuroendocrine prostate cancer is CEACAM5.sup.+ neuroendocrine prostate cancer.
4. The method of claim 1, wherein the infusion of immune cells comprises T cells.
5. The method of claim 4, wherein the T cells are CD3.sup.+ T cells.
6. The method of claim 5, wherein the T cells are CD8.sup.+ T cells.
7. The method of claim 1, wherein the immune cells are natural killer (NK) cells.
8. The method of claim 1, wherein the immune cells are natural killer T (NKT) cells.
9. The method of claim 1, wherein the CEACAM5 antigen binding moiety comprises an antibody or antigen-binding fragment thereof.
10. The method of claim 9, wherein the antibody or antigen-binding fragment thereof comprises the CDRs of labetuzumab.
11. The method of claim 10, wherein the antibody or antigen-binding fragment thereof comprises: a VH-CDR1 comprising the sequence set forth in SEQ ID NO:1; a VH-CDR2 comprising the sequence set forth in SEQ ID NO:2; a VH-CDR3 comprising the sequence set forth in SEQ ID NO:3; a VL-CDR1 comprising the sequence set forth in SEQ ID NO:4; a VL-CDR2 comprising the sequence set forth in SEQ ID NO:5; and a VL-CDR3 comprising the sequence set forth in SEQ ID NO:6.
12. The method of any of claims 9 to 11, wherein the antigen-binding fragment is a Fab or an scFv.
13. The method of claim 12, wherein the antigen-binding fragment is an scFv.
14. The method of claim 13, wherein the antigen-binding fragment is an scFv derived from labetuzumab.
15. The method of any of the preceding claims, wherein the transmembrane domain is a CD28 transmembrane domain or a CD8a transmembrane domain.
16. The method of claim 15, wherein the transmembrane domain is a CD28 transmembrane domain.
17. The method of any of the preceding claims, wherein the one or more signaling domains is selected from the group consisting of a co-stimulatory domain and an immunoreceptor tyrosine-based activation motif (ITAM)-containing signaling domain.
18. The method of claim 17, wherein the immune cell activation moiety comprises one or more co-stimulatory domains.
19. The method of claim 18, wherein the co-stimulatory domain comprises a CD28 co-stimulatory domain, a 4-1BB co-stimulatory domain, an OX40 co-stimulatory domain, or an ICOS co-stimulatory domain.
20. The method of claim 19, wherein the co-stimulatory domain comprises a CD28 co-stimulatory domain.
21. The method of any of claims 17 to 20, wherein the immune cell activation moiety comprises an ITAM-containing signaling domain.
22. The method of claim 21, wherein the ITAM-containing signaling domain comprises a CD3ζ signaling domain or an FcRγ signaling domain.
23. The method of claim 22, wherein the ITAM-containing signaling domain comprises a CD3ζ signaling domain.
24. The method of claim 17, wherein the immune cell activation moiety comprises a 28-ΔIL2RB-z(YXXQ) domain.
25. The method of claim 1, wherein the CAR further comprises a spacer domain.
26. The method of claim 25, wherein the spacer domain has a length of 1 to 500 amino acids.
27. The method of claim 26, wherein the spacer domain has a length of 200 to 300 amino acids.
28. The method of claim 27, wherein the spacer domain has a length of 229 amino acids.
29. The method of any of claims 25 to 28, wherein the spacer domain comprises a hinge domain from an immunoglobulin.
30. The method of claim 29, wherein the hinge domain from an immunoglobulin comprises the hinge domain from IgG1, IgG2, IgG3, or IgG4.
31. The method of claim 30, wherein the hinge domain from an immunoglobulin comprises the hinge domain from human IgG4.
32. The method of any of claims 25 to 31, wherein the spacer domain comprises the CH2-CH3 domain from an immunoglobulin.
33. The method of claim 32, wherein the spacer domain comprises a hinge domain from an immunoglobulin and the CH2-CH3 domain from an immunoglobulin.
34. The method of any of claims 25 to 31, wherein the spacer domain comprises the extracellular domain of CD8a.
35. The method of claim 34, wherein the spacer domain comprises a hinge domain from an immunoglobulin and the extracellular domain of CD8a.
36. The method of any of the preceding claims, wherein the CAR comprises an scFv derived from labetuzumab, a hinge of human IgG4, a CH2-CH3 domain of an immunoglobulin, a CD28 transmembrane domain, a CD28 co-stimulatory domain, and a CD3ζ signaling domain, optionally wherein the CH2-CH3 domain is a human IgG4 CH2-CH3 domain.
37. The method of any of the preceding claims, wherein the CAR comprises the amino acid sequence set forth in SEQ ID NO:7.
38. The method of any of the preceding claims, wherein the CAR increases interferon gamma (IFNγ) release by the immune cells.
39. The method of any of the preceding claims, wherein the immune cells are autologous immune cells.
40. The method of any one of claims 1 to 38, wherein the immune cells are allogeneic immune cells.
41. The method of any of the preceding claims, wherein the immune cells are administered to the subject intravenously.
42. A method of reducing or eliminating NEPC cancer cells in a subject having NEPC, comprising contacting the NEPC cancer cells with an infusion of immune cells comprising a chimeric antigen receptor (CAR) comprising a CEACAM5 antigen-binding moiety, a transmembrane domain, and an immune cell activation moiety, wherein the immune cell activation moiety comprises one or more signaling domains.
43. The method of claim 42, wherein the NEPC cancer cells comprise CEACAM5.sup.+ NEPC cancer cells.
44. The method of claim 42 or 43, wherein the immune cells are T cells.
45. The method of claim 44, wherein the T cells are CD3.sup.+ T cells.
46. The method of claim 44, wherein the T cells are CD8.sup.+ T cells.
47. The method of claim 42 or 43, wherein the immune cells are natural killer (NK) cells.
48. The method of claim 42 or 43, wherein the immune cells are natural killer T (NKT) cells.
49. The method of any of claims 42 to 48, wherein the CEACAM5 antigen binding moiety comprises an antibody or antigen-binding fragment thereof.
50. The method of claim 49, wherein the antibody or antigen-binding fragment thereof comprises the CDRs of labetuzumab.
51. The method of claim 50, wherein the antibody or antigen-binding fragment thereof comprises: a VH-CDR1 comprising the sequence set forth in SEQ ID NO:1; a VH-CDR2 comprising the sequence set forth in SEQ ID NO:2; a VH-CDR3 comprising the sequence set forth in SEQ ID NO:3; a VL-CDR1 comprising the sequence set forth in SEQ ID NO:4; a VL-CDR2 comprising the sequence set forth in SEQ ID NO:5; and a VL-CDR3 comprising the sequence set forth in SEQ ID NO:6.
52. The method of any of claims 49 to 51, wherein the antigen-binding fragment is a Fab or an scFv.
53. The method of claim 52, wherein the antigen-binding fragment is an scFv.
54. The method of claim 53, wherein the antigen-binding fragment is an scFv derived from labetuzumab.
55. The method of any of claims 42 to 54, wherein the transmembrane domain is a CD28 transmembrane domain or a CD8a transmembrane domain.
56. The method of claim 55, wherein the transmembrane domain is a CD28 transmembrane domain.
57. The method of claims 42 to 56, wherein the one or more signaling domains is selected from the group consisting of a co-stimulatory domain and an immunoreceptor tyrosine-based activation motif (ITAM)-containing signaling domain.
58. The method of claim 57, wherein the immune cell activation moiety comprises one or more co-stimulatory domains.
59. The method of claim 58, wherein the co-stimulatory domain comprises a CD28 co-stimulatory domain, a 4-1BB co-stimulatory domain, an OX40 co-stimulatory domain, or an ICOS co-stimulatory domain.
60. The method of claim 59, wherein the co-stimulatory domain comprises a CD28 co-stimulatory domain.
61. The method of any of claims 57 to 60, wherein the immune cell activation moiety comprises an ITAM-containing signaling domain.
62. The method of claim 61, wherein the ITAM-containing signaling domain comprises a CD3ζ signaling domain or an FcRγ signaling domain.
63. The method of claim 62, wherein the ITAM-containing signaling domain comprises a CD3ζ signaling domain.
64. The method of claim 57, wherein the immune cell activation moiety comprises a 28-ΔIL2RB-z(YXXQ) domain.
65. The method of any of claims 42 to 64, wherein the CAR further comprises a spacer domain.
66. The method of claim 65, wherein the spacer domain has a length of 1 to 500 amino acids.
67. The method of claim 66, wherein the spacer domain has a length of 200 to 300 amino acids.
68. The method of claim 67, wherein the spacer domain has a length of 229 amino acids.
69. The method of any of claims 65 to 68, wherein the spacer domain comprises a hinge domain from an immunoglobulin.
70. The method of claim 69, the hinge domain from an immunoglobulin comprises the hinge domain from IgG1, IgG2, IgG3, or IgG4.
71. The method of claim 70, wherein the hinge domain from an immunoglobulin comprises the hinge domain from human IgG4.
72. The method of any of claims 65 to 71, wherein the spacer domain comprises the CH2-CH3 domain from an immunoglobulin.
73. The method of claim 72, wherein the spacer domain comprises a hinge domain from an immunoglobulin and the CH2-CH3 domain from an immunoglobulin.
74. The method of any of claims 65 to 71, wherein the spacer domain comprises the extracellular domain of CD8a.
75. The method of claim 74, wherein the spacer domain comprises a hinge domain from an immunoglobulin and the extracellular domain of CD8a.
76. The method of any of claims 42 to 75, wherein the CAR comprises an scFv derived from labetuzumab, a hinge of human IgG4, a CH2-CH3 domain of an immunoglobulin, a CD28 transmembrane domain, a CD28 co-stimulatory domain, and a CD3ζ signaling domain, optionally wherein the CH2-CH3 domain is a human IgG4 CH2-CH3 domain.
77. The method of any of claims 42 to 76, wherein the CAR comprises the amino acid sequence set forth in SEQ ID NO:7.
78. The method of any of claims 42 to 77, wherein the CAR increases interferon gamma (IFNγ) release by the immune cells.
79. The method of any of claims 42 to 78, wherein the immune cells are autologous immune cells.
80. The method of any of claims 42 to 78, wherein the immune cells are allogeneic immune cells.
81. A method of treating a subject having small cell cancer, comprising administering an infusion of immune cells comprising a chimeric antigen receptor (CAR) comprising a CEACAM5 antigen-binding moiety, a transmembrane domain, and an immune cell activation moiety, wherein the immune cell activation moiety comprises one or more signaling domains.
82. The method of claim 81, wherein the small cell cancer is at least one of lung, prostate, pancreas, and stomach small cell cancer.
83. The method of claim 81 or 82, wherein the small cell cancer is CEACAM5 positive.
84. The method of any of claims 81 to 83, wherein the infusion of immune cells comprises T cells.
85. The method of claim 84, wherein the T cells are CD3.sup.+ T cells.
86. The method of claim 84, wherein the T cells are CD8.sup.+ T cells.
87. The method of any of claims 81 to 83, wherein the immune cells are natural killer (NK) cells.
88. The method of any of claims 81 to 83, wherein the immune cells are natural killer T (NKT) cells.
89. The method of any of claims 81 to 88, wherein the CEACAM5 antigen binding moiety comprises an antibody or antigen-binding fragment thereof.
90. The method of claim 89, wherein the antibody or antigen-binding fragment thereof comprises the CDRs of labetuzumab.
91. The method of claim 90, wherein the antibody or antigen-binding fragment thereof comprises: a VH-CDR1 comprising the sequence set forth in SEQ ID NO:1; a VH-CDR2 comprising the sequence set forth in SEQ ID NO:2; a VH-CDR3 comprising the sequence set forth in SEQ ID NO:3; a VL-CDR1 comprising the sequence set forth in SEQ ID NO:4; a VL-CDR2 comprising the sequence set forth in SEQ ID NO:5; and a VL-CDR3 comprising the sequence set forth in SEQ ID NO:6.
92. The method of any of claims 89 to 91, wherein the antigen-binding fragment is a Fab or an scFv.
93. The method of claim 92, wherein the antigen-binding fragment is an scFv.
94. The method of claim 93, wherein the antigen-binding fragment is an scFv derived from labetuzumab.
95. The method of any of claims 81 to 94, wherein the transmembrane domain is a CD28 transmembrane domain or a CD8a transmembrane domain.
96. The method of claim 95, wherein the transmembrane domain is a CD28 transmembrane domain.
97. The method of any of claims 81 to 96, wherein the one or more signaling domains is selected from the group consisting of a co-stimulatory domain and an immunoreceptor tyrosine-based activation motif (ITAM)-containing signaling domain.
98. The method of claim 97, wherein the immune cell activation moiety comprises one or more co-stimulatory domains.
99. The method of claim 98, wherein the co-stimulatory domain comprises a CD28 co-stimulatory domain, a 4-1BB co-stimulatory domain, an OX40 co-stimulatory domain, or an ICOS co-stimulatory domain.
100. The method of claim 99, wherein the co-stimulatory domain comprises a CD28 co-stimulatory domain.
101. The method of any of claims 97 to 100, wherein the immune cell activation moiety comprises an ITAM-containing signaling domain.
102. The method of claim 101, wherein the ITAM-containing signaling domain comprises a CD3ζ signaling domain or an FcRγ signaling domain.
103. The method of claim 102, wherein the ITAM-containing signaling domain comprises a CD3ζ signaling domain.
104. The method of claim 97, wherein the immune cell activation moiety comprises a 28-ΔIL2RB-z(YXXQ) domain.
105. The method of any of claims 81 to 104, wherein the CAR further comprises a spacer domain.
106. The method of claim 105, wherein the spacer domain has a length of 1 to 500 amino acids.
107. The method of claim 106, wherein the spacer domain has a length of 200 to 300 amino acids.
108. The method of claim 107, wherein the spacer domain has a length of 229 amino acids.
109. The method of any of claims 105 to 108, wherein the spacer domain comprises a hinge domain from an immunoglobulin.
110. The method of claim 109, wherein the hinge domain from an immunoglobulin comprises the hinge domain from IgG1, IgG2, IgG3, or IgG4.
111. The method of claim 110, wherein the hinge domain from an immunoglobulin comprises the hinge domain from human IgG4.
112. The method of any of claims 105 to 111, wherein the spacer domain comprises the CH2-CH3 domain from an immunoglobulin.
113. The method of claim 112, wherein the spacer domain comprises a hinge domain from an immunoglobulin and the CH2-CH3 domain from an immunoglobulin.
114. The method of any of claims 105 to 111, wherein the spacer domain comprises the extracellular domain of CD8a.
115. The method of claim 114, wherein the spacer domain comprises a hinge domain from an immunoglobulin and the extracellular domain of CD8a.
116. The method of any of claims 81 to 115, wherein the CAR comprises an scFv derived from labetuzumab, a hinge of human IgG4, a CH2-CH3 domain of an immunoglobulin, a CD28 transmembrane domain, a CD28 co-stimulatory domain, and a CD3ζ signaling domain, optionally wherein the CH2-CH3 domain is a human IgG4 CH2-CH3 domain.
117. The method of any of claims 81 to 116, wherein the CAR comprises the amino acid sequence set forth in SEQ ID NO:7.
118. The method of any of claims 81 to 117, wherein the CAR increases interferon gamma (IFNγ) release by the immune cells.
119. The method of any of claims 81 to 118, wherein the immune cells are autologous immune cells.
120. The method of any of claims 81 to 118, wherein the immune cells are allogeneic immune cells.
121. The method of any of claims 81 to 120, wherein the immune cells are administered intravenously.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0018] These and other features, aspects, and advantages of the present invention will become better understood with regard to the following description, and accompanying drawings.
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
DETAILED DESCRIPTION
Definitions
[0028] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the invention pertains.
[0029] The term “a” and “an” refers to one or to more than one (i.e., to at least one) of the grammatical object of the article. By way of example, “an element” means one element or more than one element.
[0030] The term “antibody,” as used herein, refers to a protein, or polypeptide sequence derived from an immunoglobulin molecule which specifically binds with an antigen. Antibodies can be polyclonal or monoclonal, multiple or single chain, or intact immunoglobulins, and may be derived from natural sources or from recombinant sources. Antibodies can be tetramers of immunoglobulin molecules.
[0031] The term “antigen” refers to a molecule that provokes an immune response. This immune response may involve either antibody production, or the activation of specific immunologically-competent cells, or both. The skilled artisan will understand that any macromolecule, including virtually all proteins or peptides, can serve as an antigen. Furthermore, antigens can be derived from recombinant or genomic DNA. A skilled artisan will understand that any DNA, which comprises a nucleotide sequences or a partial nucleotide sequence encoding a protein that elicits an immune response therefore encodes an “antigen” as that term is used herein. Furthermore, one skilled in the art will understand that an antigen need not be encoded solely by a full length nucleotide sequence of a gene. The present invention includes, but is not limited to, the use of partial nucleotide sequences of more than one gene and that these nucleotide sequences are arranged in various combinations to encode polypeptides that elicit the desired immune response. Moreover, a skilled artisan will understand that an antigen need not be encoded by a “gene” at all. It is readily apparent that an antigen can be generated, synthesized or can be derived from a biological sample, or might be macromolecule besides a polypeptide. Such a biological sample can include, but is not limited to a tissue sample, a tumor sample, a cell or a fluid with other biological components.
[0032] The term “co-stimulatory molecule” refers to the cognate binding partner on a T cell that specifically binds with a co-stimulatory ligand, thereby mediating a co-stimulatory response by the T cell, such as, but not limited to, proliferation. Co-stimulatory molecules are cell surface molecules other than antigen receptors or their ligands that are required for an efficient immune response. Co-stimulatory molecules include, but are not limited to an MHC class 1 molecule, BTLA and a Toll ligand receptor, as well as OX40, CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CD11a/CD18) and 4-1BB (CD137).
[0033] A co-stimulatory domain can be the intracellular portion of a co-stimulatory molecule. A co-stimulatory molecule can be represented in the following protein families: TNF receptor proteins, Immunoglobulin-like proteins, cytokine receptors, integrins, signaling lymphocytic activation molecules (SLAM proteins), and activating NK cell receptors. Examples of such molecules include CD27, CD28, 4-1BB (CD137), OX40, GITR, CD30, CD40, ICOS, HVEM, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, SLAMF7, NKp80, CD160, B7-H3, and a ligand that specifically binds with CD83, and the like.
[0034] The term “autologous” refers to any material derived from the same individual to whom it is later to be re-introduced into the individual.
[0035] CEACAM5
[0036] CEACAM5 is also known as Carcinoembryonic Antigen Related Cell Adhesion Molecule 5. The RefSeq accession number for CEACAM5 is NM_004363.5 as shown on the NCBI website as of Apr. 10, 2018. The amino acid sequence of human CEACAM5, transcript variant 1 is shown in the table below.
TABLE-US-00001 Name Amino Acid Sequence CEACAM5 MESPSAPPHR WCIPWQRLLL TASLLTFWNP PTTAKLTIES (human) TPFNVAEGKE VLLLVHNLPQ HLFGYSWYKG ERVDGNRQII GYVIGTQQAT PGPAYSGREI IYPNASLLIQ NIIQNDTGFY TLHVIKSDLV NEEATGQFRV YPELPKPSIS SNNSKPVEDK DAVAFTCEPE TQDATYLWWV NNQSLPVSPR LQLSNGNRTL TLFNVTRNDT ASYKCETQNP VSARRSDSVI LNVLYGPDAP TISPLNTSYR SGENLNLSCH AASNPPAQYS WFVNGTFQQS TQELFIPNIT VNNSGSYTCQ AHNSDTGLNR TTVTTITVYA EPPKPFITSN NSNPVEDEDA VALTCEPEIQ NTTYLWWVNN QSLPVSPRLQ LSNDNRTLTL LSVTRNDVGP YECGIQNELS VDHSDPVILN VLYGPDDPTI SPSYTYYRPG VNLSLSCHAA SNPPAQYSWL IDGNIQQHTQ ELFISNITEK NSGLYTCQAN NSASGHSRTT VKTITVSAEL PKPSISSNNS KPVEDKDAVA FTCEPEAQNT TYLWWVNGQS LPVSPRLQLS NGNRTLTLFN VTRNDARAYV CGIQNSVSAN RSDPVTLDVL YGPDTPIISP PDSSYLSGAN LNLSCHSASN PSPQYSWRIN GIPQQHTQVL FIAKITPNNN GTYACFVSNL ATGRNNSIVK SITVSASGTS PGLSAGATVG IMIGVLVGVA LI
[0037] The CEACAM5 gene encodes a cell surface glycoprotein that is a member of the carcinoembryonic antigen (CEA) family of proteins. The encoded protein has been used as a clinical biomarker for certain gastrointestinal cancers and may promote tumor development through its role as a cell adhesion molecule. Additionally, the encoded CEACAM5 protein may regulate differentiation, apoptosis, and cell polarity. This relevant gene coding sequence is present in a CEA family gene cluster on chromosome 19. Alternative splicing results in multiple transcript variants of CEACAM5.
[0038] In some embodiments, provided herein are methods of treating a subject with a cancer that has elevated expression of CEACAM5 relative to a control. The control can be, e.g., normal tissue that is of the same developmental origin as the relevant tumor tissue. The control expression level of CEACAM5 can also be a pre-determined threshold level (See Lee et al, Proc Natl Acad Sci USA. 2018 May 8; 115(19)). Methods for assessing CEACAM5 expression are well-known in the art and can include flow cytometry, immunoassays, and/or RT-PCR. In some embodiments, provided herein are methods of treating a subject with a cancer that is CEACAM5+ (e.g., pancreatic cancer, small cell carcinoma of the pancreas (SCCP), lung cancer, small-cell lung cancer (SCLC), prostate cancer, small cell prostate cancer, small cell neuroendocrine carcinoma, stomach cancer, colorectal cancer, and cervical cancer).
[0039] Chimeric Antigen Receptors (CARs)
[0040] In some aspects, a chimeric antigen receptor (CAR) provided herein comprises a CEACAM5 antigen-binding moiety, a transmembrane domain, and an immune cell activation moiety, wherein the immune cell activation moiety comprises one or more signaling domains.
[0041] CEACAM5 Antigen Binding Moiety
[0042] In some embodiments, the CEACAM5 antigen-binding moiety comprises an antibody or antigen-binding fragment thereof.
[0043] In some embodiments, the antibody or antigen-binding fragment thereof comprises one or more or all of the CDRs of labetuzumab. In some embodiments, the antibody or antigen-binding fragment thereof comprises: a VH-CDR1 comprising the sequence set forth in SEQ ID NO:1; a VH-CDR2 comprising the sequence set forth in SEQ ID NO:2; a VH-CDR3 comprising the sequence set forth in SEQ ID NO:3; a VL-CDR1 comprising the sequence set forth in SEQ ID NO:4; a VL-CDR2 comprising the sequence set forth in SEQ ID NO:5; and a VL-CDR3 comprising the sequence set forth in SEQ ID NO:6. In some embodiments, the antibody or antigen-binding fragment thereof comprises one or more or all of the CDRs of an anti-CEACAM5 antibody described in International Pat. Pub. No. WO2014079886, which is incorporated by reference in its entirety for all purposes.
[0044] In some embodiments, the antigen-binding fragment is a Fab or an scFv. In some embodiments, the antigen-binding fragment is an scFv. In some embodiments, the antigen-binding fragment is an scFv derived from labetuzumab. In some embodiments, the scFv derived from labetuzumab is described in U.S. Pat. No. 5,874,540A, which is incorporated by reference in its entirety for all purposes. In one aspect such antibody fragments are functional in that they retain the equivalent binding affinity, e.g., they bind the same antigen with comparable affinity, as the IgG antibody from which they are derived. In one aspect such antibody fragments are functional in that they elicit a biological response that can include, but is not limited to, activation of an immune response, inhibition of signal-transduction resulting from binding of its target antigen, inhibition of kinase activity, and the like, as will be understood by a skilled artisan.
[0045] Transmembrane Domain
[0046] In some embodiments, a transmembrane domain anchors the CAR to the cell surface, and connects the extracellular ligand binding domain that confers target specificity (e.g., CEACAM5 antigen binding moiety) to the intracellular signaling domain (e g, immune cell activation moiety), thus impacting expression of the CAR on the cell surface. In certain embodiments, the transmembrane domain may be derived either from a natural or from a recombinant source. In certain embodiments, the domain may be derived from any membrane-bound or transmembrane protein. In one aspect, the transmembrane domain provides stability to the CAR molecule. A transmembrane domain of particular use in the present disclosure may include at least the transmembrane region(s) of e.g., the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8a, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154.
[0047] In some embodiments, the transmembrane domain of a CAR is a CD28 transmembrane domain or a CD8a transmembrane domain. In some embodiments, the transmembrane domain is a CD28 transmembrane domain.
[0048] Spacer Domain
[0049] In some embodiments, the CAR further comprises a spacer domain between the antigen-binding moiety and the transmembrane domain.
[0050] In some embodiments, the spacer domain has a length of 1 to 500 amino acids, such as 1 to 50, 1 to 100, 100 to 200, 200 to 300, 300 to 400, or 400 to 500 amino acids. In some embodiments, the spacer domain has a length of 200 to 300 amino acids. In some embodiments, the spacer domain has a length of 200 to 250 amino acids. In some embodiments, the spacer domain has a length of 229 amino acids.
[0051] In some embodiments, the spacer domain comprises a hinge domain from an immunoglobulin. In some embodiments, the hinge domain from an immunoglobulin comprises the hinge domain from IgG1, IgG2, IgG3, or IgG4. In some embodiments, the hinge domain from an immunoglobulin comprises the hinge domain from human IgG1 or IgG4. In some embodiments, the hinge domain from an immunoglobulin comprises the hinge domain from human IgG4.
[0052] In some embodiments, the spacer domain comprises the CH2-CH3 domain from an immunoglobulin. In some embodiments, the spacer domain comprises a hinge domain from an immunoglobulin and the CH2-CH3 domain from an immunoglobulin. In some embodiments, the hinge domain from an immunoglobulin comprises the hinge domain from IgG1, IgG2, IgG3, or IgG4, and the CH2-CH3 domain from an immunoglobulin comprises the CH2-CH3 domain from IgG1, IgG2, IgG3, or IgG4.
[0053] In some embodiments, the spacer domain comprises the extracellular domain of CD8a. In some embodiments, the spacer domain comprises a hinge domain from an immunoglobulin and the extracellular of CD8a. In some embodiments, the hinge domain from an immunoglobulin comprises the hinge domain from IgG1, IgG2, IgG3, or IgG4.
[0054] Immune Cell Activation Moiety
[0055] In some embodiments, the immune cell activation moiety activates at least one of the normal effector functions of the immune cell. In some embodiments, effector function is a specialized function of a cell. In some embodiments, the immune cell activation moiety transduces the effector function signal and directs the cell to perform a specialized function. In certain embodiments, an immune cell activation moiety can also include the T cell receptor (TCR) and co-receptors that act in concert to initiate signal transduction following antigen receptor engagement.
[0056] In some embodiments, the immune cell activation moiety comprises one or more signaling domains. In some embodiments, the one or more signaling domains includes at least one of a co-stimulatory domain and of an immunoreceptor tyrosine-based activation motif (ITAM)-containing signaling domain. In some embodiments, the one or more signaling domains includes at least two of a co-stimulatory domain and one of an immunoreceptor tyrosine-based activation motif (ITAM)-containing signaling domain.
[0057] In some embodiments, the immune cell activation moiety comprises one or more co-stimulatory domains. In some embodiments, the co-stimulatory domain comprises a CD28 co-stimulatory domain, a 4-1BB co-stimulatory domain, an OX40 co-stimulatory domain, or an Inducible T-cell costimulator (ICOS) co-stimulatory domain. In some embodiments, the co-stimulatory domain comprises a CD28 co-stimulatory domain. In some embodiments, the co-stimulatory domain comprises a 4-1BB co-stimulatory domain. In some embodiments, the immune cell activation moiety comprises two co-stimulatory domains. In some embodiments, two co-stimulatory domains comprise a CD28 and a 4-1BB co-stimulatory domain. In some embodiments, two co-stimulatory domains comprise a CD28 and an OX40 co-stimulatory domain. In some embodiments, two co-stimulatory domains comprise a CD28 and an ICOS co-stimulatory domain.
[0058] In some embodiments, the immune cell activation moiety comprises an ITAM-containing signaling domain. In some embodiments, the ITAM-containing signaling domain comprises a CD3ζ signaling domain or an FcRγ signaling domain. In some embodiments, the ITAM-containing signaling domain comprises a CD3ζ signaling domain
[0059] In some embodiments, the immune cell activation moiety comprises a 28-ΔIL2RB-z(YXXQ) domain, which comprises a truncated cytoplasmic domain from the interleukin (IL)-2 receptor β-chain (IL-2Rβ) and a STATS-binding tyrosine-X-X-glutamine (YXXQ) motif, together with a CD3ζ signaling domain and a CD28 co-stimulatory domain. See Kagoya Y, et al., Nat Med, 2018, 24:352-359, incorporated by reference in its entirety for all purposes.
[0060] CEACAM5 CAR
[0061] In some embodiments, the CAR comprises an scFv derived from labetuzumab, a hinge of human IgG4, a CH2-CH3 domain of an immunoglobulin (e.g., IgG4), a CD28 transmembrane domain, a CD28 co-stimulatory domain, and a CD3ζ signaling domain. In some embodiments, the CAR comprises an scFv derived from labetuzumab, a hinge of human IgG4, a CH2-CH3 domain of an immunoglobulin (e.g., IgG4), a CD28 transmembrane domain, a 4-1BB co-stimulatory domain, and a CD3ζ signaling domain. In some embodiments, the CAR comprises an scFv derived from labetuzumab, a hinge of human IgG4, a CH2-CH3 domain of an immunoglobulin (e.g., IgG4), a CD28 transmembrane domain, a CD28 co-stimulatory domain, a 4-1BB co-stimulatory domain, and a CD3ζ signaling domain.
[0062] In some embodiments, the CAR comprises the amino acid sequence set forth in SEQ ID NO:7. In some embodiments, SEQ ID NO: 7 comprises a CAR comprising an scFv derived from labetuzumab, a hinge of human IgG4, a CH2-CH3 domain of an immunoglobulin, a CD28 transmembrane domain, a CD28 co-stimulatory domain, and a CD3ζ signaling domain.
[0063] In some embodiments, the CEACAM5 CAR T cells administered to the subject for the methods of treatment (e.g., NEPC, SCCP, SCLC) stimulate interferon gamma (IFNγ) release.
[0064] Immune Cells
[0065] In another aspect, immune cells are engineered to express the chimeric antigen receptors described herein. In some embodiments, the immune cells are T cells. T cells can be obtained from a number of sources, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors. In some embodiments, the T cells are CD3.sup.+ T cells. In some embodiments, the T cells are CD8.sup.+ T cells such as cytotoxic T lymphocytes (CTLs).
[0066] In some embodiments, the immune cells are natural killer (NK) cells or natural killer T (NKT) cells.
[0067] In some embodiments, the immune cells are autologous immune cells. In some embodiments, the immune cells are allogeneic immune cells.
[0068] Methods of Treatment
[0069] In some aspects, provided herein are methods of treating a subject with neuroendocrine prostate cancer (NEPC). In certain embodiments, provided herein are methods of treating a subject with CEACAM5-positive NEPC. In some embodiments, provided herein are methods of treating a subject with a cancer that shares a similar molecular signature with NEPC. In some embodiments, the NEPC molecular signature comprises certain oncogenic drivers of NEPC.
[0070] In some embodiments, oncogenic drivers of NEPC include TP53, AKT1, RB1, BCL2, and c-Myc.
TP53 (Tumor Protein P53)
[0071] This gene encodes a tumor suppressor protein containing transcriptional activation, DNA binding, and oligomerization domains. The encoded protein responds to diverse cellular stresses to regulate expression of target genes, thereby inducing cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. Mutations in this gene are associated with a variety of human cancers. Alternative splicing of this gene and the use of alternate promoters result in multiple transcript variants and isoforms. Examples of human TP53 sequences are available under the reference sequence NM_000546.
AKT1 (AKT Serine/Threonine Kinase I)
[0072] AKT1, also referred to as protein kinase B, is a known oncogene. AKT activation relies on the PI3K pathway, and is recognized as a critical node in the pathway. The E17 hotspot is the most characterized of AKT1 mutations, and has been shown to result in activation of the protein. Mutations in AKT1 have also been shown to confer resistance to allosteric kinase inhibitors in vitro. Multiple alternatively spliced transcript variants have been found for this gene. Examples of human AKT1 sequences are available under the reference sequence NM_005163.
RB1 (RB Transcriptional Corepressor I)
[0073] RB1 is a Protein Coding gene. Diseases associated with RB1 include retinoblastoma and small cell lung cancer. The protein encoded by this gene is a negative regulator of the cell cycle. Examples of human RB1 sequences are available under the reference sequence NM_000321.
BCL2 (Apoptosis Regulator)
[0074] This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Alternative splicing of this gene results in multiple transcript variants. Examples of human BCL2 sequences are available under the reference sequence NM_000633.
c-myc
[0075] This gene is a proto-oncogene and encodes a nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. The encoded protein forms a heterodimer with the related transcription factor MAX. This complex binds to the E box DNA consensus sequence and regulates the transcription of specific target genes. Amplification of this gene is frequently observed in numerous human cancers. Examples of human c-myc sequences are available under the reference sequence NM_002467.5.
[0076] Small cell cancers generally share a small-round-blue-cell morphology, markers of neuroendocrine differentiation (e.g., chromogranin A, neural cell adhesion molecule 1, and synaptophysin), high proliferative indices, and an aggressive clinical course marked by rapid dissemination. In some embodiments, the present disclosure provides methods for treating small cell cancers that share a similar molecular signature as NEPC. In certain embodiments, small cell cancers that share a similar molecular signature as NEPC are CEACAM5-positive. In some embodiments, the oncogenic drivers that drive NEPC are the same oncogenic drivers that drive small cell cancers. In some embodiments, oncogenic drivers of small cell cancers include TP53, AKT1, RB1, BCL2, and c-Myc. In certain embodiments, small cell cancer includes small cell lung cancer (SCLC), small cell prostate cancer, small cell carcinoma of the pancreas (SCCP), and small cell neuroendocrine carcinoma.
[0077] In some embodiments, the present disclosure provides methods for treating a disease associated with CEACAM5-positive expression. In some embodiments, the present disclosure provides methods for treating a cancer that is CEACAM5 positive (e.g., pancreatic cancer, small cell carcinoma of the pancreas (SCCP), lung cancer, prostate cancer, small cell prostate cancer, small cell lung cancer (SCLC), small cell neuroendocrine carcinoma, stomach cancer, colorectal cancer, and cervical cancer).
[0078] The methods comprise administering an infusion of immune cells comprising a chimeric antigen receptor (CAR) comprising a CEACAM5 antigen-binding moiety, a hinge from an immunoglobulin, a transmembrane domain, and an immune cell activation moiety, wherein the immune cell activation moiety comprises one or more signaling domains such as intracellular signaling domains (e.g., from 4-1BB or CD3c). In some embodiments, the immune cells (e.g., T cells) are administered intravenously.
[0079] In some aspects, also provided herein are methods of reducing or eliminating NEPC cancer cells in a subject in need thereof. The methods comprise contacting NEPC cancer cells with engineered immune cells comprising a chimeric antigen receptor (CAR) comprising a CEACAM5 antigen-binding moiety, a hinge from an immunoglobulin, a transmembrane domain, and an immune cell activation moiety, wherein the immune cell activation moiety comprises one or more signaling domains. In some embodiments, the NEPC cancer cells comprise CEACAM5.sup.+ NEPC cancer cells.
[0080] In some embodiments, the reduction or elimination of NEPC cancer cells in a subject in need thereof is due to an anti-tumor immune response elicited by the CAR-modified T cells. In certain embodiments, the anti-tumor immune response elicited by the CAR-modified T cells may be an active or a passive immune response, or alternatively may be due to a direct vs indirect immune response.
[0081] Combination Therapies
[0082] A CAR described herein may be used in combination with other known agents and therapies. Administered “in combination”, as used herein, means that two (or more) different treatments are delivered to the subject during the course of the subject's affliction with the disorder, e.g., the two or more treatments are delivered after the subject has been diagnosed with the disorder and before the disorder has been cured or eliminated or treatment has ceased for other reasons. In some embodiments, the delivery of one treatment is still occurring when the delivery of the second begins, so that there is overlap in terms of administration. This is sometimes referred to herein as “simultaneous” or “concurrent delivery”. In other embodiments, the delivery of one treatment ends before the delivery of the other treatment begins. In some embodiments of either case, the treatment is more effective because of combined administration. For example, the second treatment is more effective, e.g., an equivalent effect is seen with less of the second treatment, or the second treatment reduces symptoms to a greater extent, than would be seen if the second treatment were administered in the absence of the first treatment, or the analogous situation is seen with the first treatment. In some embodiments, delivery is such that the reduction in a symptom, or other parameter related to the disorder is greater than what would be observed with one treatment delivered in the absence of the other. The effect of the two treatments can be partially additive, wholly additive, or greater than additive. The delivery can be such that an effect of the first treatment delivered is still detectable when the second is delivered.
[0083] A CAR described herein and the at least one additional therapeutic agent can be administered simultaneously, in the same or in separate compositions, or sequentially. For sequential administration, the CAR-expressing cell described herein can be administered first, and the additional agent can be administered second, or the order of administration can be reversed.
EXAMPLES
[0084] The following are examples of methods and compositions of the invention. It is understood that various other embodiments may be practiced, given the general description provided herein.
[0085] Below are examples of specific embodiments for carrying out the present invention. The examples are offered for illustrative purposes only, and are not intended to limit the scope of the present invention in any way. Efforts have been made to ensure accuracy with respect to numbers used (e.g., amounts, temperatures, etc.), but some experimental error and deviation should, of course, be allowed for.
[0086] The practice of the present invention will employ, unless otherwise indicated, conventional methods of protein chemistry, biochemistry, recombinant DNA techniques and pharmacology, within the skill of the art. Such techniques are explained fully in the literature. See, e.g., T. E. Creighton, Proteins: Structures and Molecular Properties (W.H. Freeman and Company, 1993); A. L. Lehninger, Biochemistry (Worth Publishers, Inc., current addition); Sambrook, et al., Molecular Cloning: A Laboratory Manual (2nd Edition, 1989); Methods In Enzymology (S. Colowick and N. Kaplan eds., Academic Press, Inc.); Remington's Pharmaceutical Sciences, 18th Edition (Easton, Pa.: Mack Publishing Company, 1990); Carey and Sundberg Advanced Organic Chemistry 3.sup.rd Ed. (Plenum Press) Vols A and B(1992).
[0087] Materials and Methods
[0088] Cell lines. LNCaP, CWR22Rv1, and DU145 (ATCC) were grown in RPMI with 10% FBS. NCI-H660 (ATCC) and LASCPC-01 (Lee J K, et al., Cancer Cell, 2016, 29:536-547) were grown in HITES media containing RPMI, 5% FBS, 10 nM hydrocortisone, 10 nM beta-estradiol (Sigma), insulin-transferrin-selenium, and Glutamax (Life Technologies). MSKCC EF1 was derived from the organoid line MSKCC-CaP4 (Gao D, et al., Cell, 2014, 159:176-187) and was grown in RPMI with 10% FBS.
[0089] Flow Cytometry. LNCaP was non-enzymatically dissociated with Versene EDTA solution (Thermo Fisher Scientific). NCI-H660 was collected from suspension culture and dissociated mechanically by pipetting. Cell lines were washed with PBS and incubated in flow cytometry staining buffer (PBS with 2% FBS and 0.09% sodium azide) with primary antibody or isotype control antibodies for 1 h. Cells were washed with PBS and incubated with mouse or rabbit IgG (H+L) fluorescein-conjugated secondary antibody (R&D Systems) for 1 h. Cells were washed with PBS, resuspended in flow cytometry staining buffer, and analyzed on a BD FACSCanto (BD Biosciences).
[0090] Lentiviral Vectors. The third-generation lentiviral vector FU-CGW, derived from FUGW, was used to label target cell lines with GFP for co-culture experiments. Human CEACAM5 cDNA was cloned into FU-CGW by NEBuilder HiFi DNA Assembly (New England Biolabs) to generate the lentiviral vector FU-CEACAM5-CGW to express CEACAM5 in select target cell lines. The short spacer and longer spacer CEACAM5 CAR constructs (described in
[0091] CAR T Cell Engineering and Co-culture Assays. Deidentified human PBMCs were obtained from the UCLA Virology Core Laboratory and grown in TCM base media composed of AIM V medium (Thermo Fisher Scientific), 5% heat-inactivated human AB serum, 2 mM glutamine, and 55 uM 2-mercaptoethanol (Sigma). For co-culture experiments involving interferon gamma release assays measured by ELISA, human PBMCs were activated in a 24-well plate coated with 1 ug/ml anti-CD3 (eBioscience OKT-3), 1 ug/ml anti-CD28 (eBioscience CD28.2), and 300 U/ml IL-2 in TCM base media. After 48 h, cells were spin infected daily for two days with various CEACAM5 CAR lentiviruses at an MOI of approximately 5-11 in TCM base media, 300 U/ml IL-2, and 8 ug/ml polybrene. After each infection, the cells were washed and grown in TCM base media with 300 U/ml IL-2. 96 h after final spin infection, T cell transduction efficiency was measure by flow cytometry and T cells were co-cultured with target cells at a target:effector ratio of 1:1. Supernatant was harvested at 12 and 24 h (to obtain experimental data shown in
Example 1: Validation of CEACAM5 as a Target Antigen in NEPC
[0092] CEACAM5 was identified as a candidate NEPC target antigen by transcriptomic analysis of diverse prostate cancer datasets and by integrated transcriptomic and proteomic analysis of the prostate cancer cell lines (See Lee et al, Proc Natl Acad Sci USA. 2018 May 8; 115(19)).
[0093] Of the candidates with high composite ranks, the PrAd-specific expression of STEAP1, FXYD3, and FOLH1 (PSMA) and the NEPC-specific expression of NCAM1, SNAP25, and CEACAM5 were validated by immunoblot (
[0094] The potential for CEACAM5-targeted therapy in NEPC was examined. The safety implications were determined by the systemic expression of CEACAM5 in normal human tissues at the mRNA and protein levels. Evaluation of the NIH GTEx database showed that CEACAM5 gene expression in men is limited to the colon, esophagus, and small intestine (See The Genotype-Tissue Expression (GTEx) project, Nature Genetics, 2013, 45:580-585, which is incorporated by reference in its entirety). In concordance with gene expression data from the GTEx database, immunoblot analysis of a range of human tissue lysates from vital organs revealed absence of CEACAM5 protein expression in the brain, heart, kidney, liver, and lung (
[0095] These data indicate that CEACAM5 is a promising target antigen for therapeutic development in NEPC.
Example 2: Therapeutic Targeting of CEACAM5 in NEPC
[0096] Two lentiviral CEACAM5 CAR constructs encoding a single chain variable fragment (scFv) derived from labetuzumab (See Stein R & Goldenberg D M, Mol Cancer Ther., 2004, 3:1559-1564, which is incorporated by reference in its entirety; other suitable anti-CEACAM5 antibodies are described in International Pat. Pub. No. WO2014079886, which is incorporated by reference in its entirety), hinge/spacer, CD28 transmembrane domain, CD28 co-stimulatory domain, and CD3 activation domain were generated(
[0097] Analysis of the supernatant at 12 and 24 hours by interferon-gamma (IFN-γ) ELISA revealed enhanced antigen-specific IFN-γ release associated with the long spacer CEACAM5 CAR (
[0098] To quantify cytotoxicity, co-culture assays in an Incucyte ZOOM (See Artymovich K & Appledorn, Methods Mol Biol., 2015, 1219:35-42, incorporated by reference in its entirety), a live cell imaging and analysis system allowing for direct enumeration of effector and target cells based on bright-field and fluorescence imaging were performed. Varying effector-to-target ratios of T cells transduced with the long spacer CEACAM5 CAR and either MSKCC EF1 (CEACAM5-negative) or NCI-H660 (CEACAM5-positive) target NEPC cell lines engineered to express green fluorescent protein (GFP) were co-cultured. Target cell counts were calculated and plotted to show relative target cell viability over time in co-culture with effector cells. Co-culture of long spacer CEACAM5 CAR-transduced T cells with NCI-H660 led to >80-90% cell kill by 48 hours at effector-to-target ratios of 1:1 and 2:1 (
[0099] These data indicate that a CEACAM5 CAR-based targeting strategy is effective in reducing viability of NEPC cells.
Example 3: Therapeutic Targeting of CEACAM5 in Small Cell Cancers
[0100] A number of cancer cell lines (e.g., small cell lung cancer (SCLC), small cell carcinoma of the pancreas (SCCP), small cell prostate cancer) are screened for the surface expression of CEACAM5 using flow cytometry. For cancer cell lines that are CEACAM5 positive, a co-culture with CEACAM5-CAR-T cells is performed. Human peripheral blood mononuclear cells (PBMCs) from donors is obtained and activated with anti-CD3/anti-CD28 dynabeads. After four days, PBMCs are transduced with the CEACAM5-CAR. Following transduction and removal of dynabeads (seven days after activation), the CAR-T cells are used for co-culture with target cell lines (e.g., small cell lung cancer (SCLC), small cell carcinoma of the pancreas (SCCP), small cell prostate cancer) that express the CEACAM5 antigen. Varying effector-to-target ratios of target cells to T cells are tested, and cytotoxicity is measured by Incucyte live cell image analysis. Antigen-specific release of IFN-γ is analyzed in the supernatant by ELISA after 24 and 48 hrs in co-culture.
Example 4: IFN-γ Release Using Additional CARS with Alternative Co-Stimulatory Domains
[0101] Additional lentiviral CEACAM5 CAR constructs encoding a single chain variable fragment (scFv) derived from labetuzumab (See Stein R & Goldenberg D M, Mol Cancer Ther., 2004, 3:1559-1564, which is incorporated by reference in its entirety; other suitable anti-CEACAM5 antibodies are described in International Pat. Pub. No. WO2014079886, which is incorporated by reference in its entirety), hinge/spacer, CD28 transmembrane domain, 4-1BB co-stimulatory domain, and CD3ζ activation domain (
[0102] Analysis of the supernatant at 24 and 48 hours by interferon-gamma (IFN-γ) ELISA revealed that antigen-specific IFN-γ release associated with the long spacer-CS2 and long spacer-CS3 CARs that had alternative co-stimulatory domains was comparable to the long spacer-CS1 CARs with CD28 as co-stimulatory domain (
[0103] As discussed in Example 2, cytotoxicity was quantified in the co-culture assays in an Incucyte ZOOM, a live cell imaging and analysis system allowing for direct enumeration of effector and target cells based on bright-field and fluorescence imaging were performed. Varying effector-to-target ratios of T cells transduced with various long spacer CEACAM5 CARs and either DU145 (CEACAM5-negative) or DU145-CEACAM5 (CEACAM5-positive) target prostate adenocarcinoma cell lines engineered to express green fluorescent protein (GFP) were co-cultured.
[0104] These data indicate that CEACAM5 CARs with CD28, 4-1BB, or CD28-4-1BB as co-stimulatory domains function in a similar manner
TABLE-US-00002 SEQUENCE LISTING SEQ ID NO: AMINO ACID SEQUENCE SEQ ID NO: 1 GFDFTTY SEQ ID NO: 2 HPDSST SEQ ID NO: 3 LYFGFPWFAY SEQ ID NO: 4 KASQDVGTSVA SEQ ID NO: 5 WTSTRHT SEQ ID NO: 6 QQYSLYRS SEQ ID NO: 7 EVQLVESGGGVVQPGRSLRLSCSASGFDFTTYWMSWVRQAPGKG LEWIGEIHPDSSTINYAPSLKDRFTISRDNAKNTLFLQMDSLRPEDT GVYFCASLYFGFPWFAYWGQGTPVTVSSGGGGSGGGGSGGGGSD IQLTQSPSSLSASVGDRVTITCKASQDVGTSVAWYQQKPGKAPKL LIYWTSTRHTGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYSL YRSFGQGTKVEIKRESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTL MISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQ FNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAK GQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNG QPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHE ALHNHYTQKSLSLSLGKMFWVLVVVGGVLACYSLLVTVAFIIFW VRSKRSRGGHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSGG GRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDP EMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGH DGLYQGLSTATKDTYDALHMQALPPR