COMPOSITION FOR CELL TRANSPLANT, AND METHOD FOR CELL TRANSPLANT

20210252074 · 2021-08-19

Assignee

Inventors

Cpc classification

International classification

Abstract

Provided are a composition for cell transplant and a method for cell transplant, both of which enable a myocardial tissue to favorably retain cardiac myocytes and/or cardiac progenitors and can improve the persistence and proliferation of transplanted cells. The composition for cell transplant of the present invention is a composition for cell transplant, containing cells and an aqueous solution containing a protein (A), the cells including a cardiac myocyte and/or a cardiac progenitor, the protein (A) having a degree of hydrophobicity of 0.2 to 1.2, the protein (A) containing a polypeptide chain (Y) and/or a polypeptide chain (Y′), the protein (A) containing 1 to 100 polypeptide chains as a total of the polypeptide chain (Y) and the polypeptide chain (Y′), the polypeptide chain (Y) being a polypeptide chain having 2 to 100 continuous amino acid sequences (X), the amino acid sequence (X) having any one of a VPGVG sequence (1) corresponding to an amino acid sequence of SEQ ID NO: 1, a GVGVP sequence (2) corresponding to an amino acid sequence of SEQ ID NO: 2, a GPP sequence, a GAP sequence, and a GAHGPAGPK sequence (3) corresponding to an amino acid sequence of SEQ ID NO: 3, the polypeptide chain (Y′) being a polypeptide chain having a structure in which 0.1 to 5% amino acid residues in the polypeptide chain (Y) are replaced by a lysine residue and/or an arginine residue and including 1 to 100 residues as a total of the lysine residue and the arginine residue.

Claims

1. A composition for cell transplant, comprising cells and an aqueous solution containing a protein (A), the cells including a cardiac myocyte and/or a cardiac progenitor, the protein (A) having a degree of hydrophobicity of 0.2 to 1.2, the protein (A) containing a polypeptide chain (Y) and/or a polypeptide chain (Y′), the protein (A) containing 1 to 100 polypeptide chains as a total of the polypeptide chain (Y) and the polypeptide chain (Y′), the polypeptide chain (Y) being a polypeptide chain having 2 to 100 continuous amino acid sequences (X), the amino acid sequence (X) having any one of a VPGVG sequence (1) corresponding to an amino acid sequence of SEQ ID NO: 1, a GVGVP sequence (2) corresponding to an amino acid sequence of SEQ ID NO: 2, a GPP sequence, a GAP sequence, and a GAHGPAGPK sequence (3) corresponding to an amino acid sequence of SEQ ID NO: 3, the polypeptide chain (Y′) being a polypeptide chain having a structure in which 0.1 to 5% amino acid residues in the polypeptide chain (Y) are replaced by a lysine residue and/or an arginine residue and including 1 to 100 residues as a total of the lysine residue and the arginine residue.

2. The composition for cell transplant according to claim 1, wherein the protein (A) further contains a polypeptide chain (S) having 2 to 100 continuously bonded GAGAGS sequences (4) corresponding to an amino acid sequence of SEQ ID NO: 4.

3. The composition for cell transplant according to claim 2, wherein one molecule of the protein (A) has a ratio in the number of sequences of the GAGAGS sequence (4) to a total of the amino acid sequence (X) and an amino acid sequence (X′) {GAGAGS sequence (4):total of amino acid sequence (X) and amino acid sequence (X′)} of 4:1 to 1:20, the amino acid sequence (X′) being an amino acid sequence having a structure in which 20 to 60% amino acid residues in the amino acid sequence (X) are replaced by a lysine residue and/or an arginine residue.

4. The composition for cell transplant according to claim 1, wherein the protein (A) has a molecular mass determined by an SDS polyacrylamide gel electrophoresis (SDS-PAGE) method of 15 to 200 kDa.

5. The composition for cell transplant according to claim 1, wherein the protein (A) is a protein (A1) containing a polypeptide chain (Y′1), the polypeptide chain (Y′1) being a polypeptide chain having a structure in which one amino acid residue in the polypeptide chain (Y1) in which the amino acid sequence (X) is the GVGVP sequence (2) is replaced by a lysine residue.

6. The composition for cell transplant according to claim 2, wherein the protein (A) is a protein (A2) that contains a polypeptide chain (S1) having a (GAGAGS).sub.4 sequence (5) corresponding to an amino acid sequence of SEQ ID NO: 5 and a polypeptide chain (Y′2) having a (GVGVP).sub.4GKGVP(GVGVP).sub.3 sequence (6) corresponding to an amino acid sequence of SEQ ID NO: 6.

7. The composition for cell transplant according to claim 1, wherein the protein (A) is present at a concentration of 1 to 20 wt % based on a total weight of the composition for cell transplant.

8. The composition for cell transplant according to claim 1, wherein the cells are present at a concentration of 1×10.sup.5 to 1×10.sup.9 pcs/mL based on a total fluid volume of the composition for cell transplant.

9. The composition for cell transplant according to claim 1, wherein the cells are derived from a stem cell.

10. The composition for cell transplant according to claim 1, wherein the cells are derived from a mammal.

11. The composition for cell transplant according to claim 1, wherein the cells are derived from a human pluripotent stem cell.

12. The composition for cell transplant according to claim 1, configured to be used for a cardiac myocyte transplant therapy.

13. The composition for cell transplant according to claim 1, configured to be used for at least one disease selected from the group consisting of myocardial infarction, angina pectoris, cardiomyopathy, and myocarditis.

14. A method for cell transplant, comprising transplanting the composition for cell transplant according to claim 1 in a myocardial tissue of a mammal other than human.

15. A method for cell transplant according to claim 14, wherein 1×10.sup.3 to 1×10.sup.8 cells are transplanted in the myocardial tissue.

Description

DESCRIPTION OF EMBODIMENTS

[0013] The composition for cell transplant of the present invention is a composition for cell transplant, containing cells and an aqueous solution containing a protein (A), the cells including a cardiac myocyte and/or a cardiac progenitor, the protein (A) having a degree of hydrophobicity of 0.2 to 1.2, the protein (A) containing a polypeptide chain (Y) and/or a polypeptide chain (Y′), the protein (A) containing 1 to 100 polypeptide chains as a total of the polypeptide chain (Y) and the polypeptide chain (Y′), the polypeptide chain (Y) being a polypeptide chain having 2 to 100 continuous amino acid sequences (X), the amino acid sequence (X) having any one of a VPGVG sequence (1) corresponding to an amino acid sequence of SEQ ID NO: 1, a GVGVP sequence (2) corresponding to an amino acid sequence of SEQ ID NO: 2, a GPP sequence, a GAP sequence, and a GAHGPAGPK sequence (3) corresponding to an amino acid sequence of SEQ ID NO: 3, the polypeptide chain (Y′) being a polypeptide chain having a structure in which 0.1 to 5% amino acid residues in the polypeptide chain (Y) are replaced by a lysine residue and/or an arginine residue and including 1 to 100 residues as a total of the lysine residue and the arginine residue.

[0014] Hereinafter, the structure of the composition for cell transplant of the present invention is described.

(Aqueous Solution Containing Protein (A))

[0015] The protein (A) is obtainable by extraction from a natural product, organic synthesis (e.g., enzyme method, solid phase synthesis, and liquid phase synthesis), genetic recombination, or the like. Organic synthesis can be performed according to a method disclosed in “Biochemical Experimental Course 1, Chemistry of Proteins IV (Seikagaku Jikken Kouza 1, Tanpakushitsu no Kagaku IV) (1981. 7. 1, edited by The Japanese Biochemical Society, published by Tokyo Kagaku Dozin Co., Ltd.)” or a method disclosed in “Biochemical Experimental Course 2, Chemistry of Proteins (second volume) (Zoku Seikagaku Jikken Kouza 2, Tanpakushitsu no Kagaku (Ge)) (1987. 5. 20, edited by The Japanese Biochemical Society, published by Tokyo Kagaku Dozin Co., Ltd.)”. Genetic recombination can be performed according to a method disclosed in JP 3338441 T or the like. The protein (A) can be obtained by any of extraction from a natural product, organic synthesis, and genetic recombination. Still, preferred is genetic recombination in terms of easiness in changing an amino acid sequence and inexpensive mass production.

[0016] Specifically, the polypeptide chain (Y) in the present invention includes a (VPGVG).sub.b sequence, a (GVGVP).sub.c sequence, a (GPP).sub.d sequence, a (GAP), sequence, and a (GAHGPAGPK).sub.f sequence. (The letters b to f each represent the number of continuous amino acid sequences (X) and are each an integer of 2 to 100).

[0017] When one molecule of the protein (A) contains multiple polypeptide chains (Y), the polypeptide chains (Y) may have one kind or two or more kinds of sequences selected from the group consisting of the (VPGVG).sub.b sequence, the (GVGVP).sub.c sequence, the (GPP).sub.d sequence, the (GAP).sub.e sequence, and the (GAHGPAGPK).sub.f sequence.

[0018] When the protein (A) contains multiple polypeptide chains (Y) having amino acid sequences (X) of the same kind, the polypeptide chains (Y) may have the same or different number of continuous amino acid sequences (X). In other words, the protein (A) may contain polypeptide chains (Y) having the same number for a letter selected from b to f or may contain polypeptide chains (Y) having different numbers for a letter selected from b to f, i.e., different numbers of continuous amino acid sequences (X).

[0019] The amino acid sequence (X) constituting the polypeptide chain (Y) preferably has the VPGVG sequence (1) and/or the GVGVP sequence (2) in terms of the persistence and proliferation of cardiac myocytes and/or cardiac progenitors (hereinafter, collectively referred to as “cardiac myocytes or the like” when these need no particular distinguishment). In other words, the polypeptide chain (Y) preferably has the (VPGVG).sub.b sequence and/or the (GVGVP).sub.c sequence in terms of the persistence of cardiac myocytes or the like. When the protein (A) contains polypeptide chains (Y) having different kinds of amino acid sequences (X), the polypeptide chains (Y) preferably have two or more kinds of sequences selected from the group consisting of the (GPP).sub.d sequence, the (GVGVP).sub.c sequence, and the (GAHGPAGPK).sub.f sequence, particularly preferably have the (GVGVP).sub.c sequence and the (GAHGPAGPK).sub.f sequence in terms of the persistence and proliferation of cardiac myocytes or the like.

[0020] The polypeptide chain (Y) is a polypeptide chain having 2 to 100 continuous amino acid sequences (X) (each of the letters b to f is 2 to 100). In terms of the persistence and proliferation of cardiac myocytes or the like, the number of continuous sequences is preferably 2 to 50 (each of the letters b to f is 2 to 50), more preferably 2 to 30 (each of the letters b to f is 2 to 30).

[0021] The polypeptide chain (Y′) in the present invention is a polypeptide chain having a structure in which 0.1 to 5% amino acid residues in the polypeptide chain (Y) are replaced by a lysine residue (K) and/or an arginine residue (R) and having 1 to 100 residues as a total of the lysine residue and the arginine residue. Specifically, the polypeptide chain (Y′) is a polypeptide chain in which part or the whole of the amino acid sequence (X) constituting the polypeptide chain (Y) is replaced by the following amino acid sequence (X′) and 1 to 100 amino acid residues in the polypeptide chain (Y) are replaced by a lysine residue (K) and/or an arginine residue (R).

[0022] Amino acid sequence (X′): an amino acid sequence in which 20 to 60% amino acid residues in the amino acid sequence (X) is replaced by a lysine residue (K) and/or an arginine residue (R).

[0023] In the amino acid sequence (X′), the number of amino acid residues in the amino acid sequence (X) replaced (the number replaced by a lysine residue (K) and/or an arginine residue (R)) is preferably 1 to 5, more preferably 1 to 4, still more preferably 1 to 3 in terms of the solubility of the protein (A) in water.

[0024] The amino acid sequence (X′) includes preferably at least one kind of sequence selected from the group consisting of a GKGVP sequence (7) corresponding to an amino acid sequence of SEQ ID NO: 7, a GKGKP sequence (8) corresponding to an amino acid sequence of SEQ ID NO: 8, a GKGRP sequence (9) corresponding to an amino acid sequence of SEQ ID NO: 9, and a GRGRP sequence (10) corresponding to an amino acid sequence of SEQ ID NO: 10, more preferably at least one kind of sequence selected from the group consisting of the GKGVP sequence (7) and the GKGKP sequence (8) in terms of the solubility of the protein (A) in water.

[0025] Whether a polypeptide chain is the polypeptide chain (Y′) or not is determined by replacing every K and R in the sequences of the protein (A) by a different amino acid residue (G, A, V, P, or H) and checking if the resultant polypeptide chain is the polypeptide chain (Y) or not. When the amino acid sequence (X) is the GAHGPAGPK sequence (3) that includes K, the determination method is changed as follows. That is, in the replacement of every K and R in the sequences of the protein (A) by a different amino acid residue (G, A, V, P, or H), when a GAHGPAGPα sequence appears (a represents G, A, V, P, or H), α is further replaced by K. When the sequence becomes the polypeptide chain (Y) as a result of the replacement, the sequence before the replacement of amino acid residues is considered to be the polypeptide chain (Y′). In the polypeptide chain (Y′), the number of amino acid residues in the polypeptide chain (Y) replaced is preferably 1 to 70, more preferably 1 to 30 in terms of the solubility of the protein (A) in water and the persistence of the cardiac myocytes or the like. The polypeptide chain (Y′) is a polypeptide chain having a structure in which 0.1 to 5% amino acid residues in the polypeptide chain (Y) are replaced by a lysine residue (K) and/or an arginine residue (R). The proportion is preferably 0.1 to 4%, more preferably 0.5 to 3% in terms of the solubility of the protein (A) in water and the persistence and proliferation of cardiac myocytes or the like.

[0026] The protein (A) in the present invention contains a polypeptide chain (Y) and/or a polypeptide chain (Y′), and the protein (A) contains 1 to 100 polypeptide chains as a total of the polypeptide chain (Y) and the polypeptide chain (Y′). When the protein (A) contains polypeptide chains (Y) having different kinds of amino acid sequence (X) and/or different numbers of continuous sequences, each polypeptide chain (Y) is counted as one and the number of polypeptide chains (Y) corresponds to the total number of polypeptide chains (Y). The same shall apply to the polypeptide chain (Y′).

[0027] One molecule of the protein (A) contains 1 to 100 polypeptide chains as a total of the polypeptide chain (Y) and the polypeptide chain (Y′). The number is preferably 1 to 80, particularly preferably 1 to 60 in terms of the persistence and proliferation of cardiac myocytes or the like.

[0028] In the protein (A), one polypeptide chain (Y) corresponds to a portion where amino acid sequences (X) of the same kind are repetitively bonded and it continues until a point bonded to a sequence different from the amino acid sequence (X). For example, in a (GVGVP).sub.100GAGAGS(VPGVG).sub.20 sequence, the polypeptide chain (Y) has two sequences: (GVGVP).sub.100 and (VPGVG).sub.20. Similarly, one polypeptide chain (Y′) corresponds to a portion where amino acid sequences (X) of the same kind are repetitively bonded and it continues until a point bonded to a sequence different from the amino acid sequence (X), wherein every lysine residue (K) and arginine residue (R) in the sequences of the protein (A) is replaced by a different amino acid (G, A, V, P, or H). For example, a (GVGVP).sub.4GKGVP(GVGVP).sub.3GAGAGS(GVGVP).sub.4GKGVP(GVGVP).sub.3 sequence includes two polypeptide chains (Y′) both being (GVGVP).sub.4GKGVP(GVGVP).sub.3.

[0029] The protein (A) in the present invention has a degree of hydrophobicity of 0.2 to 1.2. The degree of hydrophobicity is preferably 0.3 to 1.2, more preferably 0.4 to 1.2, still more preferably 0.45 to 1.2, particularly preferably 0.60 to 1.2, most preferably 0.60 to 0.75 in terms of the solubility of the protein (A) in water and in terms of gelation. The degree of hydrophobicity of the protein (A) shows the degree of hydrophobicity of molecules of the protein (A) and can be calculated according to the following formula by assigning the number (Ma) of amino acid residues of each kind constituting one molecule of the protein (A), the degree of hydrophobicity (Na) of each amino acid, and the total number (MT) of amino acid residues in one molecule of the protein (A). For the degree of hydrophobicity of amino acids, the following values disclosed in Non-Patent Literature (Albert. L. Lehninger, David. L. Nelson, Lehninger principles of biochemistry, First volume, Hirokawa-Shoten Ltd., 2010. 9, p. 346-347) are used.


Degree of hydrophobicity=Σ(Mα×Nα)/(MT)

[0030] Mα: number of amino acid residues of each kind in one molecule of protein (A)

[0031] Nα: degree of hydrophobicity of each amino acid

[0032] MT: total number of amino acid residues in one molecule of protein (A)

[0033] A (alanine): 1.8

[0034] R (arginine): −4.5

[0035] N (asparagine): −3.5

[0036] D (asparagine acid): −3.5

[0037] C (cysteine): 2.5

[0038] Q (glutamine): −3.5

[0039] E (glutamic acid): −3.5

[0040] G (glycine): −0.4

[0041] H (histidine): −3.2

[0042] I (isoleucine): 4.5

[0043] L (leucine): 3.8

[0044] K (lysine): −3.9

[0045] M (methionine): 1.9

[0046] F (phenylalanine): 2.8

[0047] P (proline): −1.6

[0048] S (serine): −0.8

[0049] T (threonine): −0.7

[0050] W (tryptophan): −0.9

[0051] Y (tyrosine): −1.3

[0052] (valine): 4.2

[0053] For example, when the protein (A) has a (GVGVP).sub.4GKGVP(GVGVP).sub.3 sequence (6) corresponding to an amino acid sequence of SEQ ID NO: 6, the degree of hydrophobicity of the protein (A) is: degree of hydrophobicity of protein (A)={16 (number of Gs)×(−0.4)+15 (number of Vs)×4.2+8 (number of Ps)×(−1.6)+1 (number of Ks)×(−3.9)}/40 (total number of amino acid residues)=1.0.

[0054] The protein (A) in the present invention preferably further has the GAGAGS sequence (4). A protein (A) having the GAGAGS sequence (4) is further less likely to be intravitally degraded, which tends to allow the protein (A) to survive without being degraded until cardiac myocytes or the like are sufficiently engrafted in a myocardial tissue. The GAGAGS sequence (4) preferably contains a polypeptide chain (S) having 2 to 100 continuous GAGAGS sequences (4) corresponding to an amino acid sequence of SEQ ID NO: 4 in terms of biodegradation resistance. In the polypeptide chain (S), the number of continuous GAGAGS sequences (4) is preferably 2 to 100, more preferably 2 to 50, still more preferably 3 to 40, particularly preferably 4 to 30 in terms of biodegradation resistance. The protein (A), when containing the polypeptide chain (S), may contain at least one polypeptide chain (S) in one molecule. Still, the number of polypeptide chains (5) is preferably 1 to 20, more preferably 3 to 10 in terms of biodegradation resistance.

[0055] When the protein (A) contains two or more polypeptide chains as a total of the polypeptide chain (Y), the polypeptide chain (Y′), and the polypeptide chain (S), the protein (A) may have an intervening amino acid sequence (Z) between polypeptide chains. The intervening amino acid sequence (Z) is an amino acid sequence including one amino acid or two or more amino acids bonded to each other and being other than the polypeptide chain (Y), polypeptide chain (Y′), and polypeptide chain (S). The number of amino acids constituting the intervening amino acid sequence (Z) is preferably 1 to 30, more preferably 1 to 15, particularly preferably 1 to 10 in terms of biodegradation resistance. Specific examples of the intervening amino acid sequence (Z) include a VAAGY sequence (11) corresponding to an amino acid sequence of SEQ ID NO: 11, a GAAGY sequence (12) corresponding to an amino acid sequence of SEQ ID NO: 12, and a LGP sequence.

[0056] The protein (A) may include a terminal amino acid sequence (T) at the N- and/or C-terminus of any of the polypeptide chain (Y), polypeptide chain (Y′), and polypeptide chain (S) located at each terminus of the protein (A). The terminal amino acid sequence (T) is an amino acid sequence including one amino acid or two or more amino acids bonded to each other and being other than the polypeptide chain (Y), polypeptide chain (Y′), and polypeptide chain (S). The number of amino acids constituting the terminal amino acid sequence (T) is preferably 1 to 100, more preferably 1 to 50, particularly preferably 1 to 40 in terms of biodegradation resistance. Specific examples of the terminal amino acid sequence (T) include a MDPVVLQRRDWENPGVTQLNRLAAHPPFASDPM sequence (13) corresponding to an amino acid sequence of SEQ ID NO: 13.

[0057] The protein (A) may contain, in addition to the terminal amino acid sequence (T), a protein or peptide having a special amino acid sequence (hereinafter, these are collectively referred to as a “purification tag”) at the N- and/or C-terminus of the protein (A) in order to achieve easy purification or detection of the expressed protein (A). For the purification tag, a tag for affinity purification is used. Examples of such a purification tag include glutathione-S-transferase (GTS), maltose binding protein (MBP), HQ tag, Myc tag, HA tag, FLAG tag, 6×His tag formed from polyhistidine, V5 tag, Xpress tag, AU1 tag, T7 tag, VSV-G tag, DDDDK tag, S tag, Cruz Tag 09™, Cruz Tag 22™, Cruz Tag 41™, Glu-Glu tag, Ha.11 tag, and KT3 tag.

[0058] Following are combination examples of purification tag (i) and ligand (ii) for recognizing and binding the tag.

[0059] (i-1) glutathione-S-transferase (GTS) (ii-1) glutathione

[0060] (i-2) maltose binding protein (MBP) (ii-2) amylose

[0061] (i-3) HQ tag (ii-3) nickel

[0062] (i-4) Myc tag (ii-4) anti-Myc antibody

[0063] (i-5) HA tag (ii-5) anti-HA antibody

[0064] (i-6) FLAG tag (ii-6) anti-FLAG antibody

[0065] (i-7) 6×His tag (ii-7) nickel or cobalt

[0066] The purification tag sequence can be introduced by a method such as a method for inserting a nucleic acid encoding a purification tag at the 5′- or 3′-terminus of a nucleic acid encoding the protein (A) in an expression vector or a method of using a commercially available vector for introducing a purification tag.

[0067] One molecule of the protein (A) contains the polypeptide chain (Y) and the polypeptide chain (Y′) in a total amount (wt %) of preferably 10 to 90 wt %, more preferably 20 to 80 wt % based on the molecular mass of the protein (A) in terms of interaction with cardiac myocytes or the like and in terms of the persistence and proliferation of cardiac myocytes or the like.

[0068] The total amount of the polypeptide chain (Y) and the polypeptide chain (Y′) in the protein (A) can be determined by amino acid sequencing. Specifically, the following determination method is applicable.

<Method for Determining Total Amount of Polypeptide Chain (Y) and Polypeptide Chain (Y′)>

[0069] Amino acid sequencing is performed with peptide sequencer (protein sequencer) PPSQ-33A available from Shimadzu Corporation. From the determined amino acid sequence, the total amount of the polypeptide chain (Y) and the polypeptide chain (Y′) is calculated according to the following formula (1).


Total amount of polypeptide chain (Y) and polypeptide chain (Y′)=Σ(γ×β)/Σ(α×β)×100  (1)

[0070] α: number of amino acid residues of each kind in protein (A)

[0071] β: molecular mass of each amino acid

[0072] γ: number of amino acids of each kind in polypeptide chain (Y) and polypeptide chain (Y′)

[0073] One molecule of the protein (A) contains the amino acid sequence (X) and the amino acid sequence (X′) in a total amount (wt %) of preferably 10 to 90 wt %, more preferably 20 to 80 wt % based on the molecular mass of the protein (A) in terms of the persistence and proliferation of cardiac myocytes or the like.

[0074] The total amount of the amino acid sequence (X) and the amino acid sequence (X′) in the protein (A) can be determined with a protein sequencer. Specifically, the following method is applicable.

<Method for Determining Amount of Amino Acid Sequence (X) and Amino Acid Sequence (X′)>

[0075] The protein (A) is degraded into about 30 residues or less using two or more methods selected from methods for cutting a protein with a specific amino acid residue. The fragments of the protein (A) are separated by high-performance liquid chromatography (HPLC), and then the amino acid sequences of the fragments are read with a protein sequencer. The obtained amino acid sequences of the fragments are subjected to peptide mapping, whereby all sequences of the protein (A) are determined. Thereafter, the total amount of the amino acid sequence (X) and the amino acid sequence (X′) is calculated according to the following determination formula.


Total amount (%) of amino acid sequence (X) and amino acid sequence (X′)=[{molecular mass of amino acid sequence (X)}×{number of amino acid sequences (X)}+{molecular mass of amino acid sequence (X′)}×{number of amino acid sequences (X′)}]/{molecular mass of protein (A)}×100

[0076] One molecule of the protein (A) has a ratio in the number of sequences of the GAGAGS sequence (4) to the total of the amino acid sequence (X) and the amino acid sequence (X′) {GAGAGS sequence (4):total of amino acid sequence (X) and amino acid sequence (X′)} of preferably 4:1 to 1:20, more preferably 4:1 to 1:10 in terms of the solubility of the protein (A) in water and the persistence and proliferation of cardiac myocytes or the like.

[0077] The protein (A) has a molecular mass of preferably 15 to 200 kDa, more preferably 15 to 100 kDa in terms of the persistence and proliferation of cardiac myocytes or the like. The molecular mass of the protein (A) can be determined by separating a measurement sample and comparing the migration distance thereof with that of a reference material by the SDS polyacrylamide gel electrophoresis (SDS-PAGE) method.

[0078] Preferred examples of the protein (A) include the following.

(1) Protein Having GVGVP Sequence (2) as Amino Acid Sequence (X)

[0079] (1-1) Preferred is a protein (A1) containing a polypeptide chain (Y′1) having a structure in which one amino acid residue in a polypeptide chain (Y1) having continuous GVGVP sequences (2) is replaced by a lysine residue (K). More preferred are a protein (A2) containing a polypeptide chain (Y′2) having a (GVGVP).sub.4GKGVP(GVGVP).sub.3 sequence (6) and a polypeptide chain (S1) having a (GAGAGS).sub.4 sequence (5); a protein (A4) containing a polypeptide chain (Y′2) and a polypeptide chain (S2) having a (GAGAGS).sub.2 sequence (14); and a protein (A5) containing a polypeptide chain (Y′2), a polypeptide chain (S1), and a polypeptide chain (S2). A specific example is a protein (SELP8K, degree of hydrophobicity 0.62) having a molecular mass of about 80 kDa and having a sequence (15) corresponding to an amino acid sequence of SEQ ID NO: 15. This protein contains 12 polypeptide chains (S1), each of which has a (GAGAGS).sub.4 sequence (5) consisting of four continuous GAGAGS sequences (4), and 13 polypeptide chains (Y′2), each of which has a (GVGVP).sub.4GKGVP(GVGVP).sub.3 sequence (6) having a structure in which one of valine residues (V) in a polypeptide chain (Y2) consisting of eight continuous GVGVP sequences (2) is replaced by a lysine residue (K). To a structure with these polypeptide chains alternately chemically bonded, one polypeptide chain (S2) is bonded which has a (GAGAGS).sub.2 sequence (14) consisting of two continuous GAGAGS sequences (4). Another specific example is a protein (SELP0K, degree of hydrophobicity 0.72) having a molecular mass of about 82 kDa and having a sequence (16) corresponding to an amino acid sequence of SEQ ID NO: 16. This protein contains 17 polypeptide chains (S2) having a (GAGAGS).sub.2 sequence (14) consisting of two continuous GAGAGS sequences (4) and 17 polypeptide chains (Y′2) having a (GVGVP).sub.4GKGVP(GVGVP).sub.3 sequence (6). These polypeptide chains are alternately chemically bonded.

[0080] (1-2) Preferred is a protein (A6) containing a polypeptide chain (Y1) that has continuous GVGVP sequences (2). More preferred is a protein (A7) containing a polypeptide chain (Y1) consisting of two continuous GVGVP sequences (2) and a polypeptide chain (S3) consisting of six continuous GAGAGS sequences (4). A specific example is a protein (SLP4.1, degree of hydrophobicity 0.47) having a molecular mass of about 93 kDa and having a sequence (17) corresponding to an amino acid sequence of SEQ ID NO: 17. This protein contains 29 amino acid blocks (L-1) which are repetitively chemically bonded and each of which contains a polypeptide chain (Y1) and a polypeptide chain (S3) bonded to each other.

(2) Protein Having VPGVG Sequence (1) as Amino Acid Sequence (X)

[0081] (2-1) A preferred example is a protein (A8) containing a polypeptide chain (Y3) consisting of four continuous VPGVG sequences (1) and a polypeptide chain (Y4) consisting of eight continuous VPGVG sequences (1). A more preferred example is a protein (A9) containing a polypeptide chain (Y3) consisting of four continuous VPGVG sequences (1), a polypeptide chain (Y4) consisting of eight continuous VPGVG sequences (1), and a GAGAGS sequence (4). A specific example is a protein (ELP1.1, degree of hydrophobicity 1.12) having a molecular mass of about 220 kDa and having a sequence (18) corresponding to an amino acid sequence of SEQ ID NO: 18. This protein contains repetitively chemically bonded 40 amino acid blocks (L-2) each having a structure in which a polypeptide chain (Y3) is bonded to a GAGAGS sequence (4) and a polypeptide chain (Y4) is further bonded to the structure.

[0082] Also, the protein (A) may be a protein having a homology with a protein having the sequence (15), a protein having the sequence (16), a protein having the sequence (17), or a protein having the sequence (18).

[0083] The homology is preferably 80% or higher, more preferably 90% or higher, still more preferably 95% or higher.

[0084] Any water may be used for the aqueous solution containing the protein (A), but preferred is sterilized water. Examples include those sterilized by various methods, such as water having passed through a microfiltration membrane having a pore diameter of 0.2 μm or smaller, water having passed through an ultrafiltration membrane, water having passed through a reverse osmosis membrane, and ion-exchange water after heat sterilization by heating at 121° C. for 20 minutes in an autoclave.

(Cells)

[0085] As described above, the composition for cell transplant of the present invention can improve the persistence and proliferation of cardiac myocytes and/or cardiac progenitors in a myocardium.

[0086] Examples of the cardiac progenitor include cells on whose surface a protein such as a neurturin receptor (GFRA2) protein, a platelet-derived growth factor receptor α (PDGFRA) protein, or a kinase insert domain protein receptor (KDR) protein is expressed.

[0087] The cardiac myocytes and/or cardiac progenitors are preferably derived from a mammal.

[0088] The cardiac myocytes and/or cardiac progenitors are also preferably derived from stem cells.

[0089] The stem cells may be stem cells isolated from a tissue or successively cultured stem cells. Any kind of stem cells may be used and examples thereof include mouse embryonic stem cells, mouse mesenchymal stem cells, mouse pluripotent stem cells, human embryonic stem cells, human mesenchymal stem cells, and human pluripotent stem cells. Preferred among these are human pluripotent stem cells in terms of handleability and safeness. In terms of immune rejection, a target for cell transplant is preferably a mammal, more preferably a human.

[0090] Stem cells may be differentiated into cardiac myocytes and/or cardiac progenitors by any method such as a method disclosed in (Funakoshi, S. et al., Sci Rep 8, 19111 (2016)) to provide cardiac myocytes and/or cardiac progenitors.

[0091] The composition for cell transplant of the present invention may not contain animal-derived serum or the like. Absence of animal-derived serum or the like can presumably reduce antigenicity.

[0092] The protein (A) contained in the composition for cell transplant of the present invention, including a biological sequence, presumably has high biocompatibility. Moreover, the protein (A) can be inexpensively mass-produced from bacteria such as E. coli, achieving easy production.

[0093] Furthermore, the protein (A) contained in the composition for cell transplant of the present invention is less likely to be degraded by internal proteases and is thus durable, achieving long-term intravital existence.

[0094] The composition for cell transplant of the present invention contains the protein (A) at a concentration of preferably 1 to 20 wt %, more preferably 2 to 20 wt %, still more preferably 10 to 20 wt % based on the total weight of the composition for cell transplant.

[0095] When the concentration of the protein (A) in the composition for cell transplant is 1 to 20 wt % based on the total weight of the composition for cell transplant, the composition for cell transplant has sufficiently high viscosity. Thereby, cardiac myocytes or the like can be favorably engrafted in a myocardial tissue, which improves the persistence of the cardiac myocytes or the like.

[0096] In particular, when the concentration of the protein (A) in the composition for cell transplant is 10 to 20 wt % based on the total weight of the composition for cell transplant, the composition for cell transplant loses fluidity when heated to about 37° C. and results in gel with a certain hardness at which the gel does not lose its form by its own weight. Gelation of the composition for cell transplant can prevent dispersion of cardiac myocytes or the like, which can more improve the persistence of the cardiac myocytes or the like.

[0097] The gelation is achievable without adding a gelator such as a cross-linker to the composition for cell transplant. The gelation proceeds in the presence of the composition for cell transplant only. The composition for cell transplant of the present invention preferably contains no gelator such as a cross-linker.

[0098] The composition for cell transplant of the present invention contains cardiac myocytes and/or cardiac progenitors at a concentration of preferably 1×10.sup.5 to 1×10.sup.9 pcs/mL based on the total fluid volume of the composition for cell transplant.

[0099] When the concentration of the cardiac myocytes or the like in the composition for cell transplant is lower than 1×10.sup.5 pcs/mL based on the total fluid volume of the composition for cell transplant, the number of the cardiac myocytes or the like is too small, which unlikely achieves a sufficient effect of transplanting cells in a myocardial tissue.

[0100] When the concentration of the cardiac myocytes or the like in the composition for cell transplant is higher than 1×10.sup.9 pcs/mL based on the total fluid volume of the composition for cell transplant, the number of the cardiac myocytes or the like is excessive, which tends to result in insufficient improvement in persistence of the cardiac myocytes or the like transplanted in a myocardium. Additionally, such a concentration is uneconomical in terms of cost efficiency.

(Different Component)

[0101] The composition for cell transplant of the present invention may further contain inorganic salt and phosphoric acid (salt).

[0102] Examples of the inorganic salt include sodium chloride, potassium chloride, calcium chloride, magnesium chloride, sodium sulfate, potassium sulfate, calcium sulfate, magnesium sulfate, sodium hydrogen carbonate, potassium hydrogen carbonate, calcium hydrogen carbonate, and magnesium hydrogen carbonate. Here, phosphates are not included in inorganic salt.

[0103] The composition for cell transplant of the present invention contains salt in an amount (wt %) of preferably 0 to 1.3 wt %, more preferably 0.5 to 1.3 wt %, still more preferably 0.7 to 1.1 wt %, particularly preferably 0.85 to 0.95 wt % based on the total weight of the composition for cell transplant in terms of the persistence and proliferation of cardiac myocytes or the like.

[0104] Phosphoric acid (salt) as used herein means phosphoric acid and/or phosphoric salt. Examples of the phosphoric acid (salt) contained in the composition for cell transplant of the present invention include phosphoric acid and phosphates. Examples of the salt include alkali metal salt and alkaline-earth metal salt. Specific examples thereof include sodium salt, potassium salt, calcium salt, and magnesium salt.

[0105] The composition for cell transplant of the present invention contains phosphoric acid (salt) in an amount (wt %) of preferably 0 to 0.30 wt %, more preferably 0.10 to 0.30 wt %, still more preferably 0.12 to 0.28 wt %, particularly preferably 0.14 to 0.26 wt % based on the total weight of the composition for cell transplant in terms of the solubility of the protein (A).

[0106] The composition for cell transplant may further contain a growth factor.

[0107] The type of the growth factor, when contained in the composition for cell transplant, is preferably selected according to the damaged site and the type of the target disease.

[0108] Examples of the growth factor include epidermal growth factors (EGF), insulin-like growth factors (IGF), transforming growth factors (TGF), nerve growth factors (NGF), brain-derived neurotrophic factors (BDNF), vesicular endothelial growth factors (VEGF), granulocyte-colony stimulating factors (G-CSF), granulocyte-macrophage-colony stimulating factors (GM-CSF), platelet-derived growth factors (PDGF), erythropoietin (EPO), thrombopoietin (TPO), basic fibroblast growth factors (bFGF or FGF2), and hepatocyte growth factors (HGF).

[0109] The composition for cell transplant contains a growth factor at a concentration of preferably 0.003 to 9.1 wt %, more preferably 0.003 to 6.25 wt % based on the total weight of the composition for cell transplant in terms of cell proliferation.

[0110] The composition for cell transplant may further contain known substances such as differentiated factors, hormones, chemokines, cytokines, cell adhesion molecules, chemotactic factors, enzymes, enzyme inhibitors, coenzymes, minerals, fats, lipids, sugars, antibiotics, inflammation inhibitors, immunosuppresants, buffering substances, stabilizers, and vitamins.

[0111] The composition for cell transplant has a pH of preferably 5 to 9, more preferably 6 to 8 in terms of tissue affinity. The pH can be adjusted by adding a substance such as a known buffering substance.

[0112] Next, usage of the composition for cell transplant of the present invention is described.

[0113] The composition for cell transplant of the present invention can be used for a cardiac myocyte transplant therapy.

[0114] In other words, a target tissue of the composition for cell transplant of the present invention is a myocardial tissue.

[0115] The composition for cell transplant of the present invention may be used for any disease, and examples thereof include myocardial infarction, angina pectoris, cardiomyopathy, and myocarditis.

[0116] In other words, an embodiment of the present invention is use of the composition for cell transplant of the present invention for a cardiac myocyte transplant therapy, and another embodiment of the present invention is use of the composition for cell transplant of the present invention for a cardiac myocyte transplant therapy in order to cure at least one disease selected from the group consisting of myocardial infarction, angina pectoris, cardiomyopathy, and myocarditis.

[0117] A method for transplant to myocardia using the composition for cell transplant of the present invention is described in the following.

[0118] The method for cell transplant of the present invention includes transplanting the composition for cell transplant of the present invention in a myocardial tissue of a mammal.

[0119] The mammal in the method for cell transplant of the present invention may be any mammal, and examples thereof include human, mouse, rat, pig, and monkey.

[0120] The number of cells to be transplanted in a myocardial tissue in the method for cell transplant of the present invention is preferably 1×10.sup.3 to 1×10.sup.8.

[0121] Less than 1×10.sup.3 cells to be transplanted are too few, which unlikely achieves a sufficient effect of transplanting cells.

[0122] More than 1×10.sup.8 cells to be transplanted are excessive, which tends to result in insufficient improvement in persistence of cells transplanted in a myocardium. Additionally, such an excessive number of cells are uneconomical in terms of cost efficiency.

EXAMPLES

[0123] Hereinafter, the present invention is specifically described with reference to examples and comparative examples, which do not intend to limit the present invention. Unless otherwise specified, % refers to wt % and part(s) refers to part(s) by weight in the following.

Production Example 1

Production of SELP8K

[0124] Plasmid pPT0345 encoding SELP8K was produced in accordance with the method disclosed in an example of JP 4088341 B.

[0125] The plasmid was transformed into E. coli, and whereby a SELP8K producer strain was obtained.

[0126] A broth of the SELP8K producer strain cultured overnight at 30° C. was inoculated in a 50-ml LB medium in a 250-ml flask. Kanamycin was added to the flask such that the final concentration was 50 μg/ml. This broth was cultured at 30° C. while being stirred (200 rpm). When the broth satisfied OD600=0.8 (using absorption spectrometer UV1700 available from Shimadzu Corporation), the broth in an amount of 40 ml was moved to a flask warmed to 42° C. and cultured at the same temperature for about two hours. The culture was cooled with ice and then the OD600 of the broth was determined. E. coli was collected by centrifugation. The collected E. coli was lysed by ultrasonic grinding (4° C., 30 sec×10 times) in order to extract a protein from the collected E. coli.

[0127] The protein produced from E. coli was subjected to sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) and was then transferred onto a polyvinylidene fluoride film. Thereafter, western blot analysis was performed using a rabbit anti-SELP8K antibody as a primary antibody and an anti-rabbit IgG HRP labeled antibody (available from GE Healthcare) as a secondary antibody. The product had an apparent molecular mass of about 80 kDa. This revealed that the SELP8K producer strain produced SELP8K having an apparent molecular mass of 80 kDa and having reactivity with a rabbit anti-SELP8K antibody.

Purification of SELP8K

[0128] The above-obtained SELP8K was purified from E. coli biomass by bacteriolysis, removal of insoluble debris by centrifugation, and affinity chromatography. Thereby, a protein (A-1) (SELP8K) having a molecular mass of about 80 kDa was obtained.

Identification of SELP8K

[0129] The obtained protein (A-1) was identified by the following procedure.

[0130] The protein was analyzed by western blot using a rabbit anti-SELP8K antibody and a rabbit anti-6×His antibody (available from Roland) against a 6×His tag of a C-terminal sequence. A protein band having an apparent molecular mass of 80 kDa showed antibody reactivity with each antibody. The obtained protein was subjected to amino acid analysis, which demonstrated that the product was rich in glycine (43.7%), alanine (12.3%), serine (5.3%), proline (11.7%), and valine (21.2%). The product also contained lysine in an amount of 1.5%. The following Table 1 shows a correlation between the composition of the purified product and the composition by prediction theory from synthesized gene sequences.

[0131] Accordingly, the protein (A-1) was confirmed as a protein having a sequence (15). Specifically, the protein had a structure in which 13 (GVGVP).sub.4GKGVP(GVGVP).sub.3 sequences (6) and 12 (GAGAGS).sub.4 sequences (5) were alternately chemically bonded, and a (GAGAGS).sub.2 sequence (14) was chemically bonded to the structure.

TABLE-US-00001 TABLE 1 Actual Theoretical determination value Composition Composition Amino acid percentage (%) percentage (%) Ala 12.3 12.2 Asx 0.9 0.8 Glx n.d. 0.4 Phe 0.4 0.1 Gly 43.7 41.5 His 0.4 0.8 Ile 0.3 0 Lys 1.5 1.5 Leu 0.3 0.5 Met 0.3 0.3 Pro 11.7 12.4 Arg 0.5 0.6 Ser 5.3 6.1 Thr n.d. 0.1 Val 21.2 22.4 Tyr 1.1 0.1

Production Example 2

[0132] A protein (A-2) having a molecular mass of about 82 kDa and having a sequence (16) was obtained as in Production Example 1, except that “plasmid pPT0364 encoding SELP0K” was used instead of “plasmid pPT0345 encoding SELP8K”.

Production Example 3

[0133] A protein (A-3) having a molecular mass of about 93 kDa and having a sequence (17) was obtained as in Production Example 1, except that “pSY1398-1 encoding SLP4.1” was used instead of “plasmid pPT0345 encoding SELP8K”.

Production Example 4

[0134] A protein (A-4) having a molecular mass of about 220 kDa and having a sequence (18) was obtained as in Production Example 1, except that “plasmid pPT0102-1 encoding ELP1.1” was used instead of “plasmid pPT0345 encoding SELP8K”.

Comparative Production Example 1

[0135] A protein (A′-1) having a molecular mass of about 150 kDa and having a sequence (19) corresponding to an amino acid sequence of SEQ ID NO: 19 was obtained as in Production Example 1, except that “plasmid pPT0102 encoding SLP4.1.3” was used instead of “plasmid pPT0345 encoding SELP8K”.

<Method for Producing Cells for Transplant>

[0136] Human pluripotent stem cells constantly expressing luciferase were produced by inserting luciferase genes to a healthy human pluripotent stem cell strain using PiggyBac transposon vector system (available from System-Biosciences) with CAG promoter. From this cell strain, human pluripotent stem cells were differentiated and induced by a method disclosed in (Funakoshi, S. et al., Sci Rep 8, 19111 (2016)). On the 20th day from the differentiation and induction, cardiac myocytes were separately extracted by flow cytometry, whereby a solution containing cardiac myocytes for transplant was produced.

Example 1

[0137] The protein (A-1) and water were added to the solution containing cardiac myocytes for transplant such that the concentration of the protein (A-1) was 10 wt % and the concentration of the cardiac myocytes for transplant was 5×10.sup.7 pcs/mL, whereby a composition for cell transplant of Example 1 was prepared.

Examples 2 to 4

[0138] Compositions for cell transplant of Examples 2 to 4 were prepared as in Example 1, except that the protein (A-2) to the protein (A-4) were used instead of the protein (A-1).

Comparative Example 1

[0139] Water was added to the solution containing cardiac myocytes for transplant such that the concentration of the cardiac myocytes for transplant was 5×10.sup.7 pcs/mL, whereby a composition for cell transplant of Comparative Example 1 was prepared.

Comparative Example 2

[0140] A composition for cell transplant of Comparative Example 2 was prepared as in Example 1, except that the protein (A′-1) was used instead of the protein (A-1).

<Transplant of Cardiac Myocytes to Mouse>

[0141] The composition for cell transplant of each of the examples and comparative examples in an amount of 20 μL (the number of cells 1×10.sup.6) was injected with a syringe into a myocardial tissue of model mice having myocardial infarction. After one hour from the injection, luciferin was intraperitoneally administered to each mouse with a syringe, and the emission intensity of luciferase in the myocardial tissue of the mouse was detected using in vivo imaging system (IVIS).

<Evaluation for Persistence of Cardiac Myocytes after Cell Transplant (0th Day from Cell Transplant)>

[0142] The persistence of the cardiac myocytes on the 0th day from cell transplant was calculated according to the following formula using the detected emission intensity. The results are shown in Table 2.


(Persistence of cardiac myocytes on the 0th day from cell transplant)=(emission intensity of luciferase)/(emission intensity of luciferase in Comparative Example 1)

[0143] The “persistence of cardiac myocytes on 0th day from cell transplant (relative value)” in Table 2 shows relative ratios to the “luciferase emission intensity on 0th day from cell transplant” of a mouse injected with the composition for cell transplant of Comparative Example 1 defined as 1.0.

<Evaluation for Proliferation of Cardiac Myocytes after Cell Transplant (0th Day to 84th Day from Transplant)>

[0144] The mouse injected with the composition for cell transplant of each of the examples and comparative examples was raised, and luciferin was intraperitoneally administered with a syringe on the 3rd, 5th, 7th, 14th, 28th, 56th, and 84th days. The emission intensity of luciferase in the myocardial tissue of the mouse was detected using in vivo imaging system (IVIS).

[0145] The proliferation of cardiac myocytes after cell transplant was calculated according to the following formula using the detected emission intensity. The results are shown in Table 3.


(Proliferation of cardiac myocytes after cell transplant)=(emission intensity of luciferase)/(emission intensity of luciferase on 0th day from cell transplant)

[0146] The “proliferation of cardiac myocytes after cell transplant (relative value)” in Table 3 shows relative ratios to the “luciferase emission intensity on 0th day from cell transplant” of the mouse injected with the composition for cell transplant of the corresponding example or comparative example defined as 1.0.

TABLE-US-00002 TABLE 2 Persistence of cardiac myocytes on 0th day Degree of Concentration from cell transplant (relative value) hydrophobicity of protein [relative ratio to Comparative Example 1 Type of protein (A) of protein (A) (A) (wt %) defined as 1.0] Example 1 Production A-1 SELP8K 0.62 10 10.2 Example 1 Example 2 Production A-2 SELP0K 0.72 10 9.8 Example 2 Example 3 Production A-3 SLP4.1 0.47 10 9.5 Example 3 Example 4 Production A-4 ELP1.1 1.12 10 8.9 Example 4 Comparative — — — — 0 1.0 Example 1 Comparative Comparative A′-1 SLP4.1.3 0.17 10 1.5 Example 2 Production Example 1

TABLE-US-00003 TABLE 3 Proliferative property of cardiac myocytes after cell transplant (relative value) [relative ratio to emission intensity of luciferase Degree of Concentration on 0th day from cell transplant defined as 1.0] hydrophobicity of protein (A) 0th 3rd 5th 7th 14th 28th 56th 84th Type of protein (A) of protein (A) (wt %) day day day day day day day day Example 1 Production A-1 SELP8K 0.62 10 1.0 0.8 1.5 2.0 2.6 4.9 5.7 8.1 Example 1 Example 2 Production A-2 SELP0K 0.72 10 1.0 0.8 1.4 1.8 2.5 4.7 5.2 7.8 Example 2 Example 3 Production A-3 SLP4.1 0.47 10 1.0 0.7 1.3 1.7 2.3 4.5 5.0 6.0 Example 3 Example 4 Production A-4 ELP1.1 1.12 10 1.0 0.7 1.3 1.7 2.3 4.4 4.9 5.5 Example 4 Comparative — — — — 0 1.0 0.6 0.9 1.0 1.8 2.6 3.0 3.9 Example 1 Comparative Comparative A′-1 SLP4.1.3 0.17 10 1.0 0.7 0.9 1.0 1.9 2.5 3.1 4.1 Example 2 Production Example 1

[0147] Table 2 demonstrates that the persistence of cardiac myocytes after cell transplant was evaluated as significantly better in use of the compositions for cell transplant of Examples 1 to 4 than in use of the compositions for cell transplant of Comparative Examples 1 and 2.

[0148] In addition, Table 3 demonstrates that the proliferation of cardiac myocytes after cell transplant was evaluated as better in use of the compositions for cell transplant of Examples 1 to 4 than in use of the compositions for cell transplant of Comparative Examples 1 and 2.

[0149] Accordingly, use of the composition for cell transplant of the present invention enables a myocardial tissue to retain cardiac myocytes and improves the proliferation of cells.

INDUSTRIAL APPLICABILITY

[0150] The composition for cell transplant and the method for cell transplant of the present invention enable a myocardial tissue to favorably retain cardiac myocytes or the like and can improve the persistence and proliferation of transplanted cells. Accordingly, the composition for cell transplant and the method for cell transplant of the present invention are effectively applicable to diseases characterized by insufficient cardiac functions, such as myocardial infarction.