VACCINES FORMED BY VIRUS AND ANTIGEN CONJUGATION

20210236624 · 2021-08-05

Assignee

Inventors

Cpc classification

International classification

Abstract

Disclosed herein are methods of forming compounds and exemplary stable compounds in the nature of a conjugated compound at refrigerated or room temperature, which in some embodiments comprises an antigen and virus particle mixed in a conjugation reaction to form a conjugate mixture, such that the conditions and steps of forming these products allow for use of the conjugate mixture as a vaccine, including but not limited to use as a vaccine against various pathogens including for treatment of diseases caused by novel coronaviruses (including SARS-COV 2).

Claims

1. A multivalent vaccine, comprising: a first antigen comprising an influenza hemagglutinin antigen (HA); a second antigen; and a carrier comprising a virus particle having surface lysine residues; wherein the first antigen and the second antigen chemically associate with the surface lysine residues.

2. The multivalent vaccine of claim 1, wherein the second antigen is an influenza HA other than the first antigen.

3. The multivalent vaccine of claim 1, wherein the vaccine comprises two or more type A hemagglutinin antigens (HAs) and two or more type B HAs.

4. The multivalent vaccine of claim 1, wherein the second antigen comprises a receptor binding domain of a coronavirus.

5. The multivalent vaccine of claim 4, wherein the coronavirus is chosen from the group consisting of SARS-CoV-1 and SARS-CoV-2.

6. The multivalent vaccine of claim 5, wherein the vaccine comprises two or more type A hemagglutinin antigens (HAs) and two or more type B HAs.

7. The multivalent vaccine of claim 1, wherein the virus particle is a virus.

8. The multivalent vaccine of claim 7, wherein the virus is a tobacco mosaic virus.

9. The multivalent vaccine of claim 1, wherein when the vaccine is placed in an unrefrigerated environment at a storage temperature for a time period, an integrity or a concentration of the vaccine at the end of the time period is at least 90% of an initial integrity or an initial concentration of the vaccine, wherein the time period is at least 42 days after a release date of the vaccine.

10. The multivalent vaccine of claim 9, wherein the storage temperature is at least 20° C.

11. A virus-antigen conjugate, comprising a virus and at least one antigen, wherein the at least one antigen comprises a fusion peptide having a first peptide which comprises a receptor binding domain of a pathogen, and a second peptide wherein the fusion peptide is conjugable with the virus.

12. The conjugate of claim 11, wherein the conjugate is multivalent, and further comprises at least one influenza hemagglutinin antigen (HA) chosen from the group consisting of type A HA and type B HA.

13. The conjugate of claim 12, wherein the second peptide is a fragment crystallizable (Fc) region of an antibody capable of binding to a Fc receptor and the Fc region is an Fc domain of an IgG1 antibody.

14. The conjugate of claim 13, further comprising a hinge portion linking the first peptide and the second peptide, wherein the hinge portion contains an amino acid sequence as set forth in SEQ ID NO: 3.

15. The conjugate of claim 14, wherein the pathogen is a coronavirus having said receptor binding domain.

16. The conjugate of claim 15, wherein the first peptide contains an amino acid sequence as set forth in SEQ ID NO: 2.

17. The conjugate of claim 15, wherein the first peptide contains an amino acid sequence as set forth in SEQ ID NO: 8.

18. The conjugate of claim 11, wherein the virus is a tobacco mosaic virus.

19. The conjugate of claim 18, wherein the tobacco mosaic virus comprises a N-terminal lysine residue.

20. An antigen, comprising: a fusion peptide having a first peptide which comprises a receptor binding domain of a coronavirus, and a second peptide wherein the fusion peptide is conjugable with a virus particle, wherein the second peptide is a fragment crystallizable (Fc) region of an antibody capable of binding to a Fc receptor.

21. The antigen of claim 20, wherein when the antigen is placed in an unrefrigerated environment at a storage temperature for a time period, an integrity or a concentration of the antigen at the end of the time period is at least 90% of an initial integrity or an initial concentration of the antigen, wherein the time period is at least 42 days after a release date of the conjugate.

22. The antigen of claim 21, wherein the storage temperature is at least 20° C.

23. The antigen of claim 22, wherein the first peptide contains an amino acid sequence as set forth in SEQ ID NO: 2.

24. The antigen of claim 22, wherein the first peptide contains an amino acid sequence as set forth in SEQ ID NO: 8.

Description

BRIEF DESCRIPTION OF THE FIGURES

[0038] The patent or application file with respect to the present disclosure contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee.

[0039] The drawings and embodiments described herein are illustrative of multiple alternative structures, aspects, and features of the multiple embodiments and alternatives disclosed herein, and they are not to be understood as limiting the scope of any of these embodiments and alternatives. It will be further understood that the drawing figures described and provided herein are not to scale, and that the embodiments are not limited to the precise arrangements, depictions, and instrumentalities shown.

[0040] FIG. 1 is a flow chart showing the steps in a certain virus purification platform within the scope of the present disclosure, according to multiple embodiments and alternatives.

[0041] FIG. 2 is purified icosahedral red clover mosaic virus, according to multiple embodiments and alternatives.

[0042] FIG. 3 is a western blot analysis of the purification of the icosahedral red clover mosaic virus, according to multiple embodiments and alternatives.

[0043] FIG. 4 is purified icosahedral red clover mosaic virus, according to multiple embodiments and alternatives.

[0044] FIG. 5 is a western blot analysis of the purification of the icosahedral red clover mosaic virus, according to multiple embodiments and alternatives.

[0045] FIG. 6 is purified rod-shaped tobacco mosaic virus, according to multiple embodiments and alternatives.

[0046] FIG. 7 is a western blot analysis of the purification of the rod-shaped tobacco mosaic virus, according to multiple embodiments and alternatives.

[0047] FIG. 8 is a flow chart showing the steps of an antigen manufacturing platform, according to multiple embodiments and alternatives.

[0048] FIG. 9 is a western blot analysis of some of the steps of an antigen manufacturing platform, according to multiple embodiments and alternatives.

[0049] FIG. 10 is a western blot analysis of some of the steps of an antigen manufacturing platform, according to multiple embodiments and alternatives.

[0050] FIG. 11 is a western blot analysis of some of the steps of an antigen manufacturing platform, according to multiple embodiments and alternatives.

[0051] FIG. 12 is a western blot analysis of the purification of various antigens through the antigen manufacturing platform, according to multiple embodiments and alternatives.

[0052] FIG. 13 is an illustration of the conjugation of recombinant antigen to a virus, according to multiple embodiments and alternatives.

[0053] FIG. 14 is a SDS-PAGE analysis of the conjugation of an antigen to a virus, according to multiple embodiments and alternatives.

[0054] FIG. 15 is a SDS-PAGE analysis of the conjugation of an antigen to a virus, according to multiple embodiments and alternatives.

[0055] FIG. 16 is a SDS-PAGE analysis of the conjugation of an antigen to a virus, according to multiple embodiments and alternatives.

[0056] FIG. 17 is a report of size exclusion-high-performance liquid chromatography (SEC-HPLC) of a free TMV product, according to multiple embodiments and alternatives.

[0057] FIG. 18 is a report of SEC-HPLC of conjugation between a virus and an antigen for fifteen minutes, according to multiple embodiments and alternatives.

[0058] FIG. 19 is a report of SEC-HPLC of conjugation between a virus and an antigen two hours, according to multiple embodiments and alternatives.

[0059] FIG. 20 is a western blot analysis of conjugation between a virus and an antigen, according to multiple embodiments and alternatives.

[0060] FIG. 21 is a graph illustrating the infectivity of viruses treated with various levels of UV irradiation, according to multiple embodiments and alternatives.

[0061] FIG. 22 is an illustration of some of the steps of the conjugation platform of recombinant antigen to a virus, according to multiple embodiments and alternatives.

[0062] FIG. 23 is a SDS-PAGE analysis of the conjugation of an antigen to a virus, according to multiple embodiments and alternatives.

[0063] FIG. 24 is a negative stain transmission electron microscopy (TEM) image of recombinant antigen, according to multiple embodiments and alternatives.

[0064] FIG. 25 is a negative stain TEM image of a virus, according to multiple embodiments and alternatives.

[0065] FIG. 26 is a negative stain TEM image of a recombinant antigen conjugated to another recombinant antigen with added virus, according to multiple embodiments and alternatives.

[0066] FIG. 27 is a negative stain TEM image of recombinant antigen conjugated to a virus at a virus to recombinant antigen ratio of 1:1, according to multiple embodiments and alternatives.

[0067] FIG. 28 is a negative stain TEM image of recombinant antigen conjugated to a virus at a virus to recombinant antigen ratio of 1:1, according to multiple embodiments and alternatives.

[0068] FIG. 29 is a negative stain TEM image of recombinant antigen conjugated to a virus at a virus to recombinant antigen ratio of 4:1, according to multiple embodiments and alternatives.

[0069] FIG. 30 is a negative stain TEM image of recombinant antigen conjugated to a virus at a virus to recombinant antigen ratio of 16:1, according to multiple embodiments and alternatives.

[0070] FIG. 31 is a normalized sedimentation coefficient distribution of an antigen, according to multiple embodiments and alternatives.

[0071] FIG. 32 is a normalized sedimentation coefficient distribution of a virus, according to multiple embodiments and alternatives.

[0072] FIG. 33 is a normalized sedimentation coefficient distribution of recombinant antigen conjugated to a virus at a virus to recombinant antigen ratio of 1:1, according to multiple embodiments and alternatives.

[0073] FIG. 34 is a normalized sedimentation coefficient distribution of recombinant antigen conjugated to a virus at a virus to recombinant antigen ratio of 1:1, according to multiple embodiments and alternatives.

[0074] FIG. 35 is a normalized sedimentation coefficient distribution of recombinant antigen conjugated to a virus at a virus to recombinant antigen ratio of 1:1, according to multiple embodiments and alternatives.

[0075] FIG. 36 is a normalized sedimentation coefficient distribution of recombinant antigen conjugated to a virus at a virus to recombinant antigen ratio of 4:1, according to multiple embodiments and alternatives.

[0076] FIG. 37 is a normalized sedimentation coefficient distribution of recombinant antigen conjugated to a virus at a virus to recombinant antigen ratio of 16:1, according to multiple embodiments and alternatives.

[0077] FIG. 38 is a scatterplot of antigen-relevant titers in a source organism following administration of virus-antigen products at various virus to recombinant ratios, according to multiple embodiments and alternatives.

[0078] FIG. 39 is a geometric mean testing illustrating the antigen-relevant titers in a source organism following administration of virus-antigen products at various virus to recombinant ratios, according to multiple embodiments and alternatives.

[0079] FIG. 40 is a SDS-PAGE analysis of a purified recombinant antigen, according to multiple embodiments and alternatives.

[0080] FIGS. 41(A)-(B) provide graphs of stability data at two different temperature ranges for QIV conjugates.

[0081] FIG. 42 is a graph of the immunogenicity of a quadrivalent vaccine in mice, according to multiple embodiments and alternatives.

[0082] FIG. 43 is an illustration of an immunogenicity and challenge study of a quadrivalent vaccine in ferrets, according to multiple embodiments and alternatives.

[0083] FIG. 44 is an illustration of the nasal wash virus titers following virus challenge in ferrets, according to multiple embodiments and alternatives.

[0084] FIG. 45 is an illustration of the nasal wash virus titers following virus challenge in ferrets, according to multiple embodiments and alternatives.

[0085] FIG. 46 is an illustration of the immunogenicity of a monovalent vaccine produced in mice at various virus to recombinant antigen ratios, according to multiple embodiments and alternatives.

[0086] FIG. 47 is an illustration of TMV vRNA in tissues over time following an injection of a quadrivalent vaccine, according to multiple embodiments and alternatives.

[0087] FIG. 48 is an illustration of TMV vRNA in tissues eight days following an injection of a quadrivalent vaccine, according to multiple embodiments and alternatives.

[0088] FIG. 49 is an illustration of total anti-influenza titers based on an ELISA analysis from rabbit serum samples following injections of a quadrivalent vaccine, according to multiple embodiments and alternatives.

[0089] FIG. 50 is an illustration of neutralization titers measured in rabbits following injections of a quadrivalent vaccine, according to multiple embodiments and alternatives.

[0090] FIG. 51 (A) is an illustration of the protein structure of the Covid-19 Spike timer in space-filling model with the receptor binding domain circled in lateral and vertical views. FIG. 51(B) is an illustration of the fusion of the Covid-19 receptor binding domain to a human Fc domain, according to multiple embodiments and alternatives.

[0091] FIG. 52 is an illustration of an expression plasmid containing the construct of a recombinant Covid-19 antigen, according to multiple embodiments and alternatives.

[0092] FIG. 53 is a SDS-PAGE analysis of a purified recombinant Covid-19 antigen, according to multiple embodiments and alternatives.

[0093] FIG. 54 is a report of SEC-HPLC of a purified recombinant Covid-19 antigen, according to multiple embodiments and alternatives.

[0094] FIG. 55 is a SDS-PAGE analysis of a purified recombinant Covid-19 antigen, according to multiple embodiments and alternatives.

[0095] FIG. 56 is an illustration of some of the steps of the conjugation platform of recombinant Covid-19 antigen to a virus and drug substance filling, according to multiple embodiments and alternatives.

[0096] FIG. 57 is a normalized sedimentation coefficient distribution of a recombinant Covid-19 antigen conjugated to a virus, according to multiple embodiments and alternatives.

[0097] FIG. 58 is a normalized sedimentation coefficient distribution of a recombinant Covid-19 antigen conjugated to a virus, according to multiple embodiments and alternatives.

[0098] FIG. 59 is a SDS-PAGE analysis of a recombinant Covid-19 antigen conjugated to a virus, according to multiple embodiments and alternatives.

[0099] FIG. 60(A) is an ELISA standard curve illustrating the binding of the recombinant Covid-19 antigen to a Covid-19 human neutralizing monoclonal antibody. FIG. 60(B) is a graph illustrating the binding of various vaccine alternatives in accordance with multiple embodiments and alternatives described herein (sometimes referred to herein as vaccine candidates), and the binding to a Covid-19 human neutralizing monoclonal antibody, according to multiple embodiments and alternatives.

[0100] FIG. 61 consists of confocal microscopy images illustrating the co-localization of the recombinant Covid-19 antigen to ACE-2 specific antibodies, according to multiple embodiments and alternatives.

[0101] FIG. 62(A) is a graph illustrating the co-localization of a native agonist and a recombinant Covid-19 antigen to ACE-2 specific antibodies, according to multiple embodiments and alternatives. FIG. 62(B) is a graph illustrating the co-localization of a native agonist and a recombinant Covid-19 antigen to ACE-2 specific antibodies in the presence of a co-localization control, according to multiple embodiments and alternatives.

[0102] FIGS. 63(A)-(D) are graphs showing results of pooled serum samples undergoing a plaque neutralization assay at preimmune, day 12, day 28, and day 42 following first administration (followed by boost at day 14) of exemplary vaccines at increasing dilution levels and containing varying concentrations of RBD-Fc antigen, with and without adjuvant.

[0103] FIGS. 64(A)-(B) provide graphs that further examine neutralization titers produced for 15 and 45 μg groups but without adjuvant at day 28 and day 42 in accordance with the same dilutions.

[0104] FIG. 65(A) is a graph illustrating the immune response in animals immunized with a recombinant Covid-19 antigen and a control. FIG. 65(B) is a graph illustrating the immune response in animals immunized with a recombinant Covid-19 antigen conjugated to a virus (unadjuvanted). FIG. 65(C) illustrates the immune response in animals immunized with an adjuvanted Covid-19 antigen conjugated to a virus. FIG. 65(D) compares the IgG titers recognizing the Covid-19 antigen (in black) and RBD-His (in gray).

[0105] FIGS. 66(A)-63(C) are graphs illustrating an IgG isotype analysis for individual sera taken from animals immunized with a recombinant Covid-19 antigen conjugated to a virus, controls, and adjuvant, according to multiple embodiments and alternatives. FIG. 66(A) illustrates the Th1 response (IgG2a and IgG2c) associated with the analysis, FIG. 66(B) illustrates the Th2 response (IgG1) associated with the analysis, and FIG. 66(C) is a stack plot comparison of relative IgG2 versus IgG1 antibody response by an ELISA analysis.

[0106] FIG. 67 is a graph illustrating the cell viability after incubation with SARS2 virus with murine sera, according to multiple embodiments and alternatives.

[0107] FIG. 68 is a graph illustrating the immune response titers in animals immunized with a recombinant Covid-19 antigen conjugated to a virus, controls, and historical comparisons, according to multiple embodiments and alternatives.

[0108] FIG. 69 graphs virus neutralization titers following vaccination of mice with exemplary vaccines of varying concentrations.

[0109] FIG. 70(A) is a graph illustrating an IFNγ ELISpot analysis for animals immunized with a virus and a recombinant Covid-19 antigen. FIG. 70(B) is a graph illustrating an IFNγ ELISpot analysis for animals immunized with an unadjuvanted TMV:RBD-Fc vaccine. FIG. 70(C) is a graph illustrating an IFNγ ELISpot analysis for animals immunized with a TMV:RBD-Fc vaccine and an adjuvant.

[0110] FIGS. 71(A)-(C) provide graphs of survival rates, FIG. 71(A); clinical presentation, FIG. 71(B); and post-challenge weight, FIG. 71(C), for test subjects following infection, based on administration of RBD-Fc vaccines at various concentrations compared to control groups.

[0111] FIG. 72 is a graph illustrating a VaxArray® analysis of murine sera from mice immunized with various TMV:RBD-Fc vaccine dosages, and both with and without adjuvant, according to multiple embodiments and alternatives.

[0112] FIGS. 73(A)-(B) provide graphs of experimental results through analysis of specificity and relative titer of sera from animal studies by VaxArray®, comparing different capture antigens.

[0113] FIG. 74 is a graph of titers measured by VaxArray® in day 42 sera from individual animals compared with individual and pooled neutralization titers.

[0114] FIG. 75(A) is a graph showing results on the viability of macrophages exposed to nucleocapsid and spike proteins of SARS-2 with non-inventive antibodies added, as an indicator of antibody enhancement of disease. FIG. 75(B) is a graph of mouse sera containing antibodies, which were generated from TMV:RBD-Fc vaccines according to multiple embodiments and alternatives, following exposure to nucleocapsid and spike proteins of SARS-CoV2. FIG. 75(C) shows statistical differences applicable to the graphs in FIGS. 75(A-B).

[0115] FIG. 76 is a SDS-PAGE analysis of a purified recombinant Covid-19 antigen, according to multiple embodiments and alternatives.

[0116] FIG. 77 is a report of SEC-HPLC of a purified recombinant Covid-19 antigen, according to multiple embodiments and alternatives.

[0117] FIG. 78 illustrates the receptor binding domain of the spike protein sequence alignment of SARS-2 and other related coronaviruses.

[0118] FIGS. 79(A)-(B) provide graphs of data on challenge studies in mice and ferrets, respectively, in which the subjects were administered an exemplary vaccine at different ratios, with and without adjuvant.

[0119] FIG. 80 provides a graph of vaccine tolerability based on change in weight over time following administration of exemplary vaccines without infection.

[0120] FIGS. 81(A)-(B) provide graphs of data on challenge studies in rabbits for weight gain and survival, respectively, in which the subjects were administered an exemplary vaccine at different ratios, with and without adjuvant.

MULTIPLE EMBODIMENTS AND ALTERNATIVES

[0121] A multi-set process according to multiple embodiments and alternatives herein improves upstream purification processes, further enriching plant viruses, and facilitates the conjugation of virus and antigen to form a vaccine. Steps for producing and purifying a virus in accordance with multiple embodiments and alternatives are listed and discussed in connection with Table 1 and FIG. 1. Likewise, steps for producing and purifying an antigen are listed and discussed in connection with Table 2. Although the various platforms have a specific embodiment described for them below, the scope of the embodiments contained herein are not limited to any one specific embodiment.

Virus Production and Purification

[0122] Table 1 and FIG. 1 illustrate the steps of the virus purification platform according to multiple embodiments and alternatives.

TABLE-US-00001 TABLE 1 Production and Purification of Virus Operative In-Process Steps Unit Operations In-Process Controls Analytics 1 Plant Growth Irrigation, Light Plant Height, (25 DPS) Cycle, Fertilizer, structure and Nb Media, Humidity, leaf quality Temperature 2 Infection with Inoculum N/A virus Concentration, Rate of Application 3 Viral Replication Irrigation, Light N/A (7 DPI) Plant Cycle, Humidity, Growth Temperature 4 Harvest of Aerial Visual Inspection of N/A Tissue Plants 5 Disintegration of Blade Type and pH, Conductivity, Plant Cells RPM, Screen Sizes, SDSPage, (Extraction) Buffer:Tissue Ratio Endotoxin, Nicotine 6 Clarification of Ceramic Size, TMP, pH, Conductivity, Plant Extract kg/m.sup.2 SDSPage, Endotoxin, Nicotine 7 Concentration of Pore Size, TMP, pH, Conductivity, Clarified Plant Pore Material, kg/m.sup.2 SDSPage, Extract Endotoxin, Nicotine 8 Ion-Exchange kg/L, Bed Height, pH, Conductivity, Chromatography Residence Time SDSPage, Endotoxin, Nicotine 9 Multi-Modal kg/L, Bed Height, pH, Conductivity, Chromatography Residence Time SDSPage, Endotoxin, Nicotine 10 Concentration of Pore Size, TMP, UV260, TEM, Purified Virus Pore Material, kg/m.sup.2 DLS, SDSPage, Endotoxin, Nicotine, Amino Acid

[0123] This purification platform is designed for commercial scalability and compliance with the cGMP regulations and utilizes one buffer throughout the entire purification process. According to multiple embodiments and alternatives, the steps of the virus purification platform are given in connection with plant expression. However, steps after the aerial tissue harvesting and cell rupture as described below also would apply to non-plant viruses (except where context is clearly related to plants, e.g., reference to removal of plant fiber).

[0124] In accordance with multiple embodiments and alternatives described herein, virus expression is accomplished through methods that are appropriate for a particular host. In some embodiments, virus-based delivery of genes to a plant host is accomplished with a modified TMV expression vector that causes tobacco plants to recombinantly form the virus. One such available alternative is the GENEWARE® platform described in U.S. Pat. No. 7,939,318, “Flexible vaccine assembly and vaccine delivery platform.” This transient plant-based expression platform described in this patent employs the plant virus TMV to harness plant protein production machinery, which expresses a variety of viruses in a short amount of harvest time post inoculation (e.g., less than 21 days). Tobacco plants inoculated with the virus genes express the particular virus in infected cells, and the viruses are extracted at harvest. Inoculation occurs by, as examples to be selected by a user of the methods herein described, hand inoculation of a surface of a leaf, mechanical inoculation of a plant bed, a high-pressure spray of a leaf, or vacuum infiltration.

[0125] Besides Nicotiana benthamiana, other plant and non-plant hosts are contemplated by this disclosure, including those mentioned in the Summary. Besides the GENEWARE® platform, other strategies can be employed to deliver genes to plant (Lemna gibba or Lemna minor as non-limiting examples) and non-plant organisms (algae as a non-limiting example). These other strategies include Agro-infiltration, which introduces the viral gene via an Agrobacterium bacterial vector to many cells throughout the transfected plant. Another is electroporation to open pores in the cell membranes of the host to introduce the genes that recombinantly produce the viruses and antigens such as but not limited to those described in Examples 1 and 3 below. Another is TMV RNA-based overexpression (TRBO) vector, which utilizes a 35S promotor-driven TMV replicon that lacks the TMV coat protein gene sequence, as described in John Lindbo, “TRBO: A High-Efficiency Tobacco Mosaic Virus RNA-Based Overexpression Vector,” Plant Physiol. Vol. 145, 2007.

[0126] In some embodiments, growth of Nicotiana benthamiana wild type plants occurs in a controlled growth room. Plant growth is controlled via irrigation, light, and fertilized cycles. Plants are grown in a soilless media and temperature is controlled throughout the process.

[0127] After an appropriate number of days post sow (DPS), for example 23-25 DPS, the plants are infected with the virus replication. After infection, the plants are irrigated with water only and controlled via light cycle and temperature for a certain number of days post infection (DPI) depending on the type of virus.

[0128] Plants are inspected for height, infection symptoms, and the aerial tissue is harvested.

[0129] Virus recovery/cell rupture involves a disintegrator configured with an optimized blade/screen size followed by removal of residual cellulosic plant fiber from aqueous liquid (such as through a screw press, as one example).

[0130] An appropriate extraction buffer (e.g., 200 mM Sodium Acetate, pH 5.0; step 201 of FIG. 1 as a non-limiting example) is added to the resulting extract at a 1:1 buffer:tissue ratio. Removal of chlorophyll and large cellular debris at pilot scale involves the use of tangential flow (TFF) ceramic filtration (1.4 micron/5.0 micron). In some embodiments, an additional 0.1-micron ceramic tangential flow filtration step is employed. Transmembrane pressure, ceramic pore size and biomass loaded per square meter of membrane surface are all controlled to ensure passage of the virus through the ceramic. In some embodiments, the feed pressure, retentate pressure, and permeate pressure are set and controlled to produce a resulting transmembrane pressure in a range of about 1.5-2 Bar TMP. Optionally, ceramic tangential flow filtration is followed by dead-end filtration, e.g., using 1.2 micron glass fiber filtration.

[0131] Ceramic permeate is further clarified via the use of glass fiber depth filtration (step 203 of FIG. 1 as a non-limiting example).

[0132] Clarified extract is concentrated with a TFF system (available from Sartorius AG). Cassette pore size (100-300 kDa), an appropriate TMP as described herein, and load of clarified extract per square meter of membrane surface area are controlled.

[0133] The clarified extract is concentrated to NMT 2× the ion-exchange column volume and washed 7× with ion-exchange chromatography equilibration buffer (200 mM Sodium Acetate, pH 5.0, step 204 of FIG. 1 provides a non-limiting example). The Capto Q ion-exchange column is equilibrated for five column volumes with 200 mM Sodium Acetate, pH 5.0 (step 205 of FIG. 1 provides a non-limiting example), and the feed is loaded and collected in the flow-through fraction. The column is washed to baseline and host cell contaminants are stripped from the column with high salt.

[0134] The flow through and wash fractions are collected, combined and prepared for multi-modal Capto® Core 700 chromatography. The multi-modal chromatography column is equilibrated with five column volumes of equilibration buffer (200 mM Sodium Acetate, pH 5.0; step 206 of FIG. 1 provides a non-limiting example).

[0135] The combined flow-through and wash fractions from Capto Q ion-exchange chromatography are loaded onto the column and the virus collected in the void volume of the column. The column is washed to baseline and stripped with high conductivity sodium hydroxide. Loading ratio, column bed height, residence time and chromatography buffers are all controlled. Formulation and concentration of virus (step 208, FIG. 2) takes place in some embodiments with a TFF System (such as the Sartorius AG system). Pore size (30-300 kDa), an appropriate TMP as described herein, load per square meter of membrane surface area and pore material are all controlled. Virus is concentrated to an appropriate concentration, such as 10 mg/ml, and in some embodiments is diafiltered with an appropriate buffer, such as Sodium Phosphate. Formulated virus is sterilized and stored appropriately. In some embodiments, sterilization is provided via a PES filter.

[0136] All examples provided herein are meant as illustrative of various aspects of multiple embodiments and alternatives of any or all of virus production, virus purification, antigen production, antigen purification, and virus-antigen conjugation. These examples are non-limiting and merely characteristic of multiple alternative embodiments herein.

Example 1—Purification of Icosahedral Red Clover Mosaic Virus

[0137] The Western Blot, provided in FIG. 3 as a known technique for detecting various proteins in a mixture, shows successful purification of the icosahedral red clover mosaic virus illustrated in FIG. 2. Similarly, the Western Blot in FIG. 5 shows successful purification of the icosahedral red clover mosaic virus illustrated in FIG. 4. Both viruses were purified according to the embodiments described herein. In accordance with the known detection technique, target proteins were extracted from the tissue. Then proteins of the sample were separated using gel electrophoreses based on their isoelectric point, molecular weight, electrical charge, or various combinations of these factors. Samples were then loaded into various lanes in the gel, with a lane reserved for a “ladder” containing a mixture of known proteins with defined molecular weights. For example, in FIG. 3, lane 12 serves as the ladder. A voltage was then applied to the gel, causing the various proteins to migrate through the gel at different speeds based on the aforementioned factors. The separation of the different proteins into visible bands within each lane occurred as provided in FIGS. 3 and 5, respectively. With the Western Blot, a purer product is characterized by a clear and visible band, and such is characterized in these figures.

[0138] FIGS. 3 and 5 illustrate the virus purification platform successfully purifying the icosahedral red clover mosaic virus. Each lane of the western blot shows the purity of the virus after the conclusion of a different step in the virus purification platform. In FIG. 3, the lanes include: lane 1—green juice, lane 2—TFF Ceramic Clarification Retentate, lane 3—TFF Ceramic Clarification Permeate, lane 4—TFF Cassette Retentate, lane 5—TFF Cassette Permeate, lane 6—Ion Exchange, lane 7—Ion Exchange, lane 8—multimodal, lane 9—multimodal, lane 10—30 K TFF Permeate, lane 11—30 K Retentate, lane 12—marker. In FIG. 5. the lanes of the western blot include the following: lane 1—Green Juice, lane 3—TFF Ceramic Clarification Retentate, lane 5—TFF Ceramic Clarification Permeate, lane 7—TFF Cassette Retentate, lane 9—TFF Cassette Permeate, lane 11—Ion Exchange, lane 13—Multimodal, and Lane 14—Marker.

[0139] Once the final step has occurred in the virus purification platform, the resulting viral product is highly purified, as shown by the visible band in lane 11 of FIG. 3 and lane 13 of FIG. 5.

Example 2—Purification of Rod-Shaped TMV

[0140] FIG. 6 shows a purified rod-shaped TMV, and FIG. 7 illustrates a virus purification platform used in achieving this purified TMV, within the scope of multiple embodiments and alternatives disclosed herein. Similar to FIGS. 3 and 5, FIG. 7 illustrates the purity of the virus product after the conclusion of the various steps of the current virus purification platform. After the final purification step, the resulting product is highly purified virus product consistent with a clear and visible band in lane 13 of FIG. 7. The identity of such an exemplary, pre-conjugation, TMV-NtK intermediate can be confirmed by mass spectrometry, e.g. MALDI-TOF mass spectrometry. In some embodiments, physicochemical properties of the TMV-NtK intermediate include a pH between about 7.0-7.4, an osmolality between about 15-45 mOsm/kg H.sub.2O, a bioburden no greater than 100 CFU (colony forming units)/mL, and residual host cell proteins less than 100 ng/mg.

[0141] Accordingly, an inventive virus purification platform has successfully purified every virus on which the inventors have applied these methods, including both an icosahedral virus and a rod-shaped virus, and this platform is expected to be reproducible and consistently purify on a commercial scale virtually any type (if not all types) of virus.

Production and Purification of Recombinant Antigen

[0142] Table 2 and FIG. 8 illustrate the steps of the antigen purification platform according to multiple embodiments and alternatives.

TABLE-US-00002 TABLE 2 Production and Purification of Recombinant Antigen Operative In-Process Steps Unit Operations In-Process Controls Analytics 1 Plant Growth Irrigation, Light Cycle, Plant height, (25 DPS) Nb Fertilizer, Media, structure and Humidity, Temperature leaf quality 2 GENEWARE Inoculum Infection with Concentration, Rate of Target Antigen Application 3 Replication Irrigation, Light Cycle, (7-14 DPI) Plant Humidity, Temperature Growth 4 Harvest of Aerial Visual Inspection of Tissue Plants 5 Disintegration of Blade Type and RPM, pH, Plant Cells Screen Sizes, Conductivity, (Extraction) Buffer:Tissue Ratio SDSPage, Endotoxin, Nicotine 6 Clarification of Filter Press Pore Size, pH, Plant Extract Feed Pressure, kg/m2 Conductivity, SDSPage, Endotoxin, Nicotine 7 Concentration of Pore Size, TMP, Pore pH, Clarified Plant Material, kg/m.sup.2 Conductivity, Extract SDSPage, Endotoxin, Nicotine 8 Capto Q kg/L, Bed Height, pH, Chromatography Residence Time Conductivity, SDSPage, Endotoxin, Nicotine 9 ColMAC or kg/L, Bed Height, pH, ConA Residence Time Conductivity, SDSPage, Endotoxin, Nicotine 10 Ceramic kg/L, Bed Height, pH, Hydroxyapatite Residence Time Conductivity, SDSPage, Endotoxin, Nicotine 11 Concentration/ Pore Size, TMP, Pore UV260, TEM, Formulation of Material, kg/m.sup.2 DLS, Purified Antigen SDSPage, Endotoxin, Nicotine, Amino Acid

[0143] This purification platform is designed for commercial scalability and compliance with the cGMP regulations and utilizes one buffer throughout the entire purification process. According to multiple embodiments and alternatives, the steps of the antigen purification platform are as follows:

[0144] Growth of Nicotiana benthamiana wild type plants in a controlled growth room. Plant growth is controlled via irrigation, light and fertilizer cycles. Plants are grown in a soilless media and temperature is controlled throughout the process. After an appropriate number of DPS, for example 23 to 25, plants are infected for protein replication of a selected antigen. Once tagged, the protein is sufficient for retention in the ER of the transgenic plant cell. After infection plants are irrigated with water only and controlled via light cycle and temperature for an appropriate number of days post infection, such as 7-14 days depending on the type of antigen. Plants are inspected for height and infection symptoms, and the aerial tissue is harvested.

[0145] Recovery of antigen produced by the plants involves a disintegrator configured with an optimized blade/screen size followed by removal of residual cellulosic plant fiber from aqueous liquid (such as through a screw press, as one example).

[0146] A suitable extraction buffer is added to the resulting extract at an appropriate ratio, such as a 1:1 buffer:tissue ratio or a 2:1 buffer:tissue ratio. In some embodiments, the extraction buffer may be 50-100 mM Sodium Phosphate+2 mM EDTA+250 mM NaCl+0.1% Tween80, pH 8.5. Removal of chlorophyll and large cellular debris involves the use of filtration. Celpure300 is added at a ratio of 33 g/L and mixed for 15 minutes. Feed pressure (<30 PSI), filtrate pore size (0.3 microns), clarifying agent (Celpure300) and biomass loaded per square meter of membrane surface are all controlled to ensure passage of the antigens.

[0147] Clarified extract is concentrated with a TFF system (such as the Sartorius AG system). In some embodiments, the cassette pore size (for e.g., 30 kDa), an appropriate TMP as described herein, and load of clarified extract per square meter of membrane surface area are controlled.

[0148] The clarified extract is concentrated and washed 7× with an appropriate ion-exchange chromatography equilibration buffer (such as 50 mM Sodium Phosphate+75 mM NaCl, pH 6.5). The Capto Q ion-exchange column is equilibrated for five column volumes with 50 mM Sodium Phosphate+75 mM NaCl, pH 6.5, the feed is loaded, washed with equilibration buffer, and the column eluted/stripped with high salt.

[0149] Antigen fractions are collected in the elution for preparation for Cobalt IMAC chromatography. IMAC is equilibrated for five column volumes with 50 mM Sodium Phosphate+500 mM Sodium Chloride, pH 8.0, feed is loaded, washed with equilibration buffer and eluted using imidazole.

[0150] The elution fraction is diluted to conductivity, pH is checked and loaded onto a multi-modal ceramic hydroxyapatite (CHT) chromatography column. The CHT resin is equilibrated with five column volumes of equilibration buffer (5 mM Sodium Phosphate, pH 6.5). Antigens are eluted using a gradient of phosphate and NaCl. Loading ratio, column bed height, residence time and chromatography buffers are all controlled. Formulation and concentration of the antigens takes place using a TFF system (such as the Sartorius AG system). Pore size (in kDa), TMP, load per square meter of membrane surface area and pore material are all controlled, as further discussed herein.

[0151] Antigen is next concentrated to a suitable concentration, such as 3 mg/ml, and diafiltered with a suitable buffer (for example, phosphate buffered saline, pH 7.4). Formulated antigen is sterilized and stored appropriately. In some embodiments, sterilization is provided via a PES filter.

[0152] FIGS. 9, 10, and 11 illustrate the various steps of the antigen purification platform according to multiple embodiments and alternatives. FIG. 9 shows the purity of the antigen product after the Capto Q chromatography step has concluded, FIG. 10 shows the purity of the antigen product after the affinity chromatography step, and FIG. 11 shows the purity after the CHT chromatography column.

Examples 3, 4, 5, and 6—H5 rHA, H7 rhA, WNV rDIII, and LFV rGP1/2

[0153] As shown in FIG. 12, the antigen purification platform according to multiple embodiments and alternatives has successfully purified H5 rHA, H7 rhA, WNV rDIII, and LFV rGP1/2. FIG. 12 contains two images taken from the conclusion of the antigen purification platform: the image on the left contains a SDS Page gel indicating purity for the viral vector TMV NtK (where NtK is an abbreviation for N-terminal lysine) and influenza antigens, and the image on the right contains a western blot indicating the immunoreactivity for West Nile and Lassa Fever antigens. As shown by the clear and visible bands in FIG. 12, each antigen product is highly pure. Therefore, the antigen purification platform according to multiple embodiments and alternatives consistently purified each type of antigen on a commercial scale it was used with in a manner that is also compliant with cGMP regulations. In the same manner, this platform is expected to be reproducible to purify virtually any type (if not all types) of antigen.

Production of Recombinant Antigen—Virus Conjugates

[0154] Table 3 illustrates the steps of the conjugation of recombinant antigen according to multiple embodiments and alternatives.

TABLE-US-00003 TABLE 3 Production and Purification of Recombinant Antigen Operative Unit In-Process In-Process Steps Operations Controls Analytics 1 Concentration/ Pore Size, TMP, UV280 or BCA, Diafiltration Pore Material, SDSPage, pH, of Antigen kg/m.sup.2 Conductivity 2 Concentration/ Pore Size, TMP, UV260, Diafiltration Pore Material, SDSPage, pH, of TMV 1295.10 kg/m.sup.2 Conductivity 3 Formulation of Mixing, Weight EDC Check Concentrate 4 Formulation of Mixing, Weight Sulfo-NHS Check Concentrate 5 Combine Antigen Molar Ratio, pH, Conductivity, and TMV 1295.10 Mixing, Volume SDSPage 6 Addition of EDC EDC Molarity, pH, Conductivity, Mixing, Volume SDSPage 7 Addition of Sulfo- Sulfo-NHS pH, Conductivity, NHS Molarity, Mixing SDSPage Volume 8 Conjugation Time, Temperature, Reaction Mixing 9 Reaction Time, Temperature, Quenching Mixing, Molarity of Amine Group 10 Diafiltration to Pore Size, TMP, pH, Conductivity, Remove Pore Material, SDSPage, Reactants kg/m.sup.2 Reactants (EDC/NHS) 11 Concentration/ Pore Size, TMP, Certificate of Formulation of Pore Material, Analysis Purified Vaccine kg/m.sup.2 (Drug Substance)

[0155] In an embodiment, the steps of a conjugation platform are as follows:

[0156] Purified antigen and virus are separately concentrated and diafiltered into a slightly acidic buffer, such as a 2-(N-morpholino) ethanesulfonic acid (MES) buffer containing NaCl.

[0157] A water soluble carbodiimide, such as 1-ethyl-3-(3-dimethylaminopropyl) carbodiimide (known as EDC) is formulated in purified water to a molarity of 0.5 M.

[0158] A chemical reagent for converting carboxyl groups to amine reactive N-hydroxysulfosuccinimide esters, such as ThermoFisher's Sulfo-NHS, is formulated in purified water to a molarity of 0.1 M.

[0159] Antigen and virus are combined based upon weight or molarity and mixed to homogeneity (e.g. a 1:1 mg:mg addition).

[0160] The freshly prepared water soluble carbodiimide (such as EDC) is added to the mixture while mixing based upon molarity.

[0161] A chemical reagent for converting carboxyl groups to amine reactive esters (such as Sulfo-NHS) is added based upon molarity within one minute of EDC addition. The conjugation reaction begins and is continued until a predetermined mixing stop time, such as four hours, and the room temperature is controlled.

[0162] The reaction is quenched by adding free amines, and the chemical linker (for example EDC and Sulfo-NHS) is removed through a multi-modal chromatography step, such as Capto® Core 700, or diafiltration into a phosphate buffered saline. According to multiple embodiments and alternatives, the residual impurities are removed from the results of the conjugation reaction, sometimes referred to herein as a conjugate mixture, based on sized differences between impurities as the retentate, and the conjugate mixture as the permeate.

[0163] The conjugate mixture is diluted to target concentration. At this point, the virus-antigen conjugate is prepared for use as a purified vaccine/drug substance. A suitable delivery mechanism of the vaccine would include a liquid vial or lyophilized material to be reconstituted with physiologic buffering for project injection. Injection could be intramuscular or sub-cutaneous. Other delivery methods are contemplated, including without limitation intra-nasal.

Example 7—Conjugation of H7 rHA to TMV

[0164] FIG. 13 provides an illustration of the conjugation of a recombinant antigen (denoted by the “vaccine antigen”) to a virus, with lighter- and darker-shaded ovals representing the extent of conjugation for the vaccine antigen depicted in the example. The lighter shade represents free virus, while the darker shade represents antigen conjugated to the protein coat of the virus. Also, as indicated in FIG. 13, some viruses contain coat positioned proteins around the RNA genome. For example, the viral vector TMV NtK includes N-terminal lysines that serve as connector points to the coat proteins. In some embodiments, portions of the virus associated with N-terminal lysine residues are modified to enhance presentment for binding of recombinant antigen providing amine-targeted conjugation of the protein, for example antigen to virus. In connection with the discussion of radial measurement herein, the viral radius greatly increases following conjugation of the recombinant antigens to the viral coat proteins. In some embodiments, modification is performed when enveloped viruses are changed to allow enhanced presentment of their residues.

[0165] As shown in FIGS. 14-20, the conjugation platform of recombinant antigen to virus has successfully conjugated H7 rHA to TMV. FIGS. 14-16 show an analysis based on sodium dodecyl sulfate-polyacrylamide gel electrophoresis (“SDS-PAGE”) of the conjugation between H7 rHA to TMV at pH 5.50. As illustrated in these figures, nearly all of the H7 rHA was conjugated to the TMV within 2 hours. The disappearance of the rHA protein band and simultaneous appearance of complexes staining above the 200 KDa marker indicates the complex formation. The reactivity of the bands with HA-specific antibodies further establishes this conclusion.

[0166] SEC-HPLC reports also indicated successful conjugation of H7 rHA to TMV in accordance with the current embodiments of the conjugation platform. FIG. 17 shows a SEC-HPLC report of free TMV product. In FIG. 17, the SEC-HPLC report of the free TMV product produced the signal data detailed in Table 4 below.

TABLE-US-00004 TABLE 4 SEC-HPLC Data of Free TMV Peak RT [min] Width [min] Area Height Area % Symmetry 13.233 0.77 1078.39 23.41 100 0.39

[0167] FIG. 18 shows a SEC-HPLC report after H7 rHA is conjugated to TMV for fifteen minutes according to current embodiments of the conjugation platform. In FIG. 18, the SEC-HPLC report after H7 rHA is conjugated to TMV for fifteen minutes produced the signal data detailed in Table 5.

TABLE-US-00005 TABLE 5 SEC-HPLC Data After H7 rHA is conjugated to TMV for 15 Minutes Peak RT [min] Width [min] Area Height Area % Symmetry 26.539 0.52 553.75 17.65 100 0.83

[0168] FIG. 19 shows a SEC-HPLC report after H7 rHA is conjugated to TMV for two hours according to current embodiments of the conjugation platform. In FIG. 19, the SEC-HPLC report taken after H7 rHA is conjugated to TMV for two hours according to current embodiments of the conjugation platform produced the signal data detailed in Table 6 below.

TABLE-US-00006 TABLE 6 SEC-HPLC Data After H7 rHA is conjugated to TMV for 2 Hours Peak RT [min] Width [min] Area Height Area % Symmetry 13.304 0.73 37.30 0.86 0.36 0.43 20.569 1.83 167.16 1.52 1.59 0.00 22.336 1.17 62.55 0.89 0.59 0.64 24.489 2.05 73.35 0.60 0.70 1.34 26.510 0.54 10153.91 316.30 96.56 0.80 29.649 0.83 21.16 0.42 0.20 2.15

[0169] As illustrated in FIGS. 19 and 20, the SEC-HPLC reports indicated that all TMV rods were coated with some H7 rhA after conjugation for fifteen minutes, and more H7 rhA was added to the rods for up to two hours. After two hours, no additional conjugation was detected. According to multiple embodiments and alternatives, the SEC-HPLC reports indicate that the conjugation reaction achieves at least about 50% reduction in non-conjugated, native molecular weight, virus coat protein, and that approximately 3% free TMV remained after conjugation took place for four hours.

[0170] As illustrated in FIG. 20, western blot analysis of the conjugate product indicated successful conjugation of H7 rhA to TMV via covalent attachment. FIG. 20 shows a western blot analysis of the various steps of the conjugation platform according to current embodiments, wherein all samples were loaded at 10 μL. The various lanes illustrate different conjugation reaction times between the antigen and the virus. Lanes 14 and 13 show that all the TMV rods were coated with the antigen after fifteen minutes. After two hours, lanes 6-9 illustrate that no additional conjugation took place.

Example 8—UV Inactivation of TMV NtK

[0171] In order to avoid viral contamination of biopharmaceutical products, it is often necessary to inactivate (or sterilize) the virus to ensure the virus is no longer infectious. In addition, many regulatory agencies have enacted rules (such as the cGMP regulations) that require at least one effective inactivation step in the purification process of viral products. While UV-C radiation has been used in water treatment systems for many years, its use with biopharmaceutical products remains unexplored and there are limited studies regarding its ability to effectively inactivate viruses.

[0172] Accordingly, following virus production and purification but prior to conjugation with recombinant antigen, various UV-C conditions (i.e. energy density and wavelength) and various TMV concentrations were evaluated in order to effectively inactivate and sterilize TMV NtK. While many energy densities were tested, only the higher levels of energy densities successfully inactivated TMV NtK. In addition, it was determined that successful virus inactivation is concentration dependent because when the TMV solution was not diluted to an appropriate concentration, the UV-C irradiation did not effectively sterilize every virus in the sample. Therefore, the TMV solution must be appropriately dilute to permit the UV-C irradiation to interact with and effectively inactivate each virus.

[0173] As shown in FIG. 21, various amounts of UV-C irradiation (with energy densities between 300 J/m.sup.2 and 2400 J/m.sup.2) were tested on Nicotiana tabacum plants to evaluate infectivity. As shown in FIG. 21, the lesions were reduced to zero after an UV-C energy dosage of 2400 J/m.sup.2 therefore indicating successful inactivation of the virus. In addition, energy dosages at much higher levels were also tested, and it was determined that successful inactivation of TMV NtK also occurred at energy densities ranging between 4800 J/m.sup.2 and 5142 J/m.sup.2.

[0174] According to multiple embodiments and alternatives, the steps of the viral inactivation (following purification but before conjugation) are as follows:

[0175] Dilution of the TMV NtK solution to a concentration less than 50 micrograms/ml, as measured by A260 (which is a common method of quantifying nucleic acids by exposing a sample to UV light at a wavelength of 260 nm and measuring the amount of light that passes through the sample).

[0176] 0.45 micron filtration of the TMV solution to remove bacteria and any other large species that might interfere with UV line of sight, and other purification steps according to present embodiments, occur immediately before inactivation with UV light.

[0177] Inactivating the TMV NtK by exposing the virus to light in the UV spectrum with an energy density between about 2400 J/m.sup.2 and about 5142 J/m.sup.2. In some embodiments, the energy density of the UV light is between about 4800 J/m.sup.2 and about 5142 J/m.sup.2. According to multiple embodiments and alternatives, the wavelength of the UV light is 254 nm.

[0178] Next, the inactivated TMV NtK is ready to be conjugated to the recombinant antigen.

[0179] These viral inactivation steps are designed for commercial scalability and compliance with the cGMP regulations

Example 9—pH Dependency of Conjugation

[0180] To evaluate whether incubating the virus at an acidic pH results in high quality conjugation, an experiment was performed using the same batches of virus, antigen, buffers, and esters, but changing only the formulation of the virus. In reaction 1, TMV was formulated into 1×MES Conjugation Buffer at pH 5.50 at a concentration of 3.1 mg/ml, according to multiple embodiments and alternatives. In reaction 2, TMV was concentrated to 11.0 mg/ml in phosphate buffer and added directly as 15% of the conjugation reaction volume. After these steps, the conjugation process was monitoring by SEC wherein an ordered decrease in free TMV from zero minutes (indicated by T=0) would indicate successful conjugation.

[0181] As shown in Tables 7 and 8, reaction 1 exhibited successful conjugation (due to the ordered decrease in free TMV from zero minutes) while reaction 2 was unsuccessful as shown by the percent remaining free TMV.

TABLE-US-00007 TABLE 7 Reaction 1, Successful Conjugation - TMV Formulated in Acidic pH Reaction 1 (TMV Free Remaining Formulated in MES TMV Peak % Free Sample at 3.1 mg/mL) Area by SEC TMV Free 284.8 nm 11104 N/A NtK T = 0 154.9 nm 9732 100%  T = 5′ 139.8 nm 3909 40% T = 15′ 142.8 nm 1815 19% T = 30′ 149.4 nm 1039 11% T = 45′ 155.6 nm 769  8% T = 60′ 153.2 nm 777  8%

TABLE-US-00008 TABLE 8 Reaction 2, Unsuccessful Conjugation-TMV Formulated in Phosphate Buffer Reaction 2 (TMV at Free 11.0 mg/mL TMV in Peak Remaining Phosphate Area by % Free Sample Buffer) SEC TMV Free 64.2 nm 27590 N/A NtK T = 0 67.5 nm 14750 100% T = 5′ 68.8 nm 14916 101% T = 15′ 66.9 nm 13046 88% T = 30′ 73.3 nm 11705 79% T = 45′ 75.8 nm 8109 55% T = 60′ 80.0 nm 11020 75%

[0182] Accordingly, as shown in Table 7, incubation of the virus in acidic pH results in a conjugation greater than 90%. If the acidic pH incubation step does not occur, then the percent conjugation remains less than 50% (as shown in Table 8).

[0183] Based on this experiment, a model for conjugation (shown in FIG. 22) was developed. According to multiple embodiments and alternatives, conjugation between purified virus and purified antigen (denoted by “rHA” in FIG. 22) is greatly enhanced by improving the chemical readiness of the virus to engage the antigen (referred to herein as “activating,” “activation,” or “activates”) by exposing the virus to a conjugation environment. In some embodiments, virus activation occurs by formulating the virus in an acidic pH prior to the conjugation reaction such that positive charge aggregates on the virus surface. In some embodiments, the activating step involves exposing the virus to a pH of about 5.5 or less for a period of time sufficient for activation. In some embodiments, such period of exposure to the conjugation environment is between about 18 and 72 hours. According to multiple embodiments and alternatives, processing the purified virus in an acidic pH activates the virus by charging the coat protein lysine. As a result of this activation step in the conjugation environment, positive charges aggregate on the virus surface (as shown in FIG. 22) via the clustering of the amine groups and the virus is ready for conjugation with the carboxyl end of the recombinant antigen.

[0184] The virus activation steps, according to multiple embodiments and alternatives, are in contrast with traditional approaches in which the pH when storing viruses generally is maintained at or near neutral pH. As shown in FIG. 22, the traditional approach does not aggregate positive charge on the virus surface, and as a result the percent conjugation remains below 50% (see Table 8). Furthermore, the conventional approach utilizes phosphate buffers which promote solubility at the expense of having favorable surface charge.

[0185] During the investigation of successful conjugations involving TMV, it was observed that successful conjugations generally occurred when the Dynamic Light Scattering (DLS)-measured radius of the virus increased during the activation step by at least a factor of 2.75 (see Table 9A, compared to Table 9B). In general, successful TMV conjugations (such as discussed with Table 9C) were characterized by an increase in DLS radius from about 70 nm to about 195 nm or higher, as shown in these tables.

[0186] Based on the successful conjugation which utilized virus activation, a platform was developed for conjugating purified antigen to purified virus. According to multiple embodiments and alternatives, the steps for preparing the purified antigen for conjugation are as follows:

[0187] To ensure pH control of the conjugation reaction, the purified antigen is formulated into a reaction buffer immediately prior to reaction initiation.

[0188] Prior to conjugation, purified antigens are stored in phosphate buffered saline at neutral to slightly basic pH.

[0189] The antigen pH target typically is pH 5.50 to 6.50, depending upon the nature of the molecule.

[0190] To facilitate conjugation to the virus, the storage buffer is replaced with a MES/NaCl buffer at acidic pH using ultrafiltration. The protein concentration is also increased to greater than 3 mg/mL.

[0191] The conjugation reaction is then initiated within four hours of antigen preparation completion to prevent destabilizing the protein structure.

[0192] According to multiple embodiments and alternatives, the steps for preparing the purified virus for conjugation are as follows:

[0193] After storage at neutral pH, the virus is activated at acidic pH prior to conjugation. For successful reactions, the virus is formulated from phosphate buffer at pH 7.4 into acetate buffer at pH 5.50 for a minimum of about 18 hours to a maximum of about 72 hours prior to the conjugation reaction start. In some embodiments, the virus is formulated from phosphate buffer at pH 7.4 into acetate buffer at pH 4.50 for a minimum of about 18 hours to a maximum of 72 hours prior to the conjugation reaction start. It was observed that storage of the virus for greater than 72 hours at acidic pH creates self-association between the viruses which causes virus insolubility and inhibits the efficiency of the conjugation.

[0194] Tables 9A and 9B further demonstrate the activation step in terms of increasing the radius of the virus (in this case, TMV) as measured by DLS. Specifically, Table 9A provides data for DLS radius increase of TMV after being activated, and before a successful conjugation occurred, with the antigens listed in the right-hand column. The “Factor by which radius increased” divides the TMV radius after activation by the typical TMV radius at neutral pH, which is about 70 nm. Conversely, Table 9B provides data for DLS radius increase of TMV after an activation step was started, in advance of unsuccessful attempts at conjugation, with the antigens listed in the right-hand column. In Tables 9A and 9B3, the left column represents the standard radius of TMV rods at neutral pH and under general storage conditions, i.e., before any activation occurs.

TABLE-US-00009 TABLE 9A Free TMV radii as measured by DLS (Prior to successful conjugation) TMV radius after TMV radius at activation (nm) Factor by which neutral pH (DLS results) radius increased Antigen 70 nm 195.2 2.789 SG 70 nm 207.2 2.960 SG 70 nm 249.1 3.559 SG 70 nm 249.1 3.559 SG 70 nm 228.6 3.266 SG 70 nm 234.1 3.344 SG 70 nm 234.1 3.344 SG 70 nm 441.3 6.304 SG 70 nm 284.8 4.069 SG 70 nm 517.6 7.394 SG 70 nm 574.0 8.200 SG 70 nm 448.2 6.403 SG 70 nm 209.7 2.966 PH 70 nm 220.4 3.149 PH 70 nm 495.6 7.080 PH 70 nm 517.6 7.394 PH 70 nm 266.8 3.811 CO 70 nm 495.6 7.080 CO 70 nm 517.6 7.394 CO 70 nm 295.4 4.220 MI 70 nm 517.6 7.394 MI 70 nm 574.0 8.200 MI Average (nm): Average Factor 413.5 for Increase: 5.176

TABLE-US-00010 TABLE 9B Free TMV radii as measured by DLS (Prior to unsuccessful conjugation) TMV radius at TMV radius after neutral pH activation (nm) Factor by which (standard) (DLS results) radius increased Antigen 70 nm  95.4 1.363 SG 70 nm 105.4 1.506 SG 70 nm 156.0 2.229 SG 70 nm 176.5 2.521 PH Average (nm): Average Factor 133.3 for Increase: 1.905

[0195] Following these preparation steps, the antigen and virus reactants were mixed to form a conjugate mixture and the conjugation progress was monitored using DLS and SDS-PAGE methods. Table 9C illustrates the average molecular radius of the conjugation reaction over time using DLS after the virus was activated using acidic pH. As shown in Table 9C, molecular radius is one indicator of successful coating of the viral rods with antigen molecules.

TABLE-US-00011 TABLE 9C TMV NtK SEC and DLS History Soluble NTK SEC DLS Radius Peak Area (nm) 10750 496 9651 518 7106 574 5538 660

[0196] In turn, FIG. 23 shows an analysis based on the SDS-PAGE of the conjugation between the activated TMV NtK and purified antigen according to multiple embodiments and alternatives. As shown in FIG. 23, the ordered reduction in both free TMV NtK and free antigen over time, coupled with the appearance of protein bands of >200 kDA, indicates successful conjugation.

Example 10—TEM Imaging of Different Ratios of Purified Virus to Purified Antigen for Conjugation

[0197] The desired conjugation reaction between purified virus and purified antigen is represented by the following formula:


Virus+Antigen.fwdarw.Virus-Antigen  (Formula 1)

[0198] However, it is well known that antigens are prone to self-conjugation and the desired reaction may not be obtained, as shown by the following formula:


Virus+Antigen.fwdarw.Virus-Antigen+Antigen-Antigen  (Formula 2)

[0199] Self-conjugation of the purified antigen is a problem for the successful development of vaccines because the antigen-antigen conjugates are not removed during the size chromatography step and the result is a minimized or reduced immune response.

[0200] To address this self-conjugation problem, various experiments were performed to determine how to consume the unreacted antigens and antigen conjugates. First, the antigens were capped by exposing them to reagents that inhibited self-conjugation. While it was anticipated that this traditional approach would be successful, this approach failed because the reaction occurred too quickly.

[0201] Next, the virus to antigen ratios were adjusted to determine suitable conjugation ratios. As shown in Tables 10 and 11 and FIGS. 24-30, seven different samples were analyzed by negative stain transmission electron microscopy (TEM) imaging. Samples 1-3 were control groups and samples 4-7 contained different hemagglutinin (HA) to TMV ratios (at the mixing step of the conjugation platform, as shown at operative step 5 of Table 3).

TABLE-US-00012 TABLE 10 TEM Imaging Samples-Control Groups Apprx. Volume Temp. Con- Sample Description Lot (μl) Stored centration 1 HA Alone 19UL-SG- 100 4° C. 1.01 mg/ml 001 free HA 2 TMV NtK 18HA-NTK- 100 4° C. 0.54 mg/ml Alone 001 free TMV NtK 3 HA:HA 19UL-SG- 100 4° C. 2.335 mg/ml Conjugates 004 with added TMV NtK

TABLE-US-00013 TABLE 11 TEM Imaging Samples-Conjugates Approx. Temp. Con- Sample Ratio Lot Volume (μl) Stored centration 4 TMV:HA = 18KBP-VP- 100 4° C. 5.2 1:1 SG-002 mg/ml 5 TMV:HA = 19UL-SG- 100 4° C. 1.688 1:1 001 mg/ml 6 TMV:HA = 19UL-SG- 100 4° C. 1.387 4:1 002 mg/ml 7 TMV:HA = 19UL-SG- 100 4° C. 3.479 16:1 003 mg/ml

[0202] In the various designations listed herein, “KBP-VP” describes a TMV Antigen Presentation and is provided for reference purposes only. FIG. 24 is a TEM image of sample 1 (free HA, lot 19UL-SG-001) at a magnification of 52,000× and a scale bar of 200 nm. In FIG. 24, this sample contained small globular arrows (indicated by arrow A) and elongated particles (indicated by arrow B) that ranged from ˜5 nm to ˜9 nm in size. The appearance of these particles shows a regular structure consistent with ordered aggregation of HA in keeping with native trimer conformation. In addition, the particles were well dispersed with minimal instances of clumping.

[0203] FIG. 25 is a TEM image of sample 2 (TMV NtK alone, lot 18HA-NTK-001) at a magnification of 52,000× and a scale bar of 200 nm. In FIG. 25, rod-shaped particles (arrow A) were observed in sizes ranging from ˜125 nm to ˜700 nm in length and ˜18 nm to ˜20.5 nm in width. These dimensions are consistent with the size and shape of TMV particles. In addition, a central ˜4 nm channel was observed in the rods (arrow B), which is a known characteristic of TMV. Multiple rods were frequently aligned parallel to their long axis and the surface of the rods were generally smooth. On a few occasions, small ˜8 nm to ˜10 nm globular particles (arrow C) were observed both associated with the surface of the rods and not associated with the rod-shaped particles in the background. These globular particles (arrow C) did not resemble individual HA trimers.

[0204] FIG. 26 is a TEM image of sample 3 (HA:HA Self-Conjugates with added TMV NtK, lot 19UL-SG-004) at a magnification of 52,000× and a scale bar of 200 nm. In FIG. 26, rod-shaped particles were observed that ranged from ˜25 nm to ˜885 nm in length to ˜18 nm to ˜20.5 nm in width (arrow A) and a central ˜4 nm inner channel (arrow B). The rods were either not decorated at all or sparsely decorated with small, proteinaceous particles of various sizes and shapes (arrow C). Some of the small, proteinaceous particles were also seen in the background, not associated with the rods (arrow D). FIG. 26 illustrates larger clumps of HA particles, but the TMV looks identical to the unconjugated TMV (shown in FIG. 25) as expected.

[0205] FIG. 27 is a TEM image of sample 4 (TMV:HA in a 1:1 ratio, lot 18 KBP-VP-SG-002) at a magnification of 52,000× and a scale bar of 200 nm. In FIG. 27, rod-shaped particles were observed that ranged in size from ˜50 nm to more than ˜1000 nm in length and ˜18 nm to ˜20.5 nm in width (arrow A) with a ˜4 nm central inner channel (arrow B). The particle rods were similar in size and shape to the conjugated TMV observed in FIG. 28, with the exception that the majority of the rods were heavily decorated with small proteinaceous densities on their surface (arrow C). Some of the small, proteinaceous particles were also seen in the background, not associated with the rods (arrow D). The sample 5 shown in FIG. 27 looks superior to the other TEM images which is most likely due to the difference in virus treatment prior to conjugation. For this batch, the virus was formulated at pH 5.50, then the pH was reduced to 4.50 for 15 minutes, and brought back up to pH 5.50 at the start of the conjugation reaction. For the batches shown in FIGS. 28-30, the virus was formulated directly into pH 4.50 and held overnight before the conjugation.

[0206] FIG. 28 is a TEM image of sample 5 (TMV:HA in a 1:1 ratio, lot 19UL-SG-001) at a magnification of 52,000× and a scale bar of 200 nm. In FIG. 28, many rod-shaped particles were visible that ranged from ˜65 nm to ˜720 nm in length and ˜18 nm to ˜20.5 nm in width (arrow A) with a ˜4 nm central inner channel (arrow B). The particle rods were similar in size and shape to the free TMV NtK (sample 2) observed in FIG. 25. However, in contrast to the unconjugated virus shown in FIG. 25, the particle rods observed in FIG. 28 were moderately decorated with proteinaceous densities (arrow C). These densities were irregular in shape and size, and appeared to be randomly associated with the surface of the rods with no obvious pattern. Some of the small, proteinaceous particles were also seen in the background, not associated with the rods (arrow D).

[0207] FIG. 29 is a TEM image of sample 6 (TMV:HA in a 4:1 ratio, lot 19UL-SG-002) at a magnification of 52,000× and a scale bar of 200 nm. In FIG. 29, rod-shaped particles were observed that ranged from ˜25 nm to more than ˜1000 nm in length, and ˜18 nm to ˜20.5 nm in width (arrow A) with a ˜4 nm central inner channel (arrow B). The particle rods observed in FIG. 29 were similar in dimension to the previously conjugated samples, but the level of surface decoration of the small proteinaceous densities (arrow C) ranged from moderate to sparse. Some of the small, proteinaceous particles were also seen in the background, not associated with the rods (arrow D).

[0208] FIG. 30 is a TEM image of sample 7 (TMV:HA in a 16:1 ratio, lot 19UL-SG-003) at a magnification of 52,000× and a scale bar of 200 nm. In FIG. 30, rod-shaped particles were observed that ranged in size from ˜30 nm to more than ˜1000 nm in length and ˜18 nm to ˜20.5 nm in width (arrow A) with a ˜4 nm central inner channel (arrow B). The particle rods observed in FIG. 30 were similar in overall morphology to the previous conjugated samples. However, the rods were only sparsely decorated with protein (arrow C) or not decorated at all. Only a few small, proteinaceous particles were seen in the background, not associated with the rods (arrow D).

[0209] FIGS. 24-30 illustrate that the 1:1 ratio exhibited full rod decoration, the 4:1 ratio exhibited moderate decoration, and the 16:1 ratio exhibited sparse decoration. Stated differently, the 1:1 ratio generated virus rods with heavy antigen decoration (i.e. more density) of HA antigen, while the 16:1 ratio generated viral rods with less antigen decoration (i.e. less density) of HA antigen on each rod. As a byproduct of the conjugation reaction, HA-HA self-conjugates were observed, principally in the 1:1 ratio reactions. Furthermore, compared with the 1:1 reactions, there appeared to be less free HA or HA-HA conjugates in the 4:1 reaction and even less with the 16:1 reaction in TEM images as well as SDS-PAGE reaction analyses (data not shown). In other words, there was higher conjugation efficiency of HA to solely TMV rods overall at the 16:1 ratio, but less density of HA per rod than the 1:1 reaction.

Example 11—Sedimentation Velocity Analysis of Different Conjugation Conditions

[0210] Sedimentation velocity (“SV”), as measured in an analytical ultracentrifuge (“AUC”), is an ideal method for obtaining information about protein heterogeneity and the state of association of aggregation. Specifically, aggregates or different oligomers can be detected on the basis of different sedimentation coefficients. This method also detects aggregates or other minor components at a level below 1% by weight. Furthermore, SV provides high quality quantitation of the relative amounts of species and provides accurate sedimentation coefficients for any aggregates.

[0211] In order to measure the amount of self-conjugated and unreacted HA, as well as the amount of HA occupancy on TMV NtK with different conjugation conditions, the total signal associated with the sedimentation of free antigen, free virus, and various TMV:HA ratios were measured using SV-AUC. The following samples and descriptions are provided in Table 12:

TABLE-US-00014 TABLE 12 Samples and Descriptions for SV-AUC Sample Description Lot Concentration 1 HA Alone 19S-G-001 1.01 mg/ml 2 TMV Ntk Alone 18HA-NTK-001 0.54 mg/ml 3 TMV:HA = 1:1 19UL-SG-004  1.0 mg/ml 4 TMV:HA = 1:1 18 KBP-VP-SG-  1.0 mg/ml 002 5 TMV:HA = 1:1 19UL-SG-001  0.8 mg/ml 6 TMV:HA = 4:1 19UL-SG-002  1.0 mg/ml 7 TMV:HA = 16:1 19UL-SG-003  1.0 mg/ml

[0212] These stocks were shipped cold (not frozen) and subsequently stored at 2-8° C. until analyzed. 1×PBS from Corning was used for sample dilution and as a reference blank. Sample 1 was diluted 1:1, and samples 2-7 were diluted 1:3 with 1×PBS to create the sedimentation velocity samples. These dilutions were carried out to bring the total absorbance of the sample within the linear range of the absorbance detection system.

[0213] Methods—The diluted samples were loaded into cells with 2-channel charcoal-epon centerpieces with 12 mm optical pathlength. 1×PBS was loaded into the reference channel of each cell. The loaded cells were placed into an analytical rotor, loaded into an analytical ultracentrifuge, and brought to 20° C. The rotor was then brought to 3000 rpm and the samples were scanned (at 280 nm) to confirm proper cell loading. For samples 2-7, the rotor was brought to the final run speed of 9,000 rpm. Scans were recorded at this rotor speed as fast as possible (every 3 min) for ˜11 hours (250 total scans for each sample). For sample 1 (the free HA), the rotor was brought to 35,000 rpm and scans were recorded every 4 min for 5.3 hours. The data was then analyzed using the c(s) method described in Schuck, P. (2000), “Size-distribution analysis of macromolecules by sedimentation velocity ultracentrifugation and Lamm equation modeling,” Biophys. J. 78, 1606-1619. Using this method, raw scans were directly fitted to derive the distribution of sedimentation coefficients, while modeling the influence of diffusion on the data to enhance the resolution.

[0214] Results and Discussion—The high-resolution sedimentation coefficient distributions for samples 1-7 are shown in FIGS. 31-37. In these figures, the vertical axis provides the concentration and the horizontal axis provides the separation on the basis of sedimentation coefficient. Each distribution has been normalized by setting the total area under the curve to 1.0 (100%) to ensure the area under each peak provides the fraction of that species. Since samples 2-7 contain material sedimenting over a broad range of sedimentation coefficients, the data analysis has been pushed to cover species sedimenting as fast as 2000 Svedburg units (S), and therefore the horizontal axis is on a log scale. To compensate for the effect that log scaling could distort the visible area of the peaks, the vertical axis has been multiplied by the sedimentation coefficient, which correctly scales the relative peak areas. The data for sample 1 (free HA) is presented traditionally using a linear sedimentation coefficient scale.

[0215] FIG. 31 is normalized sedimentation coefficient distribution for sample 1 (HA alone, lot 19S-G-001). Since free antigen is much smaller in size than virus, this sample was analyzed at a much faster rotor speed (35,000 rpm) than samples 2-7 (9,000 RPM) in order to adequately characterize the size distribution. As shown in FIG. 31, sample 1 is somewhat homogeneous, providing 73.7% main peak at 8.967 S. This was the expected result for the HA antigen-only sample. This sedimentation coefficient together with the width of the main boundary imply this main peak species has a molar mass of ˜222 kDa, which may indicate the main peak corresponds to roughly a HA trimer of the expected ˜70 kDa monomer. It is not physically possible for this sedimentation coefficient to correspond to monomer; instead, the main peak corresponds to an oligomeric state larger than monomer. As noted in Table 13 below, SEC IPLC data at HA3 Singapore release, >90% of HA was identified in trimer status, with 3 of the 4 samples analyzed having greater than 50% trimerization.

TABLE-US-00015 TABLE 13 Extent of trimerization Pre-Clinical HA lot SEC SEC Antigen Lot number Trimer % Monomer % B/Colorado 18 KBP-VP 18HA-CO- 55.05% 44.95% CO-001 003 A/Michigan 18 KBP-VP- 18HA-MH- 11.93% 88.07% MH-002 007 B/Phuket 18 KBP-VP- 18HA-PH- 84.51% 15.49% PH-002 003 A/Singapore 18 KBP-VP- 18HA-SG- 94.52%  3.90% SG-002 003

[0216] As also shown in FIG. 31, seven minor peaks sedimenting faster than the main peak were detected, which together represent 6.2% of the total sedimenting absorbance. Presumably those two peaks represent product aggregates rather than high molecular weight impurities. The principal aggregate species at 12.45 S (4.25%) is sedimenting 1.4 times faster than the monomer, a ratio that falls within the range of 1.4 to 1.5 usually observed for dimers. While that ratio suggests that this species is a dimer of the main peak material (possibly a hexamer of the ˜70 kDa monomer), its sedimentation coefficient could also suggest that it is a highly extended or partially-unfolded trimer of the main peak material (possibly a nonamer of the ˜70 kDa monomer).

[0217] In FIG. 31, the next peak at 15.3 S (0.96%) is sedimenting 1.7× faster than monomer which suggests a trimer of the main peak material. No absorbance was detected for any sedimentation coefficients larger than 30.9 S. Also, three minor peaks sedimenting more slowly than the main peak were also detected at 2.8 S (2.81%), 4.5 S (12.44%), and 6.0 S (4.94%). Of these minor peaks, the peak at 4.5 S most likely corresponds to antigen monomer.

[0218] FIG. 32 is the normalized sedimentation coefficient distribution for sample 2 (free TMV NtK, lot 18HA-NTK-001). As shown in FIG. 32, no sedimenting material was detected below ˜60 S. This sample appeared quite heterogeneous, with the most abundant peak sedimenting at 229 S (30.9%). The second most abundant peak was detected at 191 S (28.7%). It is not clear which peak corresponds to fully assembled virus. In addition, 25.3% of the total signal was observed sedimenting from 229 S to 2,000 S, the largest sedimentation coefficient allowed in this Example 11. It is unclear what the partially-resolved peaks from ˜60 S to 2000 S represent.

[0219] FIGS. 33-37 show the normalized sedimentation coefficient distribution for virus-antigen conjugates. Each of these figures shows a significant absorbance of about 0.15 OD that did not sediment. This was established by increasing the rotor speed to 35,000 RPM after the completion of each run, in order to pelletize all remaining material. This material was not observed in either the free antigen or the free TMV NtK samples. However, since this material did not sediment, it did not affect the results of the measured size distributions.

[0220] FIG. 33 is the normalized sedimentation coefficient distribution for sample 3 (TMV to HA at 1:1 Ratio, lot 19UL-SG-004). As illustrated in FIG. 33, the results in the sedimentation coefficient range from about 40 S to 2000 S, and are similar to those observed for free virus (shown in FIG. 33). Three peaks were also observed in the sedimentation coefficient range of 1-40 S: 9.9 S (28.3%), 18.7 S (7.8%), and 34.5 S (1.0%). The peak observed at 9.9 S may correspond to the main peak observed in the free HA sample (shown in FIG. 32). The variety of smaller peaks may reflect HA-HA self-conjugation events.

[0221] FIG. 34 is the normalized sedimentation coefficient distribution for sample 4 (TMV to HA at 1:1 Ratio, lot 18 KBP-VP-SG-002) and FIG. 35 is the normalized sedimentation coefficient distribution for sample 5 (TMV to HA at 1:1 Ratio, lot 19UL-SG-001). The results shown in FIGS. 34 and 35 are similar to those discussed for sample 3 (and shown in FIG. 33). However, some notable differences were observed. First, it is difficult to comment on differences observed for the free antigen sample (from 1-40 S) because of poor resolution at this rotor speed. Nevertheless, FIGS. 34 and 35 show more total signal present from 40 S-2,000 S (which is indicative of virus associated material) than sample 3.

[0222] FIG. 36 is the normalized sedimentation coefficient distribution for sample 6 (TMV to HA at a 4:1 ratio, lot 19UL-SG-002), and FIG. 37 is the normalized sedimentation coefficient for sample 7 (TMV to HA at a 16:1 ratio, lot 19UL-SG-003). FIG. 36 shows 91.1% total virus-associated material (i.e. virus-antigen conjugates) and FIG. 37 shows 99.4% virus-associated material (i.e. virus-antigen conjugates).

[0223] The results for the virus-antigen normalized sedimentation coefficient distribution, as shown in FIGS. 33-37, are set forth in Table 14. As previously noted, the fraction between 1-40 S indicates the percent HA monomer/trimer, and the fraction between 40-2000 S indicates the percent TMV NtK-HA conjugate, according to multiple embodiments and alternatives.

TABLE-US-00016 TABLE 14 SV-AUC Results of the Different Virus-Antigen Conjugates Fraction Between Fraction Between 1-40 S 40-2000 (%) (HA S (%) (TMV monomer/ NtK-HA Sample Lot Ratio trimer) Conjugate) 3 19UL-SG-004 1:1 37.1 62.9 4 18 KBP-VP- 1:1 26.1 73.9 SG-002 5 19UL-SG-001 1:1 31.4 68.6 6 19UL-SG-002 4:1 11.2 91.1 7 19UL-SG-003 16:1  0.6 99.4

[0224] The results in Table 14 indicate that a 1:1 ratio has more self-conjugation of HA and HA products, as compared to the 4:1 and 16:1 ratios. In addition, increasing the TMV:HA ratio results in virtually complete engagement of HA products in TMV-conjugation events (approaching almost 100% conjugation in sample 7).

[0225] According to multiple embodiments and alternatives, decreasing the amount of HA in a conjugation reaction, by increasing the TMV NtK to HA ratio from 1:1 to 16:1, results in: (1) reducing the aggregation of HA antigen on each TMV rod, as observed by Example 10 and FIGS. 24-30; (2) decreasing the amount of self-conjugation and unreacted HA events to nearly zero, as shown by FIGS. 31-37 and Table 14; and (3) increasing the association of HA (as a percentage) to TMV compared with self-conjugation and unreacted HA events, as shown by FIGS. 31-37 and Table 14.

Example 12—Immune Response in Mice

[0226] To determine immune response following administration of the inventive virus-antigen conjugates, mice were administered the conjugates as vaccines via intramuscular injection. Each vaccine was a TMV:HA conjugate produced at a 1:1 (TMV:HA) ratio as described herein, administered to most of the animals on Day 0 and 14 of the study (control animals were administered buffer alone, TMV alone, or HA alone). Those administered vaccine received either 15, 7.5, or 3.75 mcg (micrograms) of antigen, as shown below in Table 15. One cohort had samples drawn on Day 7, another at Days 14 and 21, and a third at Days 28, 42, and 90, with the samples then subjected to hemagglutination inhibition (HAI) assay.

[0227] Based on the assay, no measurable response from any animal for any vaccine occurred at Days 7 or 14. However, initial responses were seen in some animals on Day 21. Specifically, 10/27 animals showed low level responses (only 1 of them >80 HAI titers) for H1N1 vaccine (Influenza A/Michigan/45/2015 (H1N1pdm09)). Also, 22/27 showed low level responses (only 2 of them >80) for H3N2 vaccine (Influenza A/Singapore/INFIMH-16-0019/2016). On Day 28, the number of animals within this cohort responding measurably to H1N1 vaccine was 8/29 with a single animal at 80 HAI titers and all others less. For H3N2 vaccine, the number responding measurably was 14/29, also with a single animal at 80 HAI titers and all others less.

[0228] The most pronounced results were observed from blood samples taken at Day 42 and Day 90, which are presented in Table 15, below. In this table, a standard error of the mean (SEM) is provided with the average and the fraction of animals responding (Fr.Resp.). It will be noted that in each cohort, some of the mice received vaccines for Influenza B viruses (B/Colorado/06/2017 (V) and B/Phuket/3073/2013 (Y), respectively). No response was detected in these animals on any of the days, as expected because B-type influenza viruses and corresponding HA immunogens are known to not generate HAI titers in mice with the efficiency and effectiveness as A-type HA immunogens.

TABLE-US-00017 TABLE 15 Immune response based on dose and time post-vaccination Day 42 Average HAI Titers Day 90 Average HAI Titers Immunogen H1N1 Fr.Resp H3N2 Fr.Resp H1N1 Fr.Resp H3N2 Fr.Resp 1. Vehicle alone 0 0 0 0 0 0 0 0 2. TMV alone: 15 μg 0 0 0 0 0 0 0 0 3. HA Quad 15 μg 0 0 0 0 0 0 0 0 4. HA Quad 7.5 μg 0 0 0 0 0 0 0 0 5. HA Quad 3.75 μg 0 0 0 0 0 0 0 0 6. V-HA Quad 15 μg 20 ± 5.477  7/10 27 ± 7.218  8/10 274 ± 66.336 10/10 136 ± 33.442 10/10 7. V-HA Quad 7.5 μg 26 ± 4.733  9/10 22 ± 9.466  6/10 174 ± 40.797  9/10  84 ± 45.77  6/10 8. V-HA Quad 3.75 μg 19 ± 4.566 7/9 17 ± 4.969 6/9 224 ± 62.993 8/9   40 ± 10.423 7/9

[0229] Separate from the previously described immune response study, and to further evaluate the inventive system in terms of suitable virus to antigen ratios, the humoral immune response in mice was evaluated following vaccination at various TMV:HA conjugate ratios (i.e., 1:1, 4:1, 16:1) of both Influenza A Antigen and Influenza B Antigen along with controls as noted below. In this manner, various conjugation ratios and their effect on immune response were studied. The mice receiving vaccination were administered 15 mcg HA via injection on Day 0 and Day 14 of the study, in a subcutaneous region dorsally. The serum antibody responses to the vaccination were then analyzed for HA-specific activity. Tables 15 (H3 influenza virus used as capture protein) and 16 (recombinant H3 protein used as capture protein) show the groupings of mice (12 mice per grouping), and the agents that were administered, with the right-hand column in each table presenting ELISA antibody (Ab) titers results.

TABLE-US-00018 TABLE 16 TMV:HA ratio study-A-type influenza HA. Conjugation ratio Average ELISA Grouping Vaccine (TMV:Antigen) Ab Titer 1. Phosphate-buffered saline n/a  0 2. TMV-H3 H3 HA:HA  0 3. TMV-H3 1:1  0 4. TMV-H3 4:1 120 5. TMV-H3 16:1 200

[0230] FIG. 38 is a scatterplot associated with Table 16, which provides graphical analysis of H3:HA Ab titers following administration of vaccine at ratios of 0, 1:1, 4:1, and 16:1 (TMV:HA). FIG. 39 also illustrates graphically the results of geometric mean testing of antigen-relevant Ab titers, using recombinant 1-3 antigen (Table 17) as coating or capture H3 virus as capture protein (Table 17) that binds with anti Influenza A H3 Antigen antibody. In terms of density (surface area of TMV occupied by HA), the trend for the three ratios progresses from 1:1 (most dense)>4:1>16:1 (least dense), as demonstrated by TEM and AUC analyses. In these figures representing ELISA results obtained with H3 antigen, the highest immune response was observed with the least dense conjugate. That is, the trend for immune response was 16:1>4:1>1:1 and went in reverse of the trend for density. Thus, surprisingly it was found at these ratios for TMV:HA, lesser density of conjugation tended to provide better immune response. Possible explanations for this surprising finding that antigenicity does not correlate with maximum HA conjugation events include: (1) more uniform antigen with less to no-unreacted or self-conjugated protein when the density is comparatively lower; (2) there could be more efficient processing of conjugated antigen and more preserved/uniform antigen conformation; and (3) the TMV rods (by way of example) may stimulate more antigen presenting cells to migrate to the injection site and stimulate processing of attached antigen, or some combination of these factors. Note, however, that just the presence of TMV particles does not replace the need for conjugation (see, e.g., Tables 14 and 15).

[0231] In addition to Influenza A H3 Antigen, Influenza B Antigen also was studied (B-Phuket HA) using the binding propensity of recombinant Influenza B Phuket Antigen and its corresponding antibody. Table 17, below, presents the results of this part of the study that was there is not as clear of a showing of 16:1>4:1>1:1 based on the results of average ELISA Ab titers.

TABLE-US-00019 TABLE 17 TMV:HA ratio study-B-type influenza HA. Conjugation ratio Average ELISA Grouping Vaccine (TMV:Antigen) Ab Titer 1. Phosphate-buffered saline n/a 0 2. TMV-B B Phuket HA:HA 283± 3. TMV-B 1:1 211± 4. TMV-B 4:1  56± 5. TMV-B 16:1 329±

[0232] Even so, the 16:1 ratio demonstrated the highest average antibody titer. Thus, is reasonable to predict the same relationship between density and immune response applies to the study of the Influenza B Antigen (B-Phuket HA). That is, as with the results of H3 antigen, immune response will be higher for less dense forms of the conjugates. Additionally, there is reason to believe the conjugation reaction for the 4:1 ratio did not proceed as the reactions for the other ratios because of possible abnormalities during conjugation, and the fact that neither electron microscopy nor ultracentrifugation analysis were performed on this sample. In any case, the data here show immune response at all three ratios. The fact that immune response was achieved at multiple ratios underscores the robustness of the system for not being tied to any one particular ratio. This flexibility as seen with the particular TMV-conjugated vaccines probably gives further indication that the system will work well both when other antigens are conjugated to TMV besides the H3 and H1 antigens included in these studies, as well as when other virus carriers besides TMV are used for the carrier.

[0233] In terms of clinical utility, a product conjugated in accordance with any of multiple embodiments and alternatives described herein may be utilized as a vaccine by delivering the purified antigen via a purified virus, such as but not limited to the virus-antigen conjugates described in Examples 7, 9, 10, 11, and 12. Still further, embodiments of the present disclosure include any vaccine products packaged in any number of forms (e.g., vial) with appropriate buffers and additives, being manufactured from any virus-protein conjugate compositions, the conjugation of which is provided for herein. In this respect, embodiments include those wherein such vaccine products are amenable to delivery in the form of unit doses provided to a subject, such as but not limited to administration by syringe or spray through routes that include, but are not limited to, subcutaneous, intramuscular, intradermal administration, and nasal, as well as administration orally by mouth and/or topically, to the extent clinically indicated. By way of non-limiting example, and without detracting from the breadth and scope of the embodiments herein, the size of TMV (typically 18 nm×300 nm) and its rod-like shape promotes antigen uptake by antigen presenting cells (APCs), and thus serves to enhance immunity promoted by T cells (such as Th1 and Th2), including cellular responses, and to provide adjuvant activity to surface conjugated subunit proteins. This activity is also stimulated through viral RNA/TLR7 interaction. As a result, the combined effect of vaccine uptake directly stimulates activation of the APCs. Humoral immunity is typically balanced between IgG1 and IgG2 subclasses through subcutaneous and intranasal delivery. Upon mucosal vaccine delivery, responses also include substantial systemic and mucosal IgA. Cellular immunity is also very robust, inducing antigen-specific secretion, similar to a live virus infection response. Whole antigen fusions allow for native cytotoxic T lymphocyte (CTL) epitope processing, without concern for human leukocyte antigen (HLA) variance.

[0234] The broad (humoral and cellular) and augmented (amplitude and effectiveness) immune responses associated with the multi-set purification platform according to current embodiments are in sharp contrast to subunit proteins tested without TMV conjugation, which induce little or no cellular or humoral immunity. The impact of these immune responses is that vaccines created via the multi-set platform, according to current embodiments, promotes highly protective responses as single dose vaccines and offers speed and safety not offered by other conventional vaccine platforms. Indeed, the conjugation platform is shown to work on a wide array of viruses and proteins (including antigens), combined within a broad range of ratios and successfully administered at various doses, which again are indicative of the robustness of the system. Additional advantages of the multi-set platform for producing vaccines in current embodiments include: a proactive antigen-stimulating approach for systemic immune protection against pathogen challenge, the platform is highly adaptable to produce antigenic domains from disease pathogens (including virus glycoproteins or non-secreted pathogen antigens), and the platform serves as an efficacious vaccine platform for both virus and bacterial pathogens.

[0235] In addition to advantages regarding vaccine applications, plant virus particles purified via the multi-set platform according to current embodiments can be formulated for various drug delivery purposes. These different purposes may include: 1) immune therapy—through the conjugation of therapeutic antibodies to the surface of virus particles and their delivery to enhance cytotoxic effect; 2) gene therapy—through loading specific nucleic acids for introduction into particular cell types for genetic modification, and 3) drug delivery—through loading chemotherapeutic agents into virus particles for targeted tumor delivery.

[0236] As a brief example of the many advantages of the methods discussed herein, the multi-set platform according to multiple embodiments could be utilized as a drug delivery tool by first causing the purified virus to swell by exposing it to a pH shift as discussed above. Subsequently, the virus in this condition would be incubated with a solution of concentrated chemotherapeutic agent, such as doxorubicin, and the pH is then reverted to neutral thereby causing the virus to return to its pre-swollen state and thereby entrapping the chemotherapeutic molecules. Next, the virus particle could be delivered to an organism by a delivery mechanism chosen from a group that includes, but is not necessarily limited to, injection for targeted treatment of tumors.

[0237] Accordingly, the above descriptions offer multiple embodiments and a number of alternative approaches for (i) the plant-based manufacture and purification of viruses; (ii) the plant-based manufacture and purification of antigens; and (iii) the formation of virus-antigen conjugates outside the plant that are therapeutically beneficial as vaccines and antigen carriers; and (iv) the delivery of therapeutic vaccines comprising a purified virus and purified antigen.

Example 13—Vaccine Stability Under Refrigerated and Room Temperature Conditions

[0238] Vaccines have dramatically improved human and animal health. For instance, in the 20.sup.th Century alone, vaccines have eradicated smallpox, eliminated polio in the Americas, and controlled a variety of diseases throughout the world. However, vaccines are highly unstable and very sensitive to changes in temperature. As discussed in F. Coenen et. al., Stability of influenza sub-unit vaccine. Does a couple of days outside the refrigerator matter? Vaccine 24 (2006), 525-531, influenza vaccines are generally unacceptable and inactive after five weeks at room temperature storage (i.e. ˜25° C.). Of all the influenza vaccines discussed in the F. Coenen article, only one vaccine exhibited stability for 12 weeks at room temperature storage. In many situations, this is a significant problem with other vaccine types too, as well as for individual specific components (e.g. intermediates) of vaccines. Accordingly, vaccines generally have had to be refrigerated during the entire supply chain from the moment of commercial production until administration, often referred to as the “cold chain.”

[0239] While in a refrigerated environment, the majority of vaccines remain stable for the typical seventy-eight week goal of stability. However, the absolute requirement for cold chain is a global problem that has limited the availability of vaccines worldwide because it is often difficult to guarantee in developing countries and has led to widespread vaccine loss. Many efforts have been made to create room temperature stable vaccines, but as discussed in the literature, those efforts have been unsuccessful. In addition, the cold chain is very costly to maintain for manufacturers, as well as the doctors and organizations receiving, storing, and applying the vaccines to populations. Accordingly, there is a significant and global need for increasing the stability of vaccines and enhancing vaccine-antigen stability in order to reduce the dependency on the cold chain and to ensure vaccines retain their potency until administration. In regards to stability of an antigen itself, i.e., as an intermediate, ready to be conjugated with a suitable virus carrier, there are advantages to maintaining antigen stability following production and purification, yet prior to conjugation. These advantages include, but are not limited to, the ability to manufacture antigen at a separate manufacturing facility or at different times from the production and purification of virus carriers. Being able to do so provides more flexibility in the supply chain. In addition, improving stability can prolong the vaccine shelf life, which would facilitate the stockpiling of vaccines in the preparation of a potential pandemic and prevent vaccine loss in unfavorable conditions. Along with other features and advantages outlined herein, the scope of present embodiments meet these and other needs. In doing so, the inventive purification and conjugation platform extends the stability of protein-virus conjugates under both refrigerated and room temperature conditions.

[0240] There are several methods for determining antigen quality and vaccine stability including: (1) protein concentration as measured by BCA Protein assay (which is based on the principle that proteins can reduce Cu.sup.2+ to Cu.sup.+1 in an alkaline solution which results in a purple color formation), (2) storage potency as measured by VaxArray® antibody array binding (which utilizes multiplexed sandwich immunoassays), (3) SDS-Page purity as measured in terms of a single migrating band, (4) pH as a measurement of the physical pollution properties, and when possible, (5) size exclusion chromatography to characterize the multimeric structure of the antigen. In some embodiments, a bioburden test is also conducted to analyze the presence of bacteria or mold contamination (in the tables below “TAMC” is an abbreviation for Total Aerobic Microbial County and “TCYM” is an abbreviation for Total Combine Yeast/Mold Count). Moreover, a vaccine is considered unacceptable for use if it fails the BCA Protein assay, the VaxArray© test, or the SDS-Page analysis. In other words, if a vaccine fails any one of these three tests, the vaccine is unacceptable for use and inactive. The VaxArray© potency assay is used to assess with improved sensitivity a range of strains of different viruses and effects of vaccines in treating them, including pandemic strains of SARS-CoV2 and influenza. Some aspects of the VaxArray© assay relevant to influenza viruses and vaccines are described in Byrne-Nash, Rose T., et al., “VaxArray potency assay for rapid assessment of ‘pandemic’ influenza vaccines,” npj Vaccines 3, 43 (2018). With the occurrence of the SARS-CoV-2 pandemic in 2020, VaxArray© potency assays are commercially available for the study of coronaviruses, vaccines, and vaccine intermediates.

[0241] Accordingly, the five tests mentioned in the previous paragraph were conducted on the following influenza HA antigens produced and purified in accordance with multiple embodiments and alternatives: H1NI (A/Michigan), H3N2 (A/Singapore), H1N1 (A/Brisbane), H3N2 (A/Kansas), B/Colorado, and B/Phuket. The following tables provide the stability data and storage potency as measured at release and various times after filling into vials and stored under refrigerated conditions (2° to 8° C.). As used herein, an initial concentration or integrity refers to the concentration or integrity of a compound, conjugate mixture, pharmaceutical product, vaccine, or the like at its release date (i.e. after constitution or dilution of a drug product and sometimes referred to as “day 0”), and the release date is determined based on 21 C.F.R. Part 11 and ICH Q1A Stability Testing of New Drug Substances and Products, Revision 2 (November 2003), and references cited in the latter document, with the full contents of all of the foregoing being incorporated by reference herein for all purposes.

TABLE-US-00020 TABLE 18 Stability of Purified H1NI (A/Michigan) Under Refrigerated Conditions Test Test Initial 1 3 4 5 6 Parameters Method Units (CoA) month months months months months Concentration BCA mg/mL  1.081    1.057  1.068   1.066   1.060   0.921 Purity SDS PAGE % 97%  >99%  92%  88%  81%  76% Purity SEC Peak 1% 11.93%    6.18%  0.00%   2.83%   4.77%   4.92% Peak 2% 88.07%    93.82% 100.00%  97.17%  95.23%  95.71% Physical/ pH NA  7.4    7.4  7.4   7.2   7.3   7.3 Chemical Properties Storage Potency VaxArray ® μg/mL 93   164 987 1300 1085 1176

TABLE-US-00021 TABLE 19 Stability of Purified H3N2 (A/Singapore) Under Refrigerated Conditions Test Test Initial 1 3 4 5 6 Parameters Method Units (CoA) month months months months months Concentration BCA mg/mL    0.855    0.900     0.891    0.908    0.885     0.795 Purity SDS PAGE %  >99%  >99%  >99%  >99%  >99%  >99% Purity SEC Peak 1%    94.52%    97.95%    100.00%   100.00%   100.00%    100.00 % Peak 2%    3.90%    0.00%     0.00%    0.00%    0.00%     0.00% Physical/ pH NA    7.4    7.4     7.4    7.2    7.3     7.3 Chemical Properties Storage Potency VaxArray ® μg/mL   746   671   1037   624   872   1089

TABLE-US-00022 TABLE 20 Stability of H1N1 (A/Brisbane) Under Refrigerated Conditions Test Test Parameters Method Units Initial (CoA) 1 month 3 months Concentration BCA mg/mL 0.804 0.810 0.967 Purity SDS % >99% 78% 73% PAGE Purity SEC Trimer % 20.85% Trimer 11.21% Trimer 100% single Monomer % 79.15% 88.79% peak Monomer Monomer Storage VaxArray ® μg/mL 1205 1064 768 Potency

TABLE-US-00023 TABLE 21 Stability of H3N2 (A/Kansas) Under Refrigerated Conditions Test Test Parameters Method Units Initial (CoA) 1 month 3 months Concentration BCA mg/mL 0.9 0.923 1.211 Purity SDS % 95% 93% 90% PAGE Purity SEC Trimer % 30.92% Trimer 5.20% Trimer 100% single Monomer % 69.08% 94.80% peak Monomer Monomer Storage VaxArray ® μg/mL 916 1061 1094 Potency

TABLE-US-00024 TABLE 22 Stability of B/Colorado Under Refrigerated Conditions Test Test Initial Parameters Method Units (CoA) 1 month 3 months 4 months 5 months 6 months Concentration BCA mg/mL  0.848  0.855  0.862  0.873  0.885   0.777 Purity SDS PAGE %   99%   63%   46%   40%   38%    35% Purity SEC Peak 1% 55.05% 39.70% 38.87% 20.77% 20.88% 39.55% Peak 2% 44.95% 49.86% 61.13% 79.23% 79.12% 60.45% Physical/ pH NA  7.3  7.5  7.4  7.3  7.3   7.4 Chemical Properties Storage VaxArray ® μg/mL 541 446 733 528 823 1082 Potency

TABLE-US-00025 TABLE 23 Stability of B/Phuket Under Refrigerated Conditions Test Test Initial Parameters Method Units (CoA) 1 month 3 months 4 months 5 months 6 months Concentration BCA mg/mL  0.957  0.895  0.912  0.951  0.818  0.819 Purity SDS PAGE %  96.1%   >99%   97%   97%   93%   91% Purity SEC Peak 1% 84.51%   90.05% 91.98% 85.96% 85.76% 92.47% Peak 2% 15.49%    9.95%  8.02% 14.04% 14.24%  7.53% Physical/ pH NA  7.4  7.4  7.3  7.3  7.3  7.4 Chemical Properties Storage VaxArray ® μg/mL 910 945 888 952 812 924 Potency

[0242] Tables 18-23 illustrate that the purified free antigens exhibit different patterns of stability. For instance, some antigens like H1NI (A/Michigan) and H3N2 (A/Singapore) appeared stable after 6 months with no significant deviations in measurements (as is typically observed). However, the other antigens such as B/Colorado and H1N1 (A/Brisbane), and to a lesser extent H3N2 (A/Kansas) and B/Phuket, exhibited degradation, loss of trimer, or loss of other key properties under these conditions. For example, FIG. 40 is a SDS-PAGE analysis of purified B/Phuket after 1 month under refrigerated conditions. In FIG. 40, the degradant bands of lower molecular weight below the intact band at ˜60 kDA indicate that the purified B/Phuket antigen has degraded. As expected, the data in Tables 18-23 and FIG. 40 indicate that different proteins exhibit different stabilities under refrigerated conditions.

[0243] When the same purified antigens are conjugated to TMV, according to multiple embodiments and alternatives, the stability profile and storage potency changes. In some embodiments, an inventive method enhances a measure of stability of a conjugated compound comprising a protein and virus particle, and includes activating the virus particle and then mixing the virus particle and the antigen in a conjugation reaction to form a conjugate mixture, resulting in enhanced stability when the conjugated compound is placed in an unrefrigerated environment and after a time period of at least 42 days following a release date. An exemplary storage temperature is at least 20° C. The stability enhancement can be gauged by comparing the stability of the conjugate mixture to that of the antigen alone. A suitable measure is any one or more of antigen concentration, antigen integrity, or antigen potency. For example, when the measure of stability is antigen concentration, as measured by BCA or other appropriate methodology, a difference between concentration of the conjugated compound and concentration of the antigen alone of at least 10% is within the scope of present embodiments. Likewise, when the measure of stability is antigen integrity, as measured by SDS-PAGE, SEC-HPLC or other appropriate methodology, a difference between integrity of the conjugated compound and integrity of the antigen alone of at least 10% is within the scope of present embodiments. Likewise, when the measure of stability is antigen potency, as measured by antigen-antibody interaction based on ELISA results, or VaxArray®, surface plasmon resonance or other appropriate methodology, a difference between potency of the conjugated compound and potency of the antigen alone of at least 30% is within the scope of present embodiments.

[0244] Accordingly, the following tables provide the stability data of several monovalent formulations (at a TMV to antigen ratio of 1:1) at release and various times after filling into vials and stored under refrigerated conditions (2° to 8° C.):

TABLE-US-00026 TABLE 24 Stability of the H1N1 (A/Michigan) to TMV Conjugate Under Refrigerated Conditions Initial Test Parameters Test Method (CoA) 1 month 3 months 6 months 12 months Appearance Appearance Clear, Clear, Cloudy, Cloudy, Cloudy, Liquid Liquid Liquid Liquid Liquid Physical/Chemical pH    7.6  7.5  7.4  7.5  7.5 Properties Protein Concentration BCA    0.898  1.066  1.101  0.994  0.975 Purity SDS PAGE  >99.0  94.3  90.7  91.7  92.7 Storage Potency VaxArray ®   325 329 415 208 338 Average Size Radius DLS    85.8  98.0  64.2  97.8  99.8 Polydispersity 53.9    54.2  54.3  55.2  55.6

TABLE-US-00027 TABLE 25 Stability of the H3N2 (A/Singapore) to TMV Conjugate Under Refrigerated Conditions Test Initial Test Parameters Method (CoA) 1 month 3 months 6 months 12 months Appearance Appearance Clear, Clear, Cloudy, Cloudy, Cloudy, Liquid Liquid Liquid Liquid Liquid Physical/Chemical pH    7.6  7.4  7.4  7.5  7.4 Properties Protein Concentration BCA    0.828  1.025  0.947  0.957  0.947 Purity SDS PAGE  >99.0  94.9  92.8  92.9  92.8 Storage Potency VaxArray ®   363 496 468 500 468 Average Size Radius DLS    72.1  86.3  77.8  71.1  77.8 Polydispersity    43  52.6  38.7  35.4  38.7

TABLE-US-00028 TABLE 26 Stability of the B/Phuket to TMV Conjugate Under Refrigerated Conditions Test Initial Test Parameters Method (CoA) 1 month 3 months 6 months 12 months Appearance Appearance Cloudy, Cloudy, Cloudy, Cloudy, Cloudy, Liquid Liquid Liquid Liquid Liquid Physical/Chemical pH     7.6   7.5   7.4   7.5    7.5 Properties Protein BCA     0.874   1.010   0.995   0.940    0.903 Concentration Purity SDS PAGE  >99.0  97.1  95.4  95.1    94.6 Storage Potency VaxArray ®    333  393  442  477   397 Average Size DLS   1040.7 1094.1 1428.2 1284.9   497.8 Radius Polydispersity    47.5  42.1  49.6  53.3  ≥57.1

TABLE-US-00029 TABLE 27 Stability of the B/Colorado to TMV Conjugate Under Refrigerated Conditions Test Initial Test Parameters Method (CoA) 1 month 3 months 6 months 12 months Appearance Appearance Cloudy, Cloudy, Cloudy, Cloudy, Cloudy, Liquid Liquid Liquid Liquid Liquid Physical/Chemical pH     7.6   7.5   7.5     7.5   7.5 Properties Protein BCA     0.961   1.020   1.077     0.959   0.993 Concentration Purity SDS PAGE  >99.0  96.0  96.0    94.9   93.9 Storage Potency VaxArray ®    218  653  599    585   569 Average Size DLS   2377.8 1025.7 1337.6   1153.9   857.2 Radius Polydispersity    49.5  55.6  53.3  ≥57.1 ≥57.1

[0245] In addition, the following tables provide the stability data of several monovalent formulations (at a TMV to antigen ratio of 8:1) at release and various times after filling into vials and stored under refrigerated conditions (2° to 8° C.):

TABLE-US-00030 TABLE 28A Stability of the H1NI (A/Michigan) to TMV Conjugate Under Refrigerated Conditions Test Test Initial 1 3 Parameters Methods Units (CoA) month months Appearance Appearance NA Cloudy, Cloudy, Cloudy, Liquid Liquid Liquid Physical/ pH NA 7.4 7.4 7.4 Chemical Properties Protein BCA mg/mL 3.789 3.643 3.453 Con- centration Purity AUC % 97.8 95.6 99.3 Potency VaxArray ® μg/mL 462 392 485 Safety Endotoxin EU/mg 189 Average Size Dynamic Light nm 119.2 117.3 119.0 Radius Scattering

TABLE-US-00031 TABLE 28B Stability of the H1NI (A/Michigan) to TMV Conjugate Under Refrigerated Conditions Test Test Initial 6 12 Parameters Methods Units (CoA) months months Appearance Appearance NA Cloudy, Cloudy, Cloudy, Liquid liquid liquid Physical/ pH NA 7.4 7.5 7.0 Chemical Properties Protein BCA mg/mL 3.789 3.121 3.614 Con- centration Purity AUC % 97.8 99.7 98.9 Potency VaxArray ® μg/mL 462 388 498 Safety Endotoxin EU/mg 189 202 Average Size Dynamic Light nm 119.2 16.0 114.2 Radius Scattering

TABLE-US-00032 TABLE 29A Stability of the H3N2 (A/Singapore) to TMV Conjugate Under Refrigerated Conditions Test Test Initial Parameters Methods Units (CoA) 1 month 3 months Appearance Appearance NA Cloudy, Cloudy, Cloudy, Liquid Liquid Liquid Physical/ pH NA 7.4 7.4 7.4 Chemical Properties Protein BCA mg/mL 3.952 3.740 3.719 Concentration Purity AUC % 95.3 99.4 96.2 Potency VaxArray ® μg/mL 405 414 352 Safety Endotoxin EU/mg 271 Average Size Dynamic nm 95.8 109.1 91.4 Radius Light Scattering

TABLE-US-00033 TABLE 29B Stability of the H3N2 (A/Singapore) to TMV Conjugate Under Refrigerated Conditions Test Test Initial 6 12 Parameters Methods Units (CoA) months months Appearance Appearance NA Cloudy, Cloudy, Cloudy, Liquid liquid liquid Physical/ pH NA 7.4 7.4 7.1 Chemical Properties Protein BCA mg/mL 3.952 3.637 3.794 Concentration Purity AUC % 95.3 100.0 95.8 Potency VaxArray ® μg/mL 405 435 420 Safety Endotoxin EU/mg 271 275 Average Size Dynamic nm 95.8 91.2 94.3 Radius Light Scattering

TABLE-US-00034 TABLE 30A Stability of the B/Phuket to TMV Conjugate Under Refrigerated Conditions Test Test Initial 1 3 Parameters Methods Units (CoA) month months Appearance Appearance NA Cloudy, Cloudy, Cloudy, Liquid Liquid Liquid Physical/ pH NA 7.4 7.4 7.3 Chemical Properties Protein BCA mg/mL 3.681 3.307 3.545 Concentration Purity AUC % 90.4 97.6 96.5 Potency VaxArray ® μg/mL 385 339 408 Safety Endotoxin EU/mg 291 Average Size Dynamic nm 88.5 86.9 82.3 Radius Light Scattering

TABLE-US-00035 TABLE 30B Stability of the B/Phuket to TMV Conjugate Under Refrigerated Conditions Test Test Initial 6 12 Parameters Methods Units (CoA) months months Appearance Appearance NA Cloudy, Cloudy, Cloudy, Liquid liquid liquid Physical/ pH NA 7.4 7.5 7.4 Chemical Properties Protein BCA mg/mL 3.681 3.258 3.627 Concentration Purity AUC % 90.4 100.0 98.6 Potency VaxArray ® μg/mL 385 393 294 Safety Endotoxin EU/mg 291 188 Average Size Dynamic nm 88.5 76.4 80.2 Radius Light Scattering

TABLE-US-00036 TABLE 31A Stability of the B/Colorado to TMV Conjugate Under Refrigerated Conditions Test Test Initial 1 3 Parameters Methods Units (CoA) month months Appearance Appearance NA Cloudy, Cloudy, Cloudy, Liquid Liquid Liquid Physical/ pH NA 7.4 7.4 7.4 Chemical Properties Protein BCA mg/mL 4.081 3.879 3.507 Concentration Purity AUC % 96.8 98.1 97.6 Potency VaxArray ® μg/mL 514 475 305 Safety Endotoxin EU/mg 221 Average Size Dynamic nm 170.4 172.1 166.6 Radius Light Scattering

TABLE-US-00037 TABLE 31B Stability of the B/Colorado to TMV Conjugate Under Refrigerated Conditions Test Test Initial 6 12 Parameters Methods Units (CoA) months months Appearance Appearance NA Cloudy, Cloudy, Cloudy, Liquid liquid liquid Physical/ pH NA 7.4 7.5 7.1 Chemical Properties Protein BCA mg/mL 4.081 3.497 3.824 Concentration Purity AUC % 96.8 100.0 98.7 Potency VaxArray ® μg/mL 514 370 439 Safety Endotoxin EU/mg 221 161 Average Size Dynamic nm 170.4 162.7 155.1 Radius Light Scattering

[0246] The following tables provide the stability data of several other monovalent formulations (at a TMV to antigen ratio of 8:1) at release and various times after filling into vials, and stored under refrigerated conditions (2° to 8° C.) or under room temperature conditions (22° to 28° C.):

TABLE-US-00038 TABLE 32 Stability of the H1N1 (A/Brisbane) to TMV Conjugate Under Refrigerated Conditions Test Test Initial Parameters Methods (CoA) 1 month 3 months 6 months Appearance Appearance Cloudy, Cloudy, Cloudy, Cloudy, Liquid Liquid Liquid liquid Physical/ pH 7.2 7.5 7.2 7.3 Chemical Properties Protein BCA 4.8 3.8 3.8 3.9 Concentration mg/mL mg/mL mg/mL mg/mL Purity AUC 100% 100% 100% 100% Conjugation Conjugation Conjugation Conjugation Potency VaxArray ®   556 μg/mL   433 μg/mL   525 μg/mL   465 μg/mL Average Size Dynamic 196.5 nm 196.3 nm 211.3 nm 199.6 nm Radius Light Scattering Safety Endotoxin 1172 1235 1180 EU/mg EU/mg EU/mg Safety Bioburden TAMC ≤ 100 CFU/mL TCYM ≤ 100 CFU/mL

TABLE-US-00039 TABLE 33 Stability of the H1N1 (A/Brisbane) to TMV Conjugate Under Room Temperature Conditions Test Test Initial Parameters Methods (CoA) 1 month 3 months Appearance Appearance Cloudy, Cloudy, Cloudy, Liquid Liquid Liquid Physical/ pH 7.2 7.2 7.1 Chemical Determination Properties Protein BCA 4.8 4.6 5.9 Concentration mg/mL mg/mL mg/mL Purity AUC 100% 100% 100% Conjugation Conjugation Conjugation Potency VaxArray ®   556 μg/mL   399 μg/mL 259 μg/mL AverageSize Dynamic 196.5 nm 248.2 nm 274.9 nm Radius Light Scattering Safety Endotoxin 1172 748.0 EU/mg EU/mg Safety Bioburden TAMC ≤ 100 CFU/mL TCYM ≤ 100 CFU/mL

TABLE-US-00040 TABLE 34 Stability of the H3N2 (A/Kansas) to TMV Conjugate Under Refrigerated Conditions Test Initial Parameters Test Methods (CoA) 1 month 3 months 6 months Appearance Appearance Cloudy, Cloudy, Cloudy, Cloudy, Liquid Liquid Liquid Liquid Physical/ pH 7.3 7.5 7.3 7.3 Chemical Properties Protein BCA 5.8 6.4 6.4 6.6 Concentration mg/mL mg/mL mg/mL mg/mL Purity AUC 100% 100% 99% 99% Conjugation Conjugation Conjugation Conjugation Potency VaxArray ®   818 μg/mL   927 μg/mL  1025 μg/mL   846 μg/mL Average Size Dynamic 210.0 nm 212.8 nm 249.7 nm 213.6 nm Radius Light Scattering Safety Endotoxin 1108 1140 1063 EU/mg EU/mg EU/mg Safety Bioburden TAMC ≤ 100 CFU/mL TCYM ≤ 100 CFU/mL

TABLE-US-00041 TABLE 35 Stability of the H3N2 (A/Kansas) to TMV Conjugate Under Room Temperature Conditions Test Test Initial Parameters Methods (CoA) 1 month 3 months Appearance Appearance Cloudy, Cloudy, Cloudy, Liquid Liquid Liquid Physical/ pH 7.3 7.2 7.1 Chemical Properties Protein BCA 5.8 7.1 9.1 Concentration mg/mL mg/mL mg/mL Purity AUC 100% 100% 100% Conjugation Conjugation Conjugation Potency VaxArray ®   818 μg/mL   854 μg/mL   718 μg/mL Average Size Dynamic 210.0 nm 220.2 nm 339.9 nm Radius Light Scattering Safety Endotoxin 1108 831.1 EU/mg EU/mg Safety Bioburden TAMC ≤ 100 CFU/mL TCYM ≤ 100 CFU/mL

TABLE-US-00042 TABLE 36 Stability of the B/Phuket to TMV Conjugate Under Refrigerated Conditions Test Test Initial Parameters Methods (CoA) 1 month 3 months 6 months Appearance Appearance Cloudy, Cloudy, Cloudy, Cloudy, Liquid Liquid Liquid Liquid Physical/ pH 7.3 7.2 7.1 7.2 Chemical Properties Protein BCA 6.3 6.5 7.2 6.0 Concentration mg/mL mg/mL mg/mL mg/mL Purity AUC 95.3% 100% 98.6% 92.4% Conjugation Conjugation Conjugation Conjugation Potency VaxArray ®   623 μg/mL   684 μg/mL  1093 μg/mL   659 μg/mL Average Size Dynamic 201.5 nm 206.7 nm 201.0 nm 205.7 nm Radius Light Scattering Safety Endotoxin 698.6 1013 2198 974.7 EU/mg EU/mg EU/mg EU/mg Safety Bioburden TAMC ≤ 100 CFU/mL TCYM ≤ 100 CFU/mL

TABLE-US-00043 TABLE 37 Stability of the B/Phuket to TMV Conjugate Under Room Temperature Conditions Test Test Initial Parameters Methods (CoA) 1 month 3 months Appearance Appearance Cloudy, Cloudy, Cloudy, Liquid Liquid Liquid Physical/ pH 7.3 7.1 7.0 Chemical Properties Protein BCA 6.3 7.9 10.9 Concentration mg/mL mg/mL mg/mL Purity AUC 95.3% 100% 100% Conjugation Conjugation Conjugation Potency VaxArray ®   623 μg/mL   521 μg/mL   581 μg/mL Average Size Dynamic 201.5 nm 332.8 nm 358.8 nm Radius Light Scattering Safety Endotoxin 698.6 980.5 1195 EU/mg EU/mg EU/mg Safety Bioburden TAMC ≤ 100 CFU/mL TCYM ≤ 100 CFU/mL

TABLE-US-00044 TABLE 38 Stability of the B/Colorado to TMV Conjugate Under Refrigerated Conditions Test Test Initial Parameters Methods (CoA) 1 month 3 months 6 months Appearance Appearance Cloudy, Cloudy, Cloudy, Cloudy, Liquid Liquid Liquid Liquid Physical/ pH 7.3 7.2 7.2 7.2 Chemical Determination Properties Protein BCA 6.6 6.5 7.3 6.9 Concentration mg/mL mg/mL mg/mL mg/mL Purity AUC 99% 100% 100% 97% Conjugation Conjugation Conjugation Conjugation Potency VaxArray ®   784 μg/mL   697 μg/mL   782 μg/mL  1012 μg/mL Average Size Dynamic 189.3 nm 209.2 nm 196.8 nm 198.1 nm Radius Light Scattering Safety Endotoxin 899.5 1347 1832 802.6 EU/mg EU/mg EU/mg EU/mg Safety Bioburden TAMC ≤ 100 CFU/mL* TCYM ≤ 100 CFU/mL

TABLE-US-00045 TABLE 39 Stability of the B/Colorado to TMV Conjugate Under Room Temperature Conditions Test Test Initial Parameters Methods (CoA) 1 month 3 months Appearance Appearance Cloudy, Cloudy, Cloudy, Liquid Liquid Liquid Physical/ pH 7.3 7.2 7.0 Chemical Properties Protein BCA 6.6 9.1 10.4 Concentration mg/mL mg/mL mg/mL Purity AUC 99% 100% 99.3% Conjugation Conjugation Conjugation Potency VaxArray ®   784 μg/mL   407 μg/mL   480 μg/mL Average Size Dynamic 189.3 nm 299.9 nm 339.2 nm Radius Light Scattering Safety Endotoxin 899.5 756.6 1614 EU/mg EU/mg EU/mg Safety Bioburden TAMC ≤ 100 CFU/mL TCYM ≤ 100 CFU/mL

[0247] In each of the conjugates described in Tables 24-39, the purity, pH, protein concentration, and storage potency is maintained through at least six months of storage, and for others at least 12 months of storage, under refrigerated conditions. Further, the polydiversity is also consistent over this timeframe. Polydiversity refers to the variability of particle size in a complex product, and generally the lower the polydiversity than the better the product. Likewise, the purification and conjugation platform, according to multiple embodiments and alternatives, successfully maintained the stability and potency of a variety of antigens and utilized a variety of conjugation ratios, illustrating its versatility.

[0248] In addition to the monovalent formulations, the following quadrivalent conjugate produced according to multiple embodiments and alternatives at a 1:1 TMV to antigen ratio exhibits strong stability under both refrigerated (2° to 8° C.) and room temperature (22° to 28° C.) conditions:

TABLE-US-00046 TABLE 40A Stability of the Quadrivalent Conjugate (at a 1:1 Ratio) Under Refrigerated Conditions Test Test Initial Parameters Method (CoA) 1 month 3 months Appearance Appearance Cloudy, Cloudy, Cloudy, Liquid Liquid Liquid Physical/ pH 7.5 7.5 7.4 Chemical Properties Protein BCA 0.799 0.911 0.983 Concentration Identity VaxArray ® Antigen Antigen Antigen Binding Binding Binding Occurs Occurs Occurs Storage VaxArray ® A/Michigan: A/Michigan: A/Michigan: Potency NtK = 123 NtK = 155 NtK = 103 μg/ml μg/ml μg/ml a/Singapore: a/Singapore: a/Singapore: NtK = 106 NtK = 110 NtK = 106 μg/ml μg/ml μg/ml B/Phuket: B/Phuket: B/Phuket: NtK = 117 NtK = 140 NtK = 114 μg/ml μg/ml μg/ml B/Colorado: B/Colorado: B/Colorado: NtK = 78 NtK = 179 NtK = 134 μg/ml μg/ml μg/ml

TABLE-US-00047 TABLE 40B Stability of the Quadrivalent Conjugate (at a 1:1 Ratio) Under Refrigerated Conditions Test Test Parameters Method Initial (CoA) 6 months 12 months Appearance Appearance Cloudy, Cloudy, Cloud, Liquid Liquid Liquid Physical/ pH 7.5 7.5 7.5 Chemical Properties Protein BCA 0.799 0.953 0.952 Concentration Identity VaxArray ® Antigen Antigen Antigen Binding Binding Binding Occurs Occurs Occurs Storage VaxArray ® A/Michigan: A/Michigan: A/Michigan: Potency NtK = 123 NtK = 113 NtK = μg/ml μg/ml 142 μg/mL a/Singapore: a/Singapore: A/Singapore: NtK = 106 NtK = 101 NtK = μg/ml μg/ml 89 μg/mL B/Phuket: B/Phuket: B/Phuket: NtK = 117 NtK = 116 NtK = μg/ml μg/ml 95 μg/mL B/Colorado: B/Colorado: B/Colorado: NtK = 78 NtK = 134 NtK = μg/ml μg/ml 12 μg/mL

TABLE-US-00048 TABLE 41A Stability of the Quadrivalent Conjugate (at a 1:1 Ratio) Under Room Temperature Conditions Test Test Initial Parameters Method (CoA) 2 weeks 1 month 2 months Appearance Appearance Cloudy, Cloudy, Cloudy, Cloudy, Liquid Liquid Liquid Liquid Physical/ pH 7.5 7.5 7.5 7.4 Chemical Properties Protein BCA 0.799 0.959 0.909 1.098 Concentration Identity VaxArray ® Antigen Antigen Antigen Antigen Binding Binding Binding Binding Occurs Occurs Occurs Occurs Storage VaxArray ® A/Michigan: A/Michigan: A/Michigan: A/Michigan: Potency NtK = 123 NtK = 115 NtK = 126 NtK = 24 μg/ml μg/ml μg/ml μg/ml a/Singapore: a/Singapore: a/Singapore: a/Singapore: NtK = 106 NtK = 108 NtK = 173 NtK = 29 μg/ml μg/ml μg/ml μg/ml B/Phuket: B/Phuket: B/Phuket: B/Phuket: NtK = 117 NtK = 96 NtK = 84 NtK = 29 μg/ml μg/ml μg/ml μg/ml B/Colorado: B/Colorado: B/Colorado: B/Colorado: NtK = 78 NtK = 62 NtK = 124 NtK = 26 μg/ml μg/ml μg/ml μg/ml

TABLE-US-00049 TABLE 41B Stability of the Quadrivalent Conjugate (at a 1:1 Ratio) Under Room Temperature Conditions Test Test Initial Parameters Method (CoA) 3 months 6 months Appearance Appearance Cloudy, Liquid Cloudy, Liquid Cloudy, Liquid Physical/ pH 7.5 7.4 7.5 Chemical Properties Protein BCA 0.799 0.980 0.920 Concentration Identity VaxArray ® Antigen Binding Antigen Binding Antigen Binding Occurs Occurs Occurs Storage VaxArray ® A/Michigan: A/Michigan: A/Michigan: Potency NtK = 123 μg/ml NtK = 113 μg/ml NtK = 114 μg/ml a/Singapore: a/Singapore: a/Singapore: NtK = 106 μg/ml NtK = 115 μg/ml NtK = 80 μg/ml B/Phuket: B/Phuket: B/Phuket: NtK = 117 μg/ml NtK = 80 μg/ml NtK = 99 μg/ml B/Colorado: B/Colorado: B/Colorado: NtK = 78 μg/ml NtK = 139 μg/ml NtK = 120 μg/ml

[0249] In addition, the following quadrivalent conjugate, produced according to multiple embodiments and alternatives at a 8:1 TMV to antigen ratio, exhibited strong stability under both refrigerated (2° to 8° C.) and room temperature (22° to 28° C.) conditions. The results for this quadrivalent conjugate were obtained for four different HA conjugated to a modified TMV NtK carrier, which included the Influenza strains A/Michigan, Influenza A/Singapore, B/Colorado, and B/Phuket. Additional potency data on these and other conjugates and vaccine components are provided herein.

TABLE-US-00050 TABLE 42A Stability of the Quadrivalent Conjugate (at a 8:1 Ratio) Under Refrigerated Conditions Test Test Initial Parameters Methods Units (CoA) 1 month 3 months Appearance Appearance NA Cloudy, Cloudy, Cloudy, Liquid Liquid Liquid Physical/ PH NA 7.4 7.4 7.4 Chemical Determina- Properties tion Protein BCA mg/mL 3.825 3.759 3.321 Concentra- tion Safety Endotoxin EU/dose 625 Identity VaxArray ® NA Reactivity Reactivity Reactivity with with with antigen- antigen- antigen- specific specific specific antibody antibody antibody Potency VaxArray ® μg/mL H1: H1: H1: 75 μg/mL 92 μg/mL 86 μg/mL H3: H3: H3: 88 μg/mL 91 μg/mL 72 μg/mL B/Y: B/Y: B/Y: 87 μg/mL 81 μg/mL 92 μg/mL B/V: B/V: B/V: 123 105 88 μg/mL μg/mL μg/mL

TABLE-US-00051 TABLE 42B Stability of the Quadrivalent Conjugate (at a 8:1 Ratio) Under Refrigerated Conditions Test Test Initial 6 12 Parameters Methods Units (CoA) months months Appearance Appearance NA Cloudy, Cloudy, Cloudy, Liquid liquid liquid Physical/ pH NA 7.4 7.5 7.3 Chemical Determina- Properties tion Protein BCA mg/mL 3.825 3.393 3.678 Concentra- tion Safety Endotoxin EU/dose 625 406 Identity VaxArray ® NA Reactivity Reactivity Reactivity with with with antigen- antigen- antigen- specific specific specific antibody antibody antibody Potency VaxArray ® μg/mL H1: H1: H1: 75 μg/mL 92 μg/mL 116 μg/mL H3: H3: H3: 88 μg/mL 93 μg/mL 94 μg/mL B/Y: B/Y: B/Y: 87 μg/mL 88 μg/mL 76 μg/mL B/V: B/V: B/V: 123 150 122 μg/mL μg/mL μg/mL

TABLE-US-00052 TABLE 43A Stability of the Quadrivalent Conjugate (at a 8:1 Ratio) Under Room Temperature Conditions Test Test Initial Parameters Methods Units (CoA) 1 month 3 months Appearance Appearance NA Cloudy, Cloudy, Cloudy, Liquid Liquid Liquid Physical/ pH NA 7.4 7.4 7.4 Chemical Determina- Properties tion Protein BCA mg/mL 3.825 3.809 3.555 Concentra- tion Safety Endotoxin EU/dose 625 Identity VaxArray ® NA Reactivity Reactivity Reactivity with with with antigen- antigen- antigen- specific specific specific antibody antibody antibody Potency VaxArray ® μg/mL H1: H1: H1: 75 μg/mL 91 μg/mL 96 μg/mL H3: H3: H3: 88 μg/mL 85 μg/mL 60 μg/mL B/Y: B/Y: B/Y: 87 μg/mL 68 μg/mL 59 μg/mL B/V: B/V: B/V: 123 μg/mL 81 μg/mL 51 μg/mL

TABLE-US-00053 TABLE 43B Stability of the Quadrivalent Conjugate (at a 8:1 Ratio) Under Room Temperature Conditions Test Test Initial 6 12 Parameters Methods Units (CoA) months months Appearance Appearance NA Cloudy, Cloudy, Cloudy, Liquid liquid liquid Physical/ pH NA 7.4 7.5 7.3 Chemical Determina- Properties tion Protein BCA mg/mL 3.825 3.293 3.433 Concentra- tion Safety Endotoxin EU/dose 625 298 Identity VaxArray ® NA Reactivity Reactivity Reactivity with with with antigen- antigen- antigen- specific specific specific antibody antibody antibody Potency VaxArray ® μg/mL H1: H1: H1: 75 μg/mL 62 μg/mL 18 μg/mL H3: H3: H3: 88 μg/mL 78 μg/mL 63 μg/mL B/Y: B/Y: B/Y: 87 μg/mL 63 μg/mL 55 μg/mL B/V: B/V: B/V: 123 μg/mL 56 μg/mL 31 μg/mL

[0250] Furthermore, the potency of the quadrivalent conjugate described in Tables 42A, 42B, 43A and 43B is illustrated at FIGS. 41A & 41B, respectively. FIG. 41(A) is a graph of the QIV stability at refrigerated temperatures of 2-8° C. from Tables 42A and 42B (referred to as Routine Stability in the figure). FIG. 41(B) is a graph of QIV stability at a higher temperature range of 22-28° C. from Tables 43A and 43B (referred to as Accelerated Stability in the figure). As shown in FIGS. 41A and 41B, there was no statistically significant difference observed in the potency of the quadrivalent conjugate, produced according to multiple embodiments and alternatives at a 8:1 TMV to antigen ratio, under room temperature conditions or under refrigerated conditions.

[0251] Furthermore, the following quadrivalent conjugate produced, according to multiple embodiments and alternatives at a 8:1 TMV to antigen ratio, exhibited strong stability under both refrigerated (2° to 8° C.) and room temperature (22° to 28° C.) conditions. Unlike the quadrivalent conjugates discussed in Tables 42-43 above, the following quadrivalent utilized four different HA conjugated to a modified TMV NtK carrier, which included the following antigens: H1 (Brisbane), H3 (Kansas), B/Y (Phuket), B/V (Colorado).

TABLE-US-00054 TABLE 44 Stability of the Quadrivalent Conjugate (at a 8:1 Ratio) Under Refrigerated Conditions Test Test Initial Parameters Methods (CoA) 1 month 3 months 6 months Appearance Appearance Cloudy, Cloudy, Cloudy, Cloudy, Liquid Liquid Liquid liquid Physical/Chemical pH 7.4 7.3 7.2 7.4 Properties Protein BCA 4.7 mg/mL 5.1 mg/mL 5.4 mg/mL 4.4 mg/mL Concentration Safety Endotoxin 3590 2246 3837 2108 EU/dose EU/dose EU/dose EU/dose Potency VaxArray ® H1 H1 H1 H1 (Brisbane) = (Brisbane) = (Brisbane) = (Brisbane) = 93 μg/dose 113 μg/dose 78 μg/dose 87 μg/dose H3 (Kansas) = H3 (Kansas) = H3 (Kansas) = H3 (Kansas) = 77 μg/dose 69 μg/dose 62 μg/dose 64 μg/dose B/Y B/Y B/Y B/Y (Phuket) = (Phuket) = (Phuket) = (Phuket) = 84 μg/dose 105 μg/dose 101 μg/dose 91 μg/dose B/V B/V B/V B/V (Colorado) = (Colorado) = (Colorado) = (Colorado) = 75 μg/dose 66 μg/dose 91 μg/dose 85 μg/dose

TABLE-US-00055 TABLE 45 Stability of the Quadrivalent Conjugate (at a 8:1 Ratio) Under Room Temperature Conditions Test Test Parameters Methods Initial (CoA) 1 month 3 months Appearance Appearance Cloudy, Liquid Cloudy, Liquid Cloudy, Liquid Physical/Chemical pH 7.4 7.2 7.3 Properties Protein BCA 4.7 mg/mL 5.3 mg/mL 5.5 mg/mL Concentration Safety Endotoxin 3590 EU/dose 1864 EU/dose 2354 EU/dose Potency VaxArray ® H1 (Brisbane) = 93 H1 (Brisbane) = H1 (Brisbane) = μg/dose 79 μg/dose 54 μg/dose H3 (Kansas) = 77 H3 (Kansas) = H3 (Kansas) = μg/dose 52 μg/dose 52 μg/dose B/Y (Phuket) = 84 B/Y (Phuket) = B/Y (Phuket) = μg/dose 25 μg/dose 19 μg/dose B/V (Colorado) = 75 B/V (Colorado) = B/V (Colorado) = μg/dose 38 μg/dose 17 μg/dose

[0252] Tables 40 to 45, and FIGS. 41A and 41B, illustrate that the quadrivalent conjugate remains consistent and stable in terms of protein concentration, storage potency, pH and appearance under both refrigerated and room temperature conditions for at least three to twelve months. The data also indicates the purification and conjugation platforms, according to multiple embodiments and alternatives, successfully conjugated and increased the stability of a wide array of antigens and at various conjugation ratios.

[0253] Table 46 provides the percent change in the storage potency of the various antigens described in Tables 41A and 41B by comparing the initial potency to the storage potency at the particular time.

TABLE-US-00056 TABLE 46 Percent Change in Storage Potency from the Initial Potency via VaxArray ® 2 Weeks 1 month 2 months 3 months 6 months A/Michigan  93.50% 102.44% 19.51%  91.87%  92.68% A/Singapore 101.89% 163.21% 27.36% 108.49%  75.47% B/Phuket  82.05%  71.80% 24.79%  68.00%  84.62% B/Colorado  79.49% 158.97% 33.33% 178.00% 153.85%

[0254] Accordingly, as shown in Table 46, when the conjugate was placed in the unrefrigerated environment, the storage potency at the end of 30 days was at least 70% of the initial potency of the conjugate mixture within the first day post-conjugation. At the end of 90 days, the storage potency of the conjugate mixture stored in the unrefrigerated environment was at least 68% of the initial potency, and the storage potency of the conjugate mixture was at least 75% at the end of at least 180 days.

[0255] The following tables illustrate the stabilizing effect of the embodiments described herein by comparing the release conditions of the purified recombinant antigen with the same protein conjugated to TMV according to multiple embodiments and alternatives. Furthermore, stability after six months under refrigerated conditions (4° to 8° C.) was compared between the purified antigen and the same antigen conjugated to TMV by analyzing the protein concentration, potency, SDS-page purity, and PH, as follows:

TABLE-US-00057 TABLE 47 Comparison Between the Stability of Purified B/Colorado Antigen and the B/Colorado to TMV Conjugate Colorado Release Colorado 6 month Data Stability Free Conjugated Free Conjugated Assay Antigen (1:1) Antigen (1:1) BCA (mg/mL) 0.848 0.961 0.777 0.959 VaxArray ® 541 218 1082 585 Potency (μg/mL) SDS PAGE 99 >99.0 35 94.9 Purity (%) pH 7.3 7.6 7.4 7.5

TABLE-US-00058 TABLE 48 Comparison Between the Stability of Purified B/Phuket Antigen and the B/Phuket to TMV Conjugate Phuket Release Data Phuket 6 month Stability Free Conjugated Free Conjugated Assay Antigen (1:1) Antigen (1:1) BCA (mg/mL)  0.957  0.874  0.819  0.940 VaxArray ® 910 333 924 447 Potency (μg/mL) SDS PAGE Purity (%)  96.1 >99.0  91.0  95.1 pH  7.4  7.6  7.4  7.5

TABLE-US-00059 TABLE 49 Comparison Between the Stability of Purified H3N2 (A/Singapore) Antigen and the H3N2 (A/Singapore) to TMV Conjugate Singapore Release Singapore 6 month Data Stability Free Conjugated Free Conjugated Assay Antigen (1:1) Antigen (1:1) BCA (mg/mL) 0.855 0.828 0.795 0.957 VaxArray ® Potency 746 363 1089 500 (μg/mL) SDS PAGE Purity (%) >99 >99.0 >99 92.9 pH 7.4 7.6 7.3 7.5

TABLE-US-00060 TABLE 50 Comparison Between the Stability of Purified H1NI (A/Michigan) Antigen and the H1NI (A/Michigan) to TMV Conjugate Michigan Release Michigan 6 month Data Stability Free Conjugated Free Conjugated Assay Antigen (1:1) Antigen (1:1) BCA (mg/mL) 1.081 0.898 0.921 0.994 VaxArray ® Potency 93 325 1176 208 (μg/mL) SDS PAGE 97 >99.0 76 91.7 Purity (%) pH 7.4 7.6 7.3 7.5

[0256] Tables 46-50 illustrate the stability inducing properties of the purification and conjugation embodiments, most clearly for the B/Colorado, B/Phuket, and H1NI (A/Michigan) antigens in terms of purity measures. For the H3N2 (A/Singapore) and B/Colorado antigens, the stability of the conjugate is also shown in terms of antigen concentration. As shown in Tables 31-34, the purification and conjugation processes, according to multiple embodiments and alternatives, stabilized the antigen's physical properties, antigenic reactivity and other quantitative stability features.

[0257] Furthermore, Tables 41A to 45, and FIG. 41B, illustrate that the quadrivalent conjugate, produced according to multiple embodiments and alternatives, exhibits strong stability measures for at least six months, or twenty-four weeks, at room temperature storage (22° to 28° C.). Compared to conventional vaccines which exhibit an average stability of ˜5 weeks at room temperature (as discussed in the F. Coenen article mentioned above), the vaccines according to multiple embodiments and alternatives exhibit stability for at least 5× greater than conventional influenza vaccines and several times longer than purified antigens. Accordingly, the formulation and conjugation processes according to multiple embodiments and alternatives stabilize extremely unstable antigens—such as B/Colorado—and extend the stability of other antigens—such as H3N2 (A/Singapore), H1NI (A/Michigan), and B/Phuket—far beyond the stability limits of free-antigens and conventional vaccines.

Example 14(a) to 14(h)—Quadrivalent Influenza Vaccine Studies

[0258] In order to demonstrate the safety, efficacy and utility of the embodiments disclosed herein for immunogenicity and protection against seasonal virus challenge, several pre-clinical studies were conducted using a quadrivalent seasonal vaccine candidate (referred to for purposes of this example as “QIV vaccine”). The vaccine used in the studies was manufactured in accordance with multiple embodiments and alternatives disclosed herein. The subject QIV vaccine contained the following influenza HA antigens from the 2018/2019 North America seasonal influenza vaccine strains recommended by the World Health Organization, the Centers for Disease Control and Prevention, and the FDA's Vaccines and Related Biological Products Advisory Committee (VRBPAC), (A/Michigan/45/2015(H1N1)pdm09, A/Singapore/INFIMH-16-0019/2016 (H3N2), B/Phuket/3073/2013 (B Yamagata lineage), and B/Colorado/06/2017 (B Victoria lineage), conjugated to inactivated TMV NtK. In some embodiments, the four vaccine antigen conjugates, in a phosphate buffer solution with 0.01% thimerosal as a preservative (as a non-limiting example), are blended together to create a single injectable, quadrivalent vaccine formulation. As discussed in more detail below, these studies demonstrated that the embodiments disclosed herein augment the immunogenicity of recombinant hemagglutinin protein antigens. This was determined by various measures and analyses, including hemagglutination inhibition and neutralizing antibody titers. Likewise, the studies described in this example indicate the QIV seasonal vaccine is immunogenic, as it provided a level of protection in all mammalian disease models tested to date from challenge with viral strains homologous to the vaccine strain HA antigens. Except where otherwise noted, the content of the inactivated TMV NtK and HA intermediates incorporated into the conjugation reaction were equal (1:1) on a mg:mg basis (i.e. weight (wt)) for the studies. Subsequent studies with the QIV vaccine conjugated at an 8:1 TMV NtK:HA ratio (on a mg:mg basis) of the drug substance intermediates, as a non-limiting example, showed desirable humoral responses.

[0259] Table 51 provides an overview of the studies conducted on the QIV vaccine in accordance with the present example. “GLP” refers to Good Laboratory Practices, such as the CPMP Note for Guidance on Preclinical Pharmacological and Toxicological Testing of Vaccines (CPMP/SWP/465/95) and the World Health Organization Guidelines on Non-Clinical Evaluation of Vaccines (WHO Technical Report Series, No. 927), with the full contents of both being incorporated by reference herein. Additional discussion of various aspects of the studies follows the table.

TABLE-US-00061 TABLE 51 Overview of QIV Non-Clinical Studies for Example 14(a) to 14(h) Study Description Summary 14(a)-Evaluate Impact QIV vaccine induced a dose-dependent of Conjugation to humoral immune response TMV on (HAI titers). Immunogenicity, There were no adverse effects or injection and Evaluate site reactions detected. Durability of Response Non- GLP, on mice 14(b)-Evaluate Impact QIV vaccine induced a detectable of Conjugation to humoral immune response based TMV on on HAI and virus neutralization assays. Immunogenicity, Titers were first detectable on Day 21 and and Evaluate were highest on Day 90 post vaccination. Durability of There were no adverse effects or injection Response Non- site reactions detected. GLP, on mice 14(c)-Immunogenicity QIV vaccine induced a detectable Challenge, humoral immune response based on Non-GLP, on ferrets HAI and virus neutralization assays against the four antigens. The log reduction in viral titers observed in the QIV vaccinated ferrets challenged with A/Michigan/45/2015 (H1N1) was superior when compared to Fluzone ® and placebo. Equivalent log reduction in viral titers was observed in the QIV vaccinated ferrets and Fluzone ® when compared to placebo in animals challenged with A/Singapore/INFIMH-16-0019/2016 (H3N2) virus. These data indicate that the QIV is immunogenic and provides a level of protection to influenza infection in ferrets. There were no adverse effects or injection site reactions detected. 14(d)-Matrix Immunization of mice with monovalent Immunogenicity to vaccine conjugated to varying ratios Evaluate Desirable (1:1 to 24:1 TMV NtK:antigen) Formulation Ratio, of TMV NtK scaffold. Non-GLP, on mice Humoral immune responses indicated that a TMV NtK:HA ratio of 8:1 (mg:mg) was a desirable formulation ratio for QIV 14(e)-Pharmacokinetic: Study employed a monovalent vaccine Biodistribution Using conjugated to inactivated or live TMV 1:1 Ratio of Virus NtK carrier at a 1:1 ratio of TMV to Antigen, Non- NtK:antigen. GLP, on rabbits Distribution determined by quantitation of TMV NtK through a RT-qPCR methodology. Peak TMV NtK values were measured at injection site muscle 1 day post dosing and declined over the 7 day time course. Lymph nodes and spleen had relatively stable levels of TMV NtK vRNA genome copy numbers over the time course. Liver, heart, and testes had low levels near the limit of quantitation (LOQ) 1 day post-dosing that was below LOQ over the rest of the time-course. Vaccine values were below the LOQ in other tissues examined (blood, brain, lung, kidney and thymus). The biodistribution pattern of TMV NtK vRNA genome was consistent with both live and inactivated TMV NtK. No injection site reactions were detected. 14(f) Pharmacokinetic: Study employed a vaccine conjugated to Biodistribution Using inactivated or live TMV NtK carrier 8:1 Ratio of Virus at a 8:1 ratio of TMV NtK:HA antigen. to Antigen, Non- RT-qPCR results consistently show that GLP, on rabbits TMV vRNA copy number peaked on 1 day post-dosing in almost all organs except the injection site (muscle) which peaked at 3 days post-dosing and declined thereafeter. Biodistribution data also demonstrate a significant decline of residual vaccine after 1 day post-dosing in all of the organs tested except injection site (near or below the LOQ). Two immune organs (spleen and lymph nodes) had relatively stable levels of TMV vRNA genome copy numbers over the time course. 14(g) Safety: Intramuscular administration of two Repeat dose toxicity, doses of QIV (1:1 TMV NtK:Antigen GLP on rabbits ratio) at doses of 15 or 45 μg/HA once every four weeks was well tolerated No treatment-related or toxicologically significant clinical findings or inoculation site reactogenicity were observed. No treatment-related or toxicologically significant effects were observed for body weights, body weight changes, food consumption, body temperatures, ophthalmology, clinical chemistry, hematology, and organ weights. A robust immunogenic response was also seen in rabbits receiving the low and high dose of the vaccine which was detected in most animals on Study Days 42, 49, and 57. 14(h) Safety: Intramuscular administration of two Repeat dose toxicity, doses of QIV (45 μg/HA + 1.44 mg GLP on rabbits TMV NtK) or TMV NtK (1.44 mg) carrier once every four weeks was well tolerated No treatment-related or toxicologically significant clinical findings or inoculation site reactogenicity were observed. No treatment-related or toxicologically significant effects were observed for body weights, body weight changes, food consumption, body temperatures, ophthalmology, clinical chemistry, hematology, and organ weights. A robust immunogenic response was also seen in rabbits receiving the QIV vaccine which was detected in most animals on Study Days 42, 49, and 57.

[0260] As summarized in Table 52, an immunogenicity study in BALB/c mice, using monovalent and quadrivalent preparations respectively, was conducted to evaluate a desirable formulation ratio, and to monitor for injection site reactions and clinical signs of toxicity.

TABLE-US-00062 TABLE 52 Immunogenicity in BALB/c Mice - Example 14(a) Antigen Dose Vaccination Blood Collection Group N (μg) (Study Days) (Study Days) 1 5  .sub. 0.sup.a 0, 14 0, 14, 28 Monovalent .sup.b 2 5   1.5 0, 14 0, 14, 28 3 5 30 0, 14 0, 14, 28 Quadrivalent .sup.c 4 5   1.5 0, 14 0, 14, 28 5 5   7.5 0, 14 0, 14, 28 6 5 15 0, 14 0, 14, 28 7 5 30 0, 14 0, 14, 28 .sup.aPhosphate buffered saline only .sup.b Monovalent Vaccine: A/Singapore/INFIMH-16-0019/2016 (H3N2) .sup.c QIV Vaccine: A/Michigan/45/2015 (H1N1), A/Singapore/INFIMH-016-0019/2016 (H3N2), B/Colorado/06/2017 and B/Phuket/3073/2013

[0261] The study was conducted in the spirit of GLP regulations. BALB/c mice (N=5/group) were immunized on Day 0 and Day 14 with the respective vaccine preparations. The animals were bled to prepare sera for HAI antibody titer analysis prior to dosing on Day 0 and Day 14, with a final bleed collected on Day 28.

[0262] Table 53 (below) provides the number of animals that generated detectable HAI titers, the titer range from positive animals, and the geometric mean titer (GMT). The GMT value was calculated using the following formula set forth in Armitage and Berry, Statistical Methods in Medical Research, 2.sup.nd Edition (1987), pp. 31-33, the full contents of which are incorporated herein by reference:


GM={x.sub.1 x.sub.2 x.sub.3 . . . x.sub.n}.sup.1/n  (Formula 3)

[0263] As shown in Table 53, prior to the first vaccination (Day 0), HAI titers for sera samples from all study groups were below the limit of detection (<10). On Day 14 (prior to the second vaccination), antibody titers were below detectable levels in all groups except for the following: 1/5 mice in Group 3 (30 g dose of the monovalent vaccine) had an HAI titer of 10 to A/Singapore/INFIMH-16-0019/2016 (H3N2) and 2/5 mice in Group 7 (30 g dose of the quadrivalent vaccine) produced a titer of 10 to A/Singapore/INFIMH-16-0019/2016 (H3N2). In Table 37, HAI antibody titers were the reciprocal of the highest dilution of sera that inhibited hemagglutination by 4 HA units of virus.

TABLE-US-00063 TABLE 53 Immunogenicity in BALB/c Mice Results - Example 14(a) Antigen Day 14 Day 28 Group (μg) H1N1 .sup.a H3N2 .sup.b B/Vict .sup.c B/Yam .sup.d H1N1 H3N2 B/Vic B/Yam 1 None 0/5 0/5 0/5 0/5 0/5 0/5 0/5 0/5 Monovalent (H3N2) 2 1.5 0/5 0/5 0/5 0/5 0/5 1/5 0/5 0/5 (40; 40) 3 30 0/5 1/5 0/5 0/5 0/5 5/5 0/5 0/5 (10; 10) .sup.e (10-160; 40) Quadrivalent KBP-VP-V001 4 1.5 0/5 0/5 0/5 0/5 1/5 2/5 1/5 0/5 (20; 20) (20; 20) (20; 20) 5 7.5 0/5 0/5 0/5 0/5 5/5 4/5 1/5 0/5 (10-320; 53) (20-40; 28) (40; 40) 6 15 0/5 0/5 0/5 0/5 4/5 2/5 2/5 0/5 (20-160; 95) (20-40; 28) (10; 10) 7 30 0/5 2/5 0/5 0/5 5/5 5/5 2/5 0/5 (10; 10) (160-640; 279) (20-80; 52) (40; 40) .sup.a A/Michigan/45/2015 (H1N1pdm09); .sup.b A/Singapore/INFIMH-16-0019/2016 (H3N2); .sup.c B/Colorado/06/2017 (Vic) .sup.d B/Phuket/3073/2013 (Yam) .sup.e Parenthetical data are the titer range and geometric mean titer (GMT).

[0264] On day 14, HAI titers were detected against the H3N2 virus in the high (30 μg) dose only in the monovalent and QIV vaccine groups. On Day 28, there were dose-dependent increases in HAI titers against A/Michigan/45/2015 (H1N1) in the quadrivalent vaccine and A/Singapore/INFINH-16-0019/2016 (H3N2) in both the monovalent and quadrivalent vaccines. HAI titers were detectable at antigen doses as low as 1.5 μg in a few animals with the majority of animals generating antibody titers at 7.5 μg per HA antigen. No detectable titer was produced by the mice that had been vaccinated with the monovalent vaccine to the other three strains tested. While less pronounced, the QIV vaccine also induced HA titers in a subsect of mice against B/Colorado/06/2017. There were no detectable HAI titers generated against the Yamagata lineage B/Phuket/3073/2013 component.

[0265] In sum, based on HAI assay data, the monovalent formulation vaccine induced a detectable humoral immune response to the H3N2 virus. The QIV formulation induced a detectable humoral immune response against three of the four antigens. The induced immune response against influenza H1N1 and H3N2 antigens seen in mice vaccinated with the monovalent and QIV vaccine formulations was dose dependent. As shown in Table 37, the H1N1 GMT ranged from 20 to 279 (increasing with the increasing dose) and the H3N2 GMT ranged from 20 to 52. In addition, no adverse clinical signs or injection reactions were observed with the monovalent or QIV vaccinations.

[0266] As summarized in Table 54, an immunogenicity study in naïve mice (BALB/c mice) was conducted by assessing the immunogenicity of quadrivalent vaccines with and without TMV conjugation (1:1 ratio of TMV NtK:HA antigen), over time. The purpose of the study was to confirm the results from the prior study shown in Table 53, compare the immunogenicity of QIV to a vaccine wherein the same antigens are not conjugated to the TMV NtK carrier, and analyze the durability of the immune response over 90 days. The vaccines in the following table were conjugated at a 1:1 ratio of TMV NtK:HA antigen.

TABLE-US-00064 TABLE 54 QIV Vaccine Immunogenicity in BALM Mice - Example 14(b) Blood Cohort Treatment Vaccine Dose Vaccination Cohort Cohort collections Necropsy Group Group N Antigen (μg) (days) Number N (days) Day {grave over ( )}1 Vehicle 28 None 0, 14 1 9 −1,7 7 Control 2 9 −1, 14, 21 21  3 10  −1, 28, 42, 90 90   2 TMV NtK 28  60 μg TMV NtK 0, 14 1 9 −1,7 7 Control 2 9 −1, 14,21 21  3 10  −1, 28, 42, 90 90   3 HA Antigen 28   15 μg/HA 0, 14 1 9 −1,7 7   60 μg Total HA 2 9 −1, 14, 21 21  3 10  −1, 28, 42, 90 90   4 28  7.5 μg/HA 0, 14 1 9 −1,7 7   30 μg Total HA 2 9 −1, 14,21 21  3 10  −1, 28, 42, 90 90   5 28 3.75 μg/HA 0, 14 1 9 −1,7 7   15 μg Total HA 2 9 −1, 14, 21 21  3 10  −1, 28, 42, 90 90   6 Quadrivalent 28   15 μg/HA 0, 14 1 9 −1,7 7 Vaccine   60 μg Total HA 2 9 −1, 14, 21 21  (referred to   60 μg TMV NtK 3 10  −1, 28, 42, 90 90   7 in FIG. 42 as 28  7.5 μg/HA 0, 14 1 9 −1,7 7 “KBP-VP   30 μg Total HA 2 9 −1, 14,21 21  H1N1 and   30 μg TMV NtK 3 10  −1, 28, 42, 90 90   8 KBP-VP 28 3.75 μg/HA 0, 14 1 9 −1,7 7 H3N2”)   15 μg Total HA 2 9 −1, 14, 21 21    15 μg TMV NtK 3 10  −1, 28, 42, 90 90 

[0267] FIG. 42 shows the QIV vaccine induction of H1N1 and H3N2 hemagglutination inhibition (HA) titers in the mice over time. The data includes the geometric mean titer (GMT) of BALB/c mice dosed with 15 μg per HA of QIV vaccine. The GMT value was calculated using the following formula:


GM={x.sub.1 x.sub.2 x.sub.3 . . . x.sub.n}.sup.1/n  (Formula 3)

[0268] The mice with a titer value <10 were assigned a titer value of 5 for GMT calculation, in accordance with the previously mentioned Armitage and Berry.

[0269] As shown in FIG. 42, and Tables 55 and 56 below, HAI titers were only observed in animals receiving the QIV vaccine (referred to in FIG. 42 as “KBP-VP H1NI” and KBP-VP H3N2”) and only to the H1N1 and H3N3 antigens. There was no detectable immune response generated to the unconjugated antigens. Titers were below detectable levels until Day 21 against A/Michigan/45/2015 (H1N1) and A/Singapore/INFIMH-16-0019/2016 (H3N2). HAI titers remained detectable on Day 28 and Day 42 and were highest on Day 90. Moreover, the humoral response continued to increase for at least 90 days, a feature that conventional influenza vaccines are not known for. Since there was no detectable response with antigen alone, this test further supports the efficacy of conjugating the antigen to the TMV NtK carrier in producing an immune response.

TABLE-US-00065 TABLE 55 Percentage of Animals and HAI Geometric Mean Titers Generated Against Influenza A Antigens - Days 21 and 28 Day 21 Day 28 Antigen H1N1 .sup.a H3N2 .sup.b H1N1 H3N2 Group (μg) % GMT % GMT % GMT % GMT 1 None 0 0 0 0 0 0 0 0 2 TMV 0 0 0 0 0 0 0 0 NtK 3 .sup.c 15 0 0 0 0 0 0 0 0 4 .sup.c 7.5 0 0 0 0 0 0 0 0 5 .sup.c 3.75 0 0 0 0 0 0 0 0 6 .sup.d 15 33%  11.7 100%  29.4 30% 7.6 44% 10 7 .sup.d 7.5 10%  6.8 100%  25.2 30% 7.6 67% 12.6 8 .sup.d 3.75 0% 5 44% 10 22% 7.9 67% 10.3 .sup.a A/Michigan/45/2015 (H1N1) .sup.b A/Singapore/INFIMH-16-0019/2016 (H3N2) .sup.c Quadrivalent vaccine antigens (A/Michigan/45/2015 (H1N1pdm09); A/Singapore/INFIMH-16-0019/2016 (H3N2); B/Colorado/06/2017 (Vict); B/Phuket/3073/2013 (Yam) alone, not conjugated to TMV NtK Carrier .sup.d QIV Vaccine (A/Michigan/45/2015 (H1N1pdm09); A/Singapore/INFIMH-16-0019/2016 (H3N2); B/Colorado/06/2017 (Vict); B/Phuket/3073/2013 (Yam) conjugated 1:1 TMV NtK:HA Antigen

TABLE-US-00066 TABLE 56 Percentage of Animals and HAI Geometric Mean Titers Generated Against Influenza A Antigens - Days 42 and 90 Day 42 Day 90 Antigen H1N1 H3N2 H1N1 H3N2 Group (μg) % GMT % GMT % GMT % GMT 1 None 0 0 0 0 0 0 0 0 2 TMV 0 0 0 0 0 0 0 0 NtK 3 .sup.c 15 0 0 0 0 0 0 0 0 4 .sup.c 7.5 0 0 0 0 0 0 0 0 5 .sup.c 3.75 0 0 0 0 0 0 0 0 6 .sup.d 15 70% 15.2 80% 20 100% 183.8 100% 91.9 7 .sup.d 7.5 90% 21.4 70% 21.4  90% 137.2  60% 26.4 8 .sup.d 3.75 78% 15.9 67% 15.9  89% 117.6  78% 27.2 a A/Michigan/45/2015 (H1N1) b A/Singapore/INFIMH-16-0019/2016 (H3N2) c Quadrivalent vaccine antigens (A/Michigan/45/2015 (H1N1pdm09); A/Singapore/INFIMH-16-0019/2016 (H3N2); B/Colorado/06/2017 (Vict); B/Phuket/3073/2013 (Yam) alone, not conjugated to TMV NtK Carrier d QIV Vaccine (A/Michigan/45/2015 (H1N1pdm09); A/Singapore/INFIMH-16-0019/2016 (H3N2); B/Colorado/06/2017 (Vict); B/Phuket/3073/2013 (Yam) conjugated 1:1 TMV NtK:HA Antigen.

[0270] Like the HAI titers, virus neutralization (VN) titers were only observed in animals receiving the QIV vaccine. As presented in Table 57, VN titers against A/Michigan/45/2015 (H1N1) and A/Singapore/INFIMH-16-0019/2016 (H3N2) were also not observed until Day 21. VN titers remained detectable on Day 28 and Day 42 and were highest on Day 90.

TABLE-US-00067 TABLE 57 Neutralization Geometric Mean Antibody Titers Induced to Influenza A Antigens A/Singapore/ A/Michigan/45/2015 (H1N1) INFIMH-16-0019/2016 (H3N2) Dose μg/mL Dose μg/mL Day 30 15 7.5 Day 30 15 7.5 −1 50 50 50 −1 50 50 50 14 50 50 50 14 50 50 50 21 100 216 136 21 293.95 158.74 79.37 28 216 151.6 114.9 28 147 114.87 141.42 42 216 186.6 233.3 42 370.35 151.57 186.61 90 635 857.4 606.3 90 864.05 303.14 263.9

[0271] In the study outlined in Table 54, the mice were also monitored for clinical signs and injection site reactions. At necropsy, organ weights were measured and gross necropsy and histopathology on tissues was performed. There were no test article-related gross findings for any animals necropsied on Day 21 or Day 90.

[0272] For the animals euthanized on Day 21, a test article-related microscopic finding of minimal to mild mixed cell infiltration at the injection site was noted in 3 out of 9 animals in Group 2 (TMV NtK Control), 1 out of 9 animals in Group 3 (HA Alone), and 9 out of 9 animals in Group 6 (QIV). Minimal degeneration/regeneration of the myofiber of the injection site was also noted in 1 out of 9 animals examined from Group 6. No other microscopic test article related finding was noted for the mice euthanized on Day 21 or Day 90.

[0273] In conclusion, the QIV vaccine induced a detectable humoral immune response based on HAI and virus neutralization assays. The most robust response was to A/Michigan/45/2015 (H1N1) and A/Singapore/INFIMH-16-0019/2016 (H3N2). HAI and VN Titers were first detectable on Day 21 and were highest on Day 90. These data indicate that the QIV vaccine is safe and immunogenic in mice.

Immunogenicity and Challenge Study in Ferrets—Example 14(c)

[0274] An immunogenicity and challenge study using the QIV vaccine was also conducted in ferrets, which are accepted as the most representative animal model for influenza infection, to evaluate vaccine efficacy through reduction of viral loads post-challenge in relation to a licensed vaccine comparator. As shown in the study design illustrated in FIG. 43, blood for immunogenicity was taken on the following study days: −3, 7, 14, 21, 28, and 42. On study day 43, the animals were challenged and nasal wash for virus titer took place on study days 45 and 47.

[0275] Briefly, ferrets N=30 (15M/15F) per group were immunized with one of the following on Study Day 0 and 14:

[0276] 1. Placebo buffer as negative control (same quantity as Group 4)

[0277] 2. Fluzone® quadrivalent as a licensed comparator (15 μg per HA, 60 μg total HA) vaccine

[0278] 3. QIV at 15 μg per HA antigen (60 μg total HA antigen; 60 μg TMV NtK carrier)

[0279] 4. QIV at 45 μg per HA antigen (180 μg total HA)

[0280] Following each dose, injections sites and clinical signs were monitored daily for 7 consecutive days. As shown in FIG. 43, animals were bled at certain intervals for measurement of HAI and neutralization antibody titers. Animals from the individual dose groups were subdivided into two groups (N=12, 6M/6F) and challenged on Day 43 with 1×10.sup.6 plaque forming units (PFU) of either A/Michigan/45/2015 (H1N1)pdm09 or A/Singapore/INFIMH-16-0019/2016 (H3N2) (as non-limiting examples). Animals were monitored and nasal washes taken 2- and 4-days post-challenge to quantify residual influenza virus titers and assess viral clearance.

[0281] In ferrets dosed with either the 15 or 45 μg dose levels of QIV and Fluzone®, hemagglutination inhibition (HI) antibodies were detected against all four viruses tested [A/Michigan/45/2015 (H1N1)pdm09, A/Singapore/INFIMH-16-0019/2016 (H3N2), B/Colorado/06/2017 and B/Phuket/3073/2013]. The QIV vaccine elicited the strongest HI responses to B/Phuket, B/Colorado and A/Singapore/INFIMH-16-0019/2016 (H3N2). The weakest HI responses were against the A/Michigan/45/2015 (H1N1) virus. Virus Neutralization (VN) titers were detected against all viruses, with order of descending response: A/Michigan/45/2015 (H1N1)pdm09, A/Singapore/INFIMH-16-0019/2016 (H3N2), B/Phuket and B/Colorado/06/2017 showing lowest response.

[0282] Following influenza challenge with A/Michigan/45/2015 (H1N1)pdm09, as shown in FIG. 43, virus was detected in the nasal washes of all challenged ferrets on Day 2 and 4 post challenge. FIG. 44 illustrates the nasal wash titers following the H1N1 challenge (log 10 TCID.sub.50/mL), wherein the QIV vaccine is referred to as “QIV”. As shown in FIG. 44, there were no statistical differences in viral titers at Day 2 post-challenge, however, an increase in average body temperature of 1.0° C. was only observed in placebo controls. When compared to the placebo group on 4-day post-challenge, all three vaccine groups yielded statistically reduced viral titers with the QIV vaccine showing dose-dependent log reductions (2.3 and 1.9 log 10 TCID50/mL) that were statistically greater than Fluzone® (0.83 log 10 TCID50/mL). In FIG. 44, the p value is less than 0.05 for the Fluzone® value compared to the placebo, and the p value is less than 0.001 for the QIV value compared to Fluzone®. Also, the weight loss observed in Fluzone® and QIV vaccinated ferrets was comparable to placebo controls.

[0283] FIG. 45 illustrates the nasal wash titers following the H3N2 challenge (log 10 TCID.sub.50/mL), wherein the QIV vaccine is referred to as “QIV”. As shown in FIG. 45, following challenge with A/Singapore/INFIMH-16-0019 (H3N2), virus was detected in the nasal washes of all challenged ferrets on Days 2 and 4 post-challenge. When compared to the placebo group, a maximal log reduction in viral titers was observed on Day 2 in the QIV vaccine 45 μg dose group (1.0 log 10 TCID.sub.50/mL) which was statistically lower than placebo. QIV vaccine and Fluzone® yielded log reductions of 0.7 log 10 TCID50/mL and 0.5 log 10 TCID50/mL, respectively which were not statistically reduced compared to the placebo group (the p value is less than 0.05). As shown in FIG. 45, on Day 4 a comparable level of significant log reduction in viral titers was observed for all vaccinated groups, Fluzone® (1.3 log 10 TCID.sub.50/mL), QIV vaccine (15 μg dose, 1.4 log 10 TCID.sub.50/mL), and QIV vaccine (45 μg, 1.2 log 10 TCID.sub.50/mL). In addition, maximal average weight loss in the placebo and Fluzone® vaccinated groups was comparable at 3.1% and 2.6%, respectively. QIV immunized animals had less infection-induced maximal average weight loss of 2.1% (15 μg QIV) and 1.2% (45 μg QIV).

[0284] In regards to studies of immunogenic response, the QIV vaccine of the present example induced a detectable humoral immune response against the four antigens tested in HI and VN assays. A strong VN response corresponded with a reduction in nasal wash viral titers observed on Day 4 post challenge in vaccinated ferrets challenged with A/Michigan/45/2015 (H1N1)pdm09. The log reduction in viral titers observed on Day 4 in the QIV vaccinated ferrets was 1.1 to 1.5 log greater when compared to Fluzone®. Against A/Singapore/INFIMH-16-0019/2016 (H3N2), a strong HI response was observed in all three groups of vaccinated ferrets. In ferrets challenged with A/Singapore/INFINH-16-0019/2016 (H3N2), improved protection was observed for high dose group day 2 post infection and at day 4, with a similar log reduction in viral titers being observed in the QIV vaccinated ferrets and Fluzone®—both resulting in statistically lower viral titers than Placebo. These data indicate that the QIV vaccine is immunogenic and provides a level of protection to ferrets against challenge with H1N1 and H3N2 homologous virus.

Matrix Immunogenicity Study in Mice—Example 14(d)

[0285] The goal of this study was to evaluate the immunogenicity of the QIV vaccine at different conjugation ratios of TMV NtK to HA antigen. For this study, monovalent vaccine was formulated using A/Singapore/INFIMH-16-0019/2016 (H3N2). As shown in Table 58, a fixed dose of HA with increasing TMV was compared to a fixed dose of TMV with decreasing doses of HA (data not shown).

TABLE-US-00068 TABLE 58 Overview of Matrix Study Vaccine Antigen TMV Blood Treatment Dose NtK Vaccination Collections Group Group N (μg) Content (days) (Days) 1 Vehicle 5 0 0 0, 14 12, 28, Control 42 and 60 2 Monovalent 5 15 15 0, 14 12, 28, 1:1 42 and 60 3 Monovalent 5 15 60 0, 14 12, 28, 4:1 42 and 60 4 Monovalent 5 15 120 0, 14 12, 28, 8:1 42 and 60 5 Monovalent 5 15 240 0, 14 12, 28, 16:1 42 and 60 6 Monovalent 5 15 360 0, 14 12, 28, 24:1 42 and 60

[0286] Eight week old female BALB/c mice, five per group, were immunized with A/Singapore/INFIMH-16-0019/2016 (H3N2) monovalent influenza vaccine by subcutaneous route of administration with the indicated vaccine composition on Days 1 and 14. Mice were bled and serum was collected on Days 12, 28, 42 and terminal serum was collected on Day 60.

[0287] FIG. 46 illustrates the immunogenicity of the monovalent vaccine produced at varying ratios of TMV NtK: HA antigen. The relative IgG titers are expressed as ng IgG per mL of serum. As shown in FIG. 46, at day 60 (the end of the study), IgG titers induced by the monovalent vaccines prepared with increasing TMV-NtK:HA antigen conjugation ratios continued to show a significant improvement compared to the benchmark 1:1 ratio group.

[0288] Furthermore, in the HA antigen study wherein the dose of HA was fixed at 15 μg with increasing TMV NtK concentrations, the 8:1 and 16:1 vaccine formulations induced the highest mean response that was stable over time. This data support the use of the vaccines produced according to multiple embodiments and alternatives as an effective strategy to generate humoral immunity.

[0289] Accordingly, the immunogenicity studies in mice and the efficacy study in ferrets clearly demonstrate a significant increase in the generation of humoral immunity by the QIV vaccine of the present example. Additionally, immunogenicity was shown to be related to the conjugation of the HA antigen to the inactivated TMV NtK carrier. In mice, the humoral response continued to increase over 90 days. Moreover, immunization of the QIV vaccine was able to significantly reduce H1N1 and H3N2 viral loads following virus challenge that was greater than or equivalent to the conventional vaccine comparator, Fluzone®. In other words, vaccination with the QIV vaccine was able to reduce morbidity and virus levels caused by infection with homologous H1N1 and H3N2 influenza strains to the vaccine strain which were greater than or equal to the conventional vaccine comparator, Fluzone®. It is expected that vaccines manufactured in accordance with the present embodiments will show similar improved efficacy as the QIV vaccines of Example 14, across a wide range of antigens conjugated to a virus such as TMV to be used against many kinds of viruses.

Pharmacokinetic Studies—Examples 14(e) and 14 (f)

[0290] Pharmacokinetic studies were performed to evaluate the biodistribution of the QIV vaccine following a single intramuscular injection in male New Zealand White rabbits over an eight day period. The study used a RT-qPCR methodology that was developed and qualified to measure the TMV NtK viral RNA extracted from tissue or blood, and the study compared two different QIV vaccine formulations prepared with differing amounts of the TMV NtK carrier. The analyzed tissues included blood, skeletal muscle (injection site), lymph nodes, spleen, thymus, heart, liver, lung, kidney and tested.

[0291] FIG. 47 shows the comparative distribution of the TMV vRNA in tissues over time as measured by RT-qPCR following a single injection of two different QIV formulations, incorporating either 45 μg (1:1 formulation monovalent vaccine) or 1440 μg (8:1 formulation quadrivalent vaccine) of the TMV NtK carrier in a 0.5 mL dose (as non-limiting examples). FIG. 48 shows the biodistribution of the TMV vRNA in tissues by organ and dose group eight days after a single injection. In FIGS. 47 and 48, “LOQ” refers to the limit of quantitation and “LOD” refers to the limit of detection.

[0292] As expected, the two formulations showed a consistent distribution pattern. In FIGS. 47 and 48, the highest levels of the QIV were quantifiable from injection site skeletal muscle tissue through the study duration with amounts decreasing over time with both formulations. After skeletal muscle, the QIV was most abundant and detected throughout the study in spleen and draining lymph nodes, indicating that QIV traffics to these tissues post-immunization. Transient levels were detected in liver, heart, and testes at the 24 hour-post dosing time point and then below the LOQ with both formulations thereafter. The 8:1 formulation had low, transient signal detected in blood, lung, and thymus tissues 24 hours post-immunization that were below the limit of quantitation (LOQ) by Day 3 post-immunization, which is likely due to the 32-fold higher amounts of TMV NtK included in that formulation. No quantifiable QIV residuals were detected in brain or kidney tissue with either QIV formulation.

[0293] Accordingly, in all formulations the vaccine was observed to traffic from the injection site to immune organs and no accumulation was observed in non-target organs. Likewise, the TMV-specific Q-RT-PCR signal was observed to be dose dependent when measured at site of injection with rapid clearance from all non-target organs. Therefore, the detection in the immune system organs suggests a “depot” effect (i.e. sustained release of antigen at the site of injection) and prolonged stimulation of the immune system.

Toxicology Studies—Examples 14(g) and 14(h)

[0294] As previously noted in Table 51 and as described in Table 59 below, several toxicological studies were conducted according to GLP requirements to evaluate the potential toxicity of the QIV vaccine and to support the clinical use of the QIV vaccine for the prevention of disease caused by infection with influenza virus (as a non-limiting example). Two repeat dose toxicology studies in New Zealand White rabbits were performed using two formulations of QIV that differed in the content of the TMV NtK carrier conjugated with the purified recombinant HA antigens, according to multiple embodiments and alternatives. As described in more detail below, the studies revealed no treatment-related or toxicologically significant clinical findings which support the safe use of the TMV NtK:HA conjugate in human studies.

TABLE-US-00069 TABLE 59 Overview of Toxicology Study Route of Study Treatment Active Components Administration Species Example 14(g) Vehicle Control — Intramuscular New Zealand 1:1 QIV formulation White Rabbis QIV Low dose 60 μg HA Intramuscular New Zealand 15 μg/HA 60 μg TMV NtK White Rabbis QIV High Dose 180 ng HA Intramuscular New Zealand 45 μg/HA 180 μg TMV NtK White Rabbis Example 14(h) Vehicle Control — Intramuscular New Zealand 8:1 QIV formulation White Rabbis TMV NtK 1.44 mg TMV NtK Intramuscular New Zealand Control White Rabbis QIV High Dose 180 μg /HA Intramuscular New Zealand 45 μg/HA 1.44 mg TMV NtK White Rabbis

[0295] As shown in Table 59, two repeat dose GLP toxicity studies were performed in rabbits using different virus to antigen ratios. In some embodiments, the QIV vaccine was administered as a single intramuscular injection on an annual basis. To investigate the efficacy of this approach, a strategy of the number of human doses plus 1 (N+1) was used with the second dose administered 28 days following the first dose. Test articles included the intended human high dose of the QIV vaccine at each conjugation level of the TMV NtK carrier molecule (1:1 and 8:1 formulations) and the high dose of the TMV NtK carrier alone.

[0296] In the repeat dose toxicity study of the QIV vaccine at a 1:1 Ratio of TMV NtK carrier, HA Antigen, a seasonable influenza vaccine candidate was administered intramuscularly twice (once daily) on study days 1 and 29 to male and female New Zealand White rabbits, and the reversibility of effects after a 28-day recovery period was evaluated. As shown in Table 60, each group consisted of 10 rabbits/sex/group. On study day 30 (1 day after the last dose) five rabbits/sex/group were sacrificed and on study day 57 (28 days after the last dose) five rabbits/sex/group were sacrificed.

TABLE-US-00070 TABLE 60 Repeat Dose Toxicity Study Design, Example 14(g) - 1:1 QIV formulation No. of Rabbits Vaccine Vaccine Dose (M + F) Dose per TMV NtK carrier Necropsied on Group Treatment Antigen (μg) (μg) Day 31 Day 57 1 Control  0 0 5 + 5 5 + 5 (vehicle) 2 QIV Vaccine 15 60 5 + 5 5 + 5 3 QIV Vaccine 45 180 5 + 5 5 + 5

[0297] The test articles were administered by intramuscular (IM) injection on study Days 1 and 29. At each injection, animals in each group received 0.5 mL of the control article (Group 1), low dose vaccine (Group 2), or high dose vaccine (Group 3) using a 25-gauge needle attached to a plastic, 1-mL syringe (as non-limiting examples). The administration site was the relatively large muscle mass on the posterior aspect of the hind limb and was shaved or re-shaved (as appropriate). On each day of injection, the administration site was wiped with alcohol and allowed to dry thoroughly for a minimum of 10 minutes prior to dosing. The IM administration site alternated between hind limbs with the right hind limb receiving the first dose.

[0298] Five rabbits/sex/group were euthanized on Study Day 31 (two days after the last dose), while the remaining study animals (4/sex/group) continued to be observed and were euthanized on study day 57 (28 days after the last dose). Experimental endpoints included morbidity/mortality; physical examinations, clinical signs of toxicity, and inoculation site (Draize) reactogenicity scoring; body weights; body weight changes; food consumption; body temperatures; ophthalmology; clinical pathology (clinical chemistry, hematology, coagulation); organ weights; immunogenicity analysis; gross pathology at necropsy; and microscopic pathology.

[0299] All study rabbits survived to the scheduled necropsies. No treatment-related or toxicologically significant clinical findings or inoculation site reactogenicity were observed. No treatment-related or toxicologically significant effects were observed for body weights, body weight changes, food consumption, body temperatures, ophthalmology, clinical chemistry, hematology, and organ weights.

[0300] Fibrinogen levels were increased (p<0.05 or <0.01) in the vaccine treatment groups usually at two days post dose. The increase in fibrinogen in these groups was considered to be related to vaccine treatment, but was considered an expected (inflammatory) response following treatment with an immunogenic substance. Fibrinogen was no longer increased (p>0.05) at the end of the 28-day recovery period (reversible effect).

[0301] Mixed cell infiltration in the left sciatic nerve and injection site (side of last IM administration on Study Day 29) was a common microscopic finding seen in the intramuscularly dosed vaccine toxicology studies. This lesion was recoverable in the sciatic nerve, but not fully recovered in the injection site at the end of the 28-day recovery period. This lesion was not considered adverse, but was an anticipated finding consistent with the administration of an immunogenic material.

[0302] In conclusion, intramuscular administration of the QIV vaccine at doses of 15 or 45 μg once every four weeks for two injections (study days 1 and 29) was well tolerated. Any findings noted did not result in any adverse or limiting toxicity, were considered to be of minimal toxicological significance (e.g., noted in only one sex, reversible, transient, no alteration in organ function, etc.), and/or were anticipated findings (such as fibrinogen increases and mixed cell infiltration in the injection site or sciatic nerve) following administration of an immunogenic substance.

Repeat Dose Toxicity Study—Example 14(h)

[0303] In the repeat dose toxicity study of the QIV vaccine at a 8:1 Ratio of TMV NtK carrier, HA Antigen, a seasonable influenza vaccine candidate was also administered intramuscularly twice (once daily) on study days 1 and 29 to male and female New Zealand White rabbits, and the reversibility of effects after a 28-day recovery period was evaluated. As shown in Table 61, each group consisted of 8 rabbits/sex/group. On study day 30 (1 day after the last dose) five rabbits/sex/group were sacrificed and on study day 57 (28 days after the last dose) five rabbits/sex/group were sacrificed.

TABLE-US-00071 TABLE 61 Repeat Dose Toxicity Study Design, Example 14(h) - 1:1 QIV formulation Vaccine Vaccine No. of Rabbits Dose Dose (M + F) per Antigen TMV NtK Necropsied on Group Treatment (μg) carrier (μg) Day 31 Day 57 1 Control 0   0 4 + 4 4 + 4 (vehicle) 2 TMV NtK 0 1440 4 + 4 4 + 4 Control 3 QIV Vaccine 45  1440 4 + 4 4 + 4

[0304] The test articles were administered by IM injection on Study Days 1 and 29. At each injection, animals in each group received 0.5 mL of the control article (Group 1), low dose vaccine (Group 2), or high dose vaccine (Group 3) using a 25-gauge needle attached to a plastic, 1-mL syringe (as non-limiting examples). The administration site was the relatively large muscle mass on the posterior aspect of the hind limb and was shaved or re-shaved (as appropriate). On each day of injection, the administration site was wiped with alcohol and allowed to dry thoroughly for a minimum of 10 minutes prior to dosing. The IM administration site alternated between hind limbs with the right hind limb receiving the first dose.

[0305] Four rabbits/sex/group were euthanized on study day 31 (two days after the last dose), while the remaining study animals (4/sex/group) continued to be observed and were euthanized on study day 57 (28 days after the last dose). Experimental endpoints included morbidity/mortality; physical examinations, clinical signs of toxicity, and inoculation site (Draize) reactogenicity scoring; body weights; body weight changes; food consumption; body temperatures; ophthalmology; clinical pathology (clinical chemistry, hematology, coagulation); organ weights; immunogenicity analysis; gross pathology at necropsy; and microscopic pathology.

[0306] All study rabbits survived to the scheduled necropsies. No treatment-related or toxicologically significant clinical findings or inoculation site reactogenicity were observed. No treatment-related or toxicologically significant effects were observed for body weights, body weight changes, food consumption, body temperatures, ophthalmology, clinical chemistry, hematology, organ weights, and gross and microscopic pathology.

[0307] Fibrinogen levels were increased (p<0.01) in the treated groups usually at two days post dose. The increase in fibrinogen in these groups was considered to be related to treatment, but was considered an expected (inflammatory) response following treatment with immunogenic substances. Fibrinogen was no longer increased (p>0.05) during the recovery period (reversible effect).

[0308] Accordingly, IM administration of the QIV vaccine candidate, or inactivated TMV NtK at doses of either 45 μg of each HA antigen (180 μg total HA+180 μg TMV NtK) or 1440 μg of each HA antigen, respectively, once every four weeks for two injections (Study Days 1 and 29) was well tolerated. The findings in these GLP toxicological studies did not result in any adverse or limiting toxicity, were considered to be of minimal toxicological significance (e.g., noted in only one sex, reversible, transient, no alteration in organ function, etc.), and/or were anticipated findings (such as fibrinogen increases) following administration of immunogenic substances. No significant toxicological issues were noted with either 1:1 or 8:1 (TMV NtK:HA antigen) formulations of the QIV vaccines in these studies.

[0309] Furthermore, during the two GLP toxicological studies (Examples 14(g) and 14(h)), a robust antigen-specific immunogenic response was also measured based on ELISA, HAI, and neutralization antibody titers in rabbits receiving the low and high dose of the QIV vaccine test articles. FIG. 49 illustrates the total anti-HA IgG ELISA analysis from rabbit serum samples following QIV vaccine immunizations on Day 1 and Day 29. As shown in FIG. 49, the immunologic response peaked after the second administration of the QIV vaccine, as expected from the immunization of naïve animals. Anti-influenza titers to all four influenza antigens (Michigan H1N1, Singapore H3N2, B/Colorado, and B/Phuket as non-limiting examples) were measured in serum samples after the day 29 injection. Moreover, the mean anti-influenza titers up to 90-fold higher (than the controls) were detected on study days 42, 49, and 57.

[0310] As shown in Table 62 below, HAI titers were detected in most animals on study days 42, 49, and 57 against A/Michigan/45/2015(H1N1), A/Singapore/INFIMH-16-0019/2019 (H3N2) and B/Colorado/06/2017 viruses (as non-limiting examples). In contrast, HAI titers against the B/Phuket/3073/2013 virus (as a non-limiting example) were generally seen in 4 or fewer animals on Study Days 42, 49, and 57

TABLE-US-00072 TABLE 62 Percentage of Animals with Detectable HAI Titers on Study Day 49 of the GLP Toxicology Studies Percentage of animals with detectable HI titer at Study Day 49 (HI Titer Response Range) A/Michigan H/Singapore B/Colorado B/Phuket Dose (H1N1) (H3N2) (B/Victoria) (B/Yamagata) Placebo 0  0% 0% 0% 0% [from the 1:1 ratio study] Placebo 0  0% 0% 0% 0% [from the 8:1 ratio study] TMV NtK 1440 μg  0% 0% 0% 0% [from the 8:1 ratio study] QIV 15 μg/HA 100% 80%  50%  30%  [1:1 TMV to (80-640) (20-160) (20-80) (10-20) HA Ratio] 45 μg/HA 100% 100%  70%  30%  (80-640) (20-160) (20-80) (20-40) QIV 45 μg/HA 100% 100%  38%  100%  [8:1 TMV to (40-320) (10-800) (10)  (10-160) HA Ratio]

[0311] FIG. 50 illustrates the measurement of microneutralization GMT titers throughout the GLP Toxicology Study using the 8:1 QIV Formulation for each virus in the QIV vaccine. Also, Table 63 below, provides the percentage of animals with detectable microneutralization titers on study day 49 of both GLP Toxicology Studies (i.e. both the 1:1 and 8:1 QIV formulations). As shown in FIG. 50 and Table 63, neutralization titers against these same four viruses (as non-limiting examples) were also consistently measured in rabbits receiving the low and high dose of the vaccine on Study Days 42, 49, and 57, with the highest titers seen against the A/Michigan/45/2015 (H1N1)pdm09 and A/Singapore/INFIMH-16-0019/2019 (H3N2) viruses

TABLE-US-00073 TABLE 63 Percentage of Animals with Detectable Microneutralization Titers on Study Day 49 of the GLP Toxicology Studies Percentage of Animals with Measurable Titer A/Michigan H1N1 A/Singapore H3N2 B/Colorado B/Phuket Study QIV QIV QIV QIV QIV QIV QIV QIV QIV QIV QIV QIV Time 1:1 1:1 8:1 1:1 1:1 8:1 1:1 1:1 8:1 1:1 1:1 8:1 Point 15 μg 45 μg 45 μg 15 μg 45 μg 45 μg 15 μg 45 μg 45 μg 15 μg 45 μg 45 μg −2  0%  0%  0%  0%  0%  0%  0%  0%  0%  0%  0%  0% 14  0%  0%  0% 20% 40%  0%  0%  0%  0%  0%  0%  0% 21 35% 30% 12.5%   60% 90% 12.5%    5%  5%  0%  0%  0%  0% 31 90% 75% 75% 55% 85% 12.5%    0%  0%  0%  0%  0%  0% 42 100%  100%  100%  100%  100%  88% 20% 56% 12.5%   100%  78% 100%  49 100%  100%  100%  100%  100%  100%  50% 75% 12.5%   80% 63% 100%  57 100%  100%  100%  80% 100%  100%   0% 30%  0% 40% 50% 100% 

[0312] Accordingly, the studies discussed in this Example demonstrate that the QIV vaccine consistently produces a robust immune response following intramuscular administration across three species (mice, ferrets and rabbits). The primary measure of immunity was the generation of HAI antibody titers, the recognized serum biomarker of protection for influenza infection. In immunologically naïve animals, the humoral immune response was predominantly detected following a second (booster) immunization. Immunogenicity to the vaccine hemagglutinin antigens was dependent upon conjugation to the TMV NtK carrier. The QIV vaccine prepared at a ratio of 8:1 TMV NtK carrier-to-recombinant HA antigen was shown to be desirable. In a disease challenge model, immunization of ferrets with QIV significantly reduced viral loads in animals subsequently challenged with homologous H1N1 and H3N2 strains as assessed from nasal wash samples. This reduction in viral load was greater than or equal to that of a licensed comparator. Immunization also ameliorated clinical signs of morbidity associated with the challenge viruses.

[0313] The studies also investigated the distribution and safety of the QIV vaccine. There has been no detection of edema or injection site reactions in any of the studies. Biodistribution studies (measuring RNA from the TMV NtK carrier) with QIV found that, outside of the injection site muscle, QIV was measured in the spleen and lymph nodes at all time points tested indicating that TMV viral RNA was relatively stable or decreased slowly in these organs which provides a potential mechanism of action and presentation of the antigens to the immune system. In repeat dose toxicity studies, the only finding was a reversible elevation in fibrinogen levels from the clinical chemistry profile in the treated groups usually at two days post-dosing, an expected finding for an immunological substance. No other treatment-related or toxicologically significant effects were observed for body weights, body weight changes, food consumption, body temperatures, ophthalmology, clinical chemistry, hematology, organ weights, and gross and microscopic pathology.

[0314] In conclusion, the data support the advancement of the TMV NtK conjugate to human clinical studies and offers clear advantages over currently licensed influenza vaccines. Since no toxicologically significant findings have been observed with the QIV vaccine, the probability is increased that no such events will be observed for any other antigen(s), purified in accordance with the antigen platform, that is conjugated to the TMV NtK carrier described herein. Accordingly, it is expected that other antigens conjugated to the inactive TMV NtK will have similar biodistribution and toxicology profiles, and thus are suitable for use in humans.

Example 15(a) to (c)—Coronavirus Vaccine Candidate: RBD-Fc 121 (SARS-2) Conjugated to TMV

[0315] A Covid-19 vaccine was produced by forming an antigen through the expression of a recombinant version of the RBD SARS-2 spike protein fused to the Fc domain of a human IgG1 in Nicotiana benthemiana (Nb) plants (as a non-limiting example). Before conjugation, the formed antigen was then purified according to an antigen purification platform as described herein, in accordance with multiple embodiments and alternatives, and the TMV virus particles were purified and inactivated according to a virus purification platform described herein, in accordance with multiple embodiments and alternatives. The purified recombinant RBD-Fc antigen was then conjugated to the purified and inactivated TMV virus particle in accordance with the teachings of multiple embodiments and alternatives herein. Upon delivery to a mammalian subject (e.g., human or animal), the RBD-Fc to TMV conjugate presents the SARS-2 spike glycoprotein RBD fused to the human IgG1 Fc domain via the chemical conjugation to the TMV virus particles. As discussed in more detail below, the presentation of the RBD-Fc fusion in this embodiment has been demonstrated to enhance Th1 and Th2 responses in all mammalian disease models tested to date.

[0316] For this example, the antigen for the Covid-19 vaccine was selected by targeting the RBD domain of the SARS-2 spike glycoprotein because it serves as the binding site for the human ACE-2 receptor and the binding site overlaps with characterized neutralizing antibodies. The SARS-2 spike glycoprotein is found in the S1 subunit at the amino acids numbered approximately 320 to 520. In FIG. 51(A), the SARS-2 spike trimer is shown in space-filling model with RBD circled in lateral and vertical views. FIG. 51(B) shows the RBD domain fused to a human 171 allotype IgG1 Fc domain, expressed and purified from plants according to multiple embodiments and alternatives.

[0317] Several considerations went into selecting SARS-2 RBD as a fusion partner for developing the RBD-Fc antigen described in the present example and the next example. SARS-2 RBD is a binding site for neutralizing antibodies. Also, as discussed below, CR 3022 is a human mAb isolated from a SARS patient that binds a domain in the SARS-2 RBD domain. CR 3022 binding can neutralize both SARS-1 and SARS-2 CoV. The SARS-2 RBD also presents the ACE-2 (angiotensin II) binding domain.

[0318] In accordance with the method for the present example, multigenic constructs were designed and built to contain genes encoding the proteins necessary to synthesize a Covid-19 antigen targeting the RBD domain of SARS-2. In the present example, the following antigen sequence (collectively referred to herein as the “RBD-Fc 121 Construct”) was used for the synthesis of a Covid-19 antigen:

TABLE-US-00074 1. “(SEQ ID NO: 1)” Signal Peptide: MGKMASLFATFLVVLVSLSLASESSA 2. “(SEQ ID NO: 2)” SARS-2 virus Spike amino acids numbered 331-632: NITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCY GVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFT GCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPC NGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKS TNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQ TLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLT PT 3. “(SEQ ID NO: 3”) Fc Hinge: VEPKSCDKTHTCPPCP 4. “(SEQ ID NO: 4”) IgG1 171 allotype Fc: APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA PIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE ALHNHYTQKSLSLSPG

[0319] Illustratively, and without limitation, FIG. 52 shows an assembled TRBO expression plasmid for a SARS-CoV2 RBD-Fc fusion peptide (i.e., antigen) for production in Nb plants. Successful infiltration and plant incubation were followed by extraction and purification of the antigen as described herein. As illustrated and discussed further herein, a fusion peptide was formed having a first peptide which comprises a receptor binding domain (RBD) of a pathogen (specifically, a coronavirus and namely the SARS-CoV-2 spike (S) glycoprotein RBD), fused to a second peptide which comprises a fragment crystallizable (Fc) region of an antibody (containing a sequence of amino acids as set forth in SEQ ID NO: 4, human IgG1 Fc domain), and a hinge portion linking the first peptide and second peptide (containing a sequence of amino acids as set forth in SEQ ID NO: 3). In Example 15, the RBD contained a sequence of amino acids as set forth in SEQ ID NO: 2, and in Example 17, the RBD contained a sequence of amino acids as set forth in SEQ ID NO: 8. It will be noted that the reference to codons in the plasmid of FIG. 52 includes both the RBD and Fc region as well as the hinge portion. The sequences encoding the RBD-Fc antigen were optimized for efficient plant expression. In accordance with the plasmid design, donor plasmids containing the referenced nucleic acid sequences for the fusion peptide were synthesized. The antigen donor plasmid and TRBO expression plasmid were digested using suitable restriction enzymes. The antigen was ligated into the TRBO expression plasmid and subsequent colonies were screened to confirm clones. Assembled expression plasmids (FIG. 52) from successful ligations were amplified in E. coli and DNA purified. The vector DNA-confirmed clones of the antigen in the TRBO expression plasmid were used to transform Agrobacterium tumefaciens in preparation for infiltration into Nb plants. Individual colonies were transferred in a sterile manner, incubated, and 20% glycerol stocks from culture were produced and retained as antigen Master Cell Banks. As further illustrated in FIG. 52, the exemplary construct included a cauliflower mosaic virus (CaMV) 35S promoter, which is a DNA dependent RNA promoter set to transcribe the TMV expression vector with an accurate 5′ end. In addition, the TMV replicase is composed of the 126 kDa and 183 kDa replication associated proteins. In FIG. 52, the “30k” refers to a movement protein produced from a sub-genomic promoter in the 3′ end of the 183 kDa protein coding region. In the exemplary construct, the antigen gene is transcribed from a sub-genomic promoter in the 3′ end of the 30 kDa protein coding region and the 3′ untranslated region has a ribozyme to insure termination of the transcript near the authentic 3′ end. Furthermore, there is an E. coli origin for replication and border regions for the TI plasmid and other elements for efficient replication in Agrobacterium and insertion into plant cells.

[0320] Accordingly, a plasmid providing a construct for an antigen which is conjugable with a virus can be manufactured in accordance with multiple embodiments and alternatives herein. Such a construct may comprise first and second coding regions that encode a fusion peptide. In non-limiting fashion, the first coding region contains a nucleic acid sequence encoding an amino acid sequence as set forth in SEQ ID NO: 2 above, or by way of further example SEQ ID NO: 8 below. The first peptide may comprise or substantially comprise a receptor binding domain of a pathogen, such as a virus, non-limiting examples of which include coronaviruses and influenza viruses as discussed further herein. Additionally, and again in similar non-limiting fashion, the second coding region contains a nucleic acid sequence encoding an amino acid sequence as set forth in SEQ ID NO: 4 above. The second peptide may be a fragment crystallizable (Fc) region of an antibody capable of binding to a Fc receptor. In some embodiments, the first peptide and the second peptide are linked by a hinge portion coded by a third coding region. The third coding region may contain a nucleic acid sequence encoding an amino acid sequence as set forth in SEQ ID NO: 3 above. In some embodiments, the hinge portion is a portion of the Fc region. In some embodiments, one or more nucleic acid sequences identified herein will be part of a heterologous expression system.

Plant Expression, Purification, and Characterization—Example 15(a)

[0321] In the present example, an RBD-FC 121 fusion peptide (hereafter, referred to in this example as “RBD-Fc 121 antigen”) was expressed in tobacco plants, harvested then purified. Expression occurred in naïve wild-type Nb plants, which were infected with an expression vector (such as the vector shown in FIG. 52 as a non-limiting example) for protein replication of the RBD-Fc 121 antigen, in accordance with multiple embodiments and alternatives herein, with growth and incubation of the plants occurring in a contained and controlled indoor environment. Purification of the RBD Fc-121 antigen was performed according to an antigen purification platform described herein (for example, as illustrated at Table 2 and FIG. 8), with the multi-modal ceramic hydroxyapatite (CHT) chromatography column step omitted for this particular example. Accordingly, for the present example, FIG. 51(B) shows the RBD domain fused to the human 171 allotype IgG1 Fc domain, expressed and purified from plants according to multiple embodiments and alternatives. The identify of such an exemplary, pre-conjugation, SARS-COV2 RBD-Fc purified antigen intermediate can be confirmed by MALDI-TOF mass spectrometry. In some embodiments, physicochemical properties of the antigen intermediate include a pH between about 7.0±0.4, an osmolality between about 250-350 mOsm/kg H.sub.2O, a bioburden less than 10 CFU/mL, and residual host cell proteins less than 100 ng/mg. The content of an inactivated TMV NtK intermediate and a RBD-Fc intermediate will be incorporated into a conjugation reaction.

[0322] As shown in FIGS. 54-55, an antigen purification platform according to multiple embodiments and alternatives successfully purified the RBD-Fc 121 antigen resulting in high yields (>400 mg of RBD-Fc protein) with pure, stable antigen as RBD-Fc monomer in a manner that is compliant with GLP regulations. FIG. 53, taken from the conclusion of the purification platform applied to this antigen, contains a SDS page gel indicating purity for the RBD-Fc 121 antigen, wherein lane 1 shows the marker and lane 2 shows the purified RBD-Fc 121 protein. As shown by the clear and visible bands in lane 2 of FIG. 53, the RBD-Fc 121 antigen product is highly pure. In addition, the protein migration shown in FIG. 53 is consistent with the SEC-HPLC report of the free, purified RBD-Fc 121 shown in FIG. 53. In FIG. 54, the SEC-HPLC report of the free RBD-Fc 121 antigen produced the signal data detailed in Table 64 below.

TABLE-US-00075 TABLE 64 SEC-HPLC Data of free, purified RBD-Fc 121 Antigen RT Width Peak [min] [min] Area Height Area % Symmetry 13.428 0.64  327.78  7.19 11.18 0.71 15.964 0.57 2605.08 68.46 88.82 0.68

[0323] Table 64 and FIG. 54 illustrate that >90% of the purified RBD-Fc 121 antigen is in monomeric form. Likewise, low impurities were present in the batches at less than 0.442 EU/mg. Therefore, the RBD-Fc 121 antigen was successfully and sufficiently purified consistent with GLP.

[0324] The stability of the RBD-Fc 121 antigen is reflected in FIG. 55 and Table 65 (below). FIG. 55 contains a SDS Page gel of the purified RBD-Fc 121 antigen 5 weeks after purification. In FIG. 55, the lanes include: lane 1—marker, lane 2—blank, lane 3—blank, and lanes 4-6—RBD-Fc 121 antigen 5 weeks after purification. The clear and visible bands in FIG. 55 indicate the purified RBD-Fc 121 antigen is highly stable. In addition, as shown in Table 49 below, the purified RBD-Fc 121 antigen maintained its potency for at least 5 weeks following purification based on ELISA results.

TABLE-US-00076 TABLE 65 Potency of Purified RBD-Fc 121 Antigen as Measured by ELISA Test Parameter Test Method units 2 week 3 week 4 week 5 week Potency ELISA μg/mL 7010 8188 7096 5178

Conjugation and Preparation—Example 15(a)

[0325] The purified RBD-Fc 121 antigen was then conjugated with a TMV NtK carrier. The TMV NtK virions with surface lysine residues for efficient conjugation were manufactured in Nb plants (again, as a non-limiting example). The TMV NtK carrier was purified according to a virus purification platform described herein (for example, as illustrated at Table 1 and FIG. 1). In accordance with multiple embodiments and alternatives herein, following purification the TMV NtK was subject to micron filtration (e.g. 0.45) and treated with UV inactivation (as discussed in Example 8 herein).

[0326] The purified and inactive TMV NtK was then chemically conjugated to the RBD-Fc 121 antigen to produce a Covid-19 vaccine, in accordance with multiple embodiments and alternatives herein (for example, as illustrated at Table 3). As shown in FIG. 56, an exemplary conjugation procedure may include at least the following steps:

[0327] Purified RBD-Fc 121 antigen was diafiltered into a 50 mM MES buffered salt (50 mM NaCl) solution, concentrated to a target concentration appropriate for conjugation, and subjected to 0.2 micron filtration.

[0328] Purified RBD-Fc 121 antigen was conjugated to the purified TMV NtK particles using EDC and Sulfo-NHS chemistries within a 1-hour mixing reaction.

[0329] As previously indicated, conjugation may occur at a range of TMV NtK:antigen (mg:mg) ratios, including without limitation 8:1, 4:1, and 1:1.

[0330] Now returning to the present example, the RBD-Fc 121 antigen and TMV NtK underwent a conjugation reaction performed at a pH of about 6.0, in EDC (4 mM) and Sulfo NHS (5 mM). In this regard, the pH of the conjugation reaction and the pH of the purification step need not be the same. The conjugation reaction was quenched with free amine (Tris Base), optionally using a 30 kDa UF membrane to remove residual EDC, Sulfo NHS, and Tris Base.

[0331] Accordingly, the conjugated drug substance was diafiltered and formulated. As the conjugate exceeded 0.2 microns, all steps downstream of the TMV NtK UV treatment and antigen 0.2-micron filtration were maintained in a state of asepsis.

[0332] At this point, the TMV NtK:RBD-Fc conjugate will be (and in the case of Example 15, was) ready for drug substance filling and drug product filling. A suitable delivery mechanism of the vaccine would include a liquid vial or lyophilized material to be reconstituted with physiologic buffering for project injection, with administration of the vaccine according to optional methods described herein.

[0333] To determine the percent conjugation between the TMV NtK and the RBD-Fc 121 antigen, the SV was measured using an AUC. As previously noted, the fraction between 1-40 S indicates the percent RBD-Fc monomer/trimer, and the fraction between 40-2000 S indicates the percent TMV NtK:RBD-Fc conjugate, according to multiple embodiments and alternatives.

[0334] In the present example, FIG. 57 shows the normalized sedimentation coefficient for sample 4 (in which the TMV:RBD-Fc conjugate was diluted by a factor of 28), and FIG. 58 shows the normalized sedimentation coefficient for another sample (where the TMV:RBD-Fc conjugate was diluted by a factor of 10). FIG. 57 shows 100% total virus associated material (i.e. virus-antigen conjugates) and FIG. 58 shows 99.7% total virus associated material (i.e. virus-antigen conjugates). The results in FIGS. 57 and 58 indicate virtually complete engagement of the RBD-Fc products in TMV-conjugation events.

[0335] The successful conjugation between the TMV NtK and the RBD-Fc 121 antigen was confirmed by SDS-Page analysis. FIG. 59 contains a SDS Page gel of the TMV NtK:RBD-Fc conjugate at different time periods post-conjugation. In FIG. 59, the lanes include: lane 1—marker, lane 2—the conjugate mixture at 0 min, lane 3—the conjugate mixture at 5 min post-conjugation, lane 4—the conjugate mixture at 15 min post-conjugation, lane 5—the conjugate mixture at 30 min post-conjugation, lane 6—the conjugate mixture at 45 min post-conjugation, lane 7—the conjugate mixture at 60 min post-conjugation, lane 8—the final conjugate mixture after mixing, lane 9—a TMV:HA conjugate as a control, lane 10—the conjugate mixture 0 min, lane 11—the conjugate mixture at 5 min post-conjugation, lane 12—the conjugate mixture at 15 min post-conjugation, lane 13—the conjugate mixture at 30 min post-conjugation, lane 14—the conjugate mixture at 45 min post-conjugation, lane 15—the conjugate mixture at 60 min post-conjugation, lane 16—the final conjugate mixture after mixing, and lane 17—a TMV:HA conjugate as a control. The clear and visible bands in lanes 8 and 16, which are similar to the bands in lanes 9 and 17, indicate successful conjugation of TMV NtK to the RBD-Fc 121 antigen.

[0336] Accordingly, almost 100% conjugation of the RBD-Fc 121 antigen to the TMV NtK was confirmed by AUC and SDS Page.

In Vitro Testing—Example 15(b)

[0337] To determine the efficacy of the TMV NtK to RBD-Fc 121 conjugate as a Covid-19 vaccine candidate, the binding of the antigen to CR 3022 and the ACE-2 receptor were analyzed, as well as the immune response in mice. As discussed in more detail below, the data indicates the RBD-Fc antigen that was conjugated to TMV NtK, bound successfully to the human ACE-2 receptor. As further shown in Table 51, the initial immune responses stimulated after one vaccine dose with the TMV NtK:RBD-Fc conjugate supported this observation. Likewise, the RBD-Fc 121 antigen which was conjugated to TMV NtK SARS-2 RBD-specific, human neutralizing monoclonal antibody (mAb), CR 3022.

[0338] To determine the binding efficacy of the conjugate, an ELISA test was developed to measure the RBD potency for both free antigen (i.e. RBD-FC 121 alone) and conjugated forms (TMV to RBD-Fc) using CR3022 mAb for capture. The ELISA test was conducted to find sera that did not bind to the Fc portion of the antigen in order to eliminate background binding. This test was conducted through various methods including pre-absorption and/or binding to the kappa region of the CR3022 light chain. FIG. 60 illustrates the CR 3022 ELISA data by showing the conservation of RBD conformation among the free antigen and the TMV:RBD-Fc conjugate formulated at a 8:1 and 4:1 (TMV NtK:antigen) ratio, respectively. In FIG. 60(A), the ELISA standard curve illustrates the sensitivity and linearity for binding of SARS-2 Spike antigen to the CR 3022 antibody. In FIG. 60(B), the TMV:RBD-Fc conjugate is referred to as “TMV:RBD-Fc.” FIG. 60(B) shows strong, dose-dependent binding of CR 3022 to both the RBD-Fc 121 antigen and formulated TMV to RBD-Fc 121 conjugate. Accordingly, FIG. 60 indicates the RBD-Fc 121 antigen shows greater than five times the reactivity to CR 3022 as compared to commercially sourced control SARS Spike and RBD reagents. This data also suggests that the purified RBD-Fc 121 antigen maintains essential conformational epitopes in a more favorable manner compared to conventional purchased reagents.

[0339] ACE-2 functions as a cell surface receptor for the spike protein of SARS-CoV2 during the invasion of respiratory epithelial cells. To analyze the ability of the RBD-Fc 121 antigen to bind to the ACE-2 receptor and elicit a protective immune response against SARS-CoV2 infection, quantitative and functional ACE-2 binding was performed using two-color confocal microscopy and analysis by co-localization and competitive binding methods on Vero e6 cells to assess both co-localization of the ligands with ACE-2 and the relative affinity of the RBD-antibody complexes for ACE2 compared to angiotensin II.

[0340] Vero cells are derived from the kidney of an African green monkey and are commonly used in cellular research. The Vero e6 cells are a subclone of Vero76, exhibiting a range of virus susceptibility. Herein, the binding ability of the native agonist, angiotensin II, was compared with the RBD-Fc binding by analyzing the concentration dependent ability to block binding of an ACE-2 specific antibody (ab15348, a homolog of angiotensin II) to the receptor on living Vero e6 cells. In conducting these studies, plant-produced recombinant H7 strain influenza HA protein was used as a control. Multiple concentrations of each antigen-antibody complex ranging from 0.04 μg/ml to 10 μg/ml were incubated with Vero e6 cells and compared with angiotensin II, the native ligand of ACE-2, for their ability to bind the receptor. FIG. 62(A) graphically illustrates ligand co-localization events, in which FAM-angiotensin II bound to Vero e6 cells as expected, with an average of 452 particles per field and a 2.79-fold increase over the non-specific H7 control (n=10 analyses). (In discussing FIGS. 61, 62(A), and 62(B), angiotensin II refers to ab15348.) As shown in the same figure, the RBD-Fc 121 antigen bound to Vero e6 cells in a concentration-dependent manner with 2.58-fold increase at a concentration of 10 ug/ml (n=10 analyses). By contrast, in the same figure, binding of recombinant influenza HA-H7 remained at an average of 122.5 particles per field with no significant change at any concentration. FIG. 61 visually illustrates ligand co-localization and competitive binding with Vero e6 cells between angiotensin II and the RBD-Fc 121 antigen as discussed with FIG. 62(A). The images in FIG. 61 were obtained with confocal microscopy at the following ACE-2 specific antibody concentrations: 10 ug/ml, 3.3 ug/ml, 1.1 ug/ml, and 0.12 ug/ml, wherein the scale bars are equal to 15 μm. In FIG. 61, the red color shows binding of angiotensin II with the Vero e6 cells, and the green color shows co-localized binding of the RBD-Fc 121 antigen with these cells. The binding of the RBD-Fc 121 antigen to the Vero e6 cells occurred in a concentration-dependent manner with a 2.58-fold increase over the H7 HA control. Accordingly, increased binding of the RBD-Fc antigen (green) was observed to correlate with decreased detection of angiotension II binding (red). Higher concentrations of both angiotensin II and the RBD-Fc 121 antigen (n=10) correlated with direct and marked decreases in detectable levels of ACE-2 receptor binding (compared to lower concentrations), but recombinant influenza HA-H7 did not correlate to a direct decrease with increasing concentrations.

[0341] FIG. 62(B) illustrates that adding a co-localization control reduces all specific binding, demonstrating a reduction in ACE-2 antibody binding in the presence of both angiotensin II and the RBD-Fc 121 antigen. It will be noted that the binding of H7 HA did not impact the detection of ACE-2 by monoclonal antibody at any concentration. These figures also illustrate that the RBD-Fe 121 antigen effectively competes with angiotensin II for ACE-2 receptor binding on Vero e6 cells and co-localizes with these cells with similar affinity and specificity as angiotensin II.

[0342] Accordingly, FIGS. 60-62 illustrate that the RBD-Fc 121 antigen maintains functional conformation and activity through the binding of CR 3022 and ACE-2. The binding to ACE-2 shows similar affinity and specificity as the native agonist, angiotensin II, suggesting that the conformation of the spike protein RBD in the recombinant RBD-Fc 121 fusion peptide complex is comparable to that observed with native SARS-2 Spike protein. This data indicates that the RBD-Fc 121 antigen displays the correct structure necessary to elicit the production of neutralizing antibodies against the RBD of the Covid-19 spike protein.

[0343] To further evaluate the capability of the RBD-Fc 121 antigen (both free and TMV conjugate forms) to not only stimulate immune response but to neutralize virus infection by blocking cellular entry at the ACE-2 receptor, pooled serum samples were analyzed pre-immune, at day 12, day 28 following boost, and day 42 using a SARS-CoV2 plaque neutralization assay. Neutralization titers were calculated by determining the dilution of serum that reduced 50% of plaques. A standard 100 PFU amount of SARS-CoV-2 was incubated with two-fold serial dilutions of serum samples for one hour. The virus-serum mixture was then used to inoculate Vero e6 cells for 60 minutes, and the cells overlaid with EMEM agar medium plus 1.25% Avicel, incubated for 2 days, and plaques were counted after staining with 1% crystal violet in formalin. As FIGS. 63(A)-(D) show, pre-immune sera indicated no evidence of interference with the SARS-CoV2 plaque neutralization assay (FIG. 63(A)). Day 12 sera showed a slight trend of inhibition at the lowest dilution of 1/20, but no statistical difference from vehicle control (FIG. 63(B)). By day 28 (14 days post second vaccine), statistically significant reductions in titer were noted for 15 μg neat (non-vaccinated) and 15 μg+CpG groups at the 1/20 dilution. However, the 45 μg neat and 45 μg+CpG groups showed significance to the 1/320 dilution (FIG. 63(C)). By day 42 (28 days post second vaccine), the 15 μg neat group showed neutralization titers significant to the 1/640 dilution and 15 μg+CpG groups at the 1/320 dilution. The neutralization titers increased for the 45 mcg neat to 1/5120 and 45 μg+CpG to the 1/1280 dilution (FIG. 63(D)).

[0344] The growth in neutralization titer for 15 and 45 μg groups is further highlighted in FIGS. 64(A)-(B). This study combined with data provided in Table 68 below, Neutralizing Antibody Titers Induced by TMV:RBD-Fc 121 vaccines in Two Murine Pre-Clinical Trials as Measured by Geometric Mean Titer (GMT) Using CPE Neutralizing Assay and PRNT50 Methods, showed dose response and no additive induction of neutralization titers by inclusion of CpG, compared to the neat vaccine groups shown in FIG. 64(A). As further summarized in Table 52, the day 42 (28 days post vaccine two) sera were tested using standard cytopathic effect (CPE) neutralization assays tested with SARS-CoV2. The CPE neutralization assay begins with titrating dilutions of heat-inactivated serum samples, mixing with 100 TCID50 of SARS-CoV-2 in duplicate and incubation for 1 hour. The serum/virus mixture was then added to Vero e6 cells and allowed to incubate for 3 days at 37° C. and 5% CO.sub.2. Following incubation, the cell monolayers were fixed and stained with crystal violet to evaluate for the presence of virus-induced CPE. The virus neutralization titer for each sample is reported as the reciprocal of the highest dilution that prevented CPM is 50% of the wells. The results obtained from the CPE-neutralization method of individual sera samples from all groups correlates well with the pooled sera results obtained with SARS-CoV2 plaque assay. Groups showing highest neutralization titer, in descending order, were: TAP COVID-19 45 μg neat (GMT=2702), 45 μg+CpG (GMT=1280), 15 μg (GMT=676), 15 μg+CpG (338), RBD-Fc antigen alone (GMT=294) and PBS vehicle (<64). The group correspondence is clear showing dose response and no measurable contribution of CpG to promote enhanced neutralization titers.

In Vivo Testing—Example 15(c)

[0345] The TMV NtK:RBD-Fc 121 Covid-19 vaccine described above was evaluated for immunogenicity in two parallel evaluations using female C57BL/6 mice. As shown in FIGS. 65(A)-(D), the collected serum was tested for total IgG anti-RBD reactivity by ELISA, using recombinant COV2 RBD-His as capture antigen to compare immune response between groups.

[0346] In the first evaluation, 10 animals were used per group wherein 5 animals per group were sacrificed at day 14 to have sufficient sera for broad testing. The 5 remaining animals per group were boosted on day 14 and sacrificed on day 28. As used herein, the terms “boost” or “booster” or other derivatives of these words refer to a second administration of the vaccine at the same dose as the first. In the second evaluation, 5 animals were used per group, each receiving prime and boost vaccinations on days 0 and 14 respectively, with blood draws at days 0, 12, 14, 28, and terminal from all animals. In both evaluations, the trial endpoints include measurement of antigen-specific geometric mean antibody titers induced in mice, SARS-2 neutralizing titers, and antibody isotype analysis. The trials are outlined in Table 66 below, which included various dosages, different vaccines (including purified TMV NtK only, RBD-Fc only, and the TMV:RBD-Fc conjugate), and compared identical doses both with and without the use of CpG oligodeoxynucleotides (CpG) as an adjuvant. The CpG was added to the vaccine formulation such that the concentration of the antigen remains the same in a consistent 100 mcL injection as the neat (non-adjuvanted) vaccine formulation. In some embodiments, monophosphoryl lipid A (MPLA) and/or SE-M were utilized as adjuvants for enhancing the immune response of the subject to the vaccine. “SE-M” is a type of stable emulsion, which typically uses a TRL4 Toll-Like Receptor agonist as the adjuvant.

TABLE-US-00077 TABLE 66 TMV NtK:RBD-Fc Vaccine Immunogenicity Testing in Mice Group Vaccine Antigen Dose (μg) Adjuvant Immunization Days Bleed Dates 1A Purified TMV n/a none 0 0, 14 only 1B Purified TMV n/a none 0, 14 0, 14, 28 only 2A RBD-Fc antigen only 45 none 0 0, 14 2B RBD-Fc 45 none 0, 14 0, 14, 28 antigen only 3A TMV:RBD-Fc 15 none 0 0, 14 Conjugate 3B TMV:RBD-Fc 15 none 0, 14 0, 14, 28 Conjugate 4A TMV:RBD-Fc 45 none 0 0, 12, 14, Conjugate 4B TMV:RBD-Fc 45 none 0, 14 0, 14, 28 Conjugate 5A TMV:RBD-Fc 15 CpG (50 μg) 0 0, 14 Conjugate 5B TMV:RBD-Fc 15 CpG (50 μg) 0, 14 0, 14, 28 Conjugate 6A TMV:RBD-Fc 45 CpG (50 μg) 0 0, 14 Conjugate 6B TMV:RBD-Fc 45 CpG (50 μg) 0, 14 0, 14, 28 Conjugate

[0347] FIG. 65(A) illustrates the immune response (ng/mL) stimulated by RBD-Fc antigen only at 12, 28, and 42 days post first vaccination. FIG. 65(B) illustrates the immune response (ng/mL) stimulated by TMV:RBD-Fc conjugate at dosages of 15 mcg and 45 neat (unadjuvanted) at 12, 28 and 42 days post-first vaccination. FIG. 65(C) illustrates the immune response (ng/mL) stimulated by adjuvanted TMV:RBD-Fc conjugate (15 mcg) and TMV:RBD-Fc conjugate (45 mcg+CpG) vaccines at 12, 28 and 42 days post-first vaccination. In FIG. 65(d), comparative IgG titers recognizing the RBD-Fc antigen (in black) and RBD-His (in gray) are shown from sera taken at day 42. The relative ratio of reaction to RBD-His is shown as a percentage of total, RBD-Fc response, above each stacked plot member.

[0348] Baseline serum antibody levels were very low for RBD-His and RBD-121-Fc antigen, being <100 ng/mL. Further, no significant response was measured for PBS vehicle control animals, and the unconjugated RBD-Fc antigen produced a limited antibody response demonstrating that conjugated to the TMV NtK carrier is needed to produce a robust immune response.

[0349] As shown in FIGS. 65(B) and 65(C), all TMV:RBD-Fc vaccine groups showed measurable antibody responses by day 12. As shown in FIGS. 65(A), 65(B) and 65(C), a dose response was observed when comparing the RBD-Fc antigen alone and the TMV:RBD-Fc Conjugate. Further, strong boosting was observed from day 12 to day 28 following the second vaccination. The TMV:RBD-Fc conjugate groups showed expansion of antibody titers from day 28 to day 42, whereas CpG adjuvanted vaccines showed consistent (45 μg+CpG) or declining titers (15 μg+CpG). The non-adjuvanted TMV:RBD-Fc conjugate groups showed similar quantitative titers than CpG adjuvanted vaccines with all sera analyzed simultaneously against a single capture protein.

[0350] As shown in FIG. 65(D), the relative immune response to the SARS-2 RBD was tested, as well as the human Fc portion of the antigen to the immune response. Day 42 sera were analyzed by ELISA using either the SARS-2 RBD-His or the RBD-121-Fc proteins as capture agents. ELISA data was measured after 1:100 dilutions of PBS/RBD-121-Fc antigen immune groups, and 1:1000 for TMV:RBD-Fc conjugate groups. Titers recognizing the RBD were significantly lower than for RBD-Fc antigen, with the percentage of anti-RBD varying by the TMV:RBD-Fc group from 12-35% (FIG. 65(D)). The immune response titers were not significantly different across the TMV:RBD-Fc conjugate groups, regardless of the capture antigen.

[0351] A favorable balance of Th1/Th2 cytokines produced facilitates a safe and effective immune response, by balancing proinflammatory and anti-inflammatory responses Given the importance of Th1/Th2 balance, IgG isotype analysis was also conducted by measuring IgG1 (Th2) and IgG2 (IgG2a+IgG2c; Th1)) isotype for individual sera taken at day 42 and the results are shown in FIG. 66. FIG. 66(A) illustrates the Th1 response (IgG2a and IgG2c), FIG. 66(B) illustrates the Th2 response (IgG1), and FIG. 66(C) is a stack plot comparison of relative IgG2 versus IgG1 antibody by ELISA. In FIG. 66, the “*” indicates a p<0.05 compared to other groups.

[0352] As expected, the PBS and RBD-Fc antigen groups showed low overall IgG2 antibody responses, compared with all TMV:RBD-Fc conjugate groups. All TMV:RBD-Fc conjugate groups were different from each other, with significantly improved IgG2 titers by dose and by addition of adjuvant. The IgG1 titers were significantly higher in non-adjuvanted TMV:RBD-Fc conjugate groups, compared with all other groups, with the CpG adjuvanted group significantly lower and equivalent to RBD-Fc alone group. The ratio of IgG1 to G2 isotype varied across groups, with primarily IgG1 isotype titer in the RBD-121-Fc group, an IgG1 to G2 ratio greater than 1 for non-adjuvanted TMV:RBD-Fc conjugate groups, and a IgG1 to G2 ratio less than 0.1 for TMV:RBD-Fc conjugate+CpG adjuvant groups. In summary, the CpG adjuvant strongly skewed the isotype response to TMV:RBD-Fc conjugate vaccine to the Th1 type, with non-adjuvanted TMV:RBD-Fc conjugate showing a more balanced mix of Th1/Th2 response. The unconjugated protein stimulated almost entirely a Th2 response.

[0353] In the first evaluation mentioned above, SARS-2 neutralizing titers were measured using Vero E6 cell viability tests from day 14 samples. FIG. 67 shows the mean cell viability after co-incubation of SARS-2 virus with murine sera, wherein the average cell viability as percentage of total cells is plotted against the serum dilution. The data shown in FIG. 67 illustrate significantly increased viability observed in TMV:RBD-Fc 121 vaccine groups (45 mcg alone, 15 and 45 mcg+CpG) compared with the control groups—vehicle alone and antigen alone. The geometric mean neutralization titers were calculated for each group and are shown in Table 51.

TABLE-US-00078 TABLE 67 Geometric Mean Neutralization Titers Induced by TMV:RBD-Fc 121 Vaccine in Mice GMT Group Neutralization Titer Vehicle alone <16 Antigen alone (RBD-Fc) <16 TMV:RBD-Fc 121 vaccine <16 15 mcg TMV:RBD-Fc 121 vaccine 32 45 mcg TMV:RBD-Fc 121 vaccine 35.8 15 mcg + CpG TMV:RBD-Fc 121 vaccine 64 45 mcg + CpG

[0354] The data in Table 67 show measurable neutralization titers induced in mice following prime vaccine for adjuvanted and neat (non-adjuvanted) TMV:RBD-Fc 121 vaccines. FIG. 69 is a graph indicating serum neutralization activity based on titers following vaccination of mice against SARS CoV-2. The data depicted in FIG. 69 represents log(2) transformed end-point serum dilutions that inhibited CPE by 50%. Dotted and dashed line represent the starting dilution used for the post-prime and post-boost assays, respectively. (* p<0.05, 2way ANOVA, Tukey's multiple comparison, GraphPad Prism 8.4.2). The data in FIG. 69 provides further support that the exemplary TMV:RBD-Fc vaccines (including without limitation TMV:RBD-Fc 121 vaccine) can induce measurable neutralization titers post a single vaccine with and without adjuvant. After a second vaccine boost, these titers grow significantly for both 15 and 45 μg concentrations. With reference to FIGS. 71(A)-(C), exemplary TMV:RBD-Fc vaccines confer protection to organisms following exposure to SARS-CoV2. The subjects in the five groups received either a control (PBS), or an exemplary vaccine at varying levels of RBD-Fc concentration (CpG adjuvant only, 15 μg no adjuvant, or 45 μg no adjuvant), or no immunization. Survival (FIG. 71(A)), clinical presentation (FIG. 71(B)), and post-challenge weight (FIG. 71(C)) were evaluated and graphed. The clinical presentation data was based on temperature and physical appearance, with the latter being scored on a 0-3 scale: 0=normal; 1=mild, lack of grooming; 2=moderate, rough coat, nasal/ocular discharge; 3=severe, respiratory distress, lack of response to stimuli, humanely euthanized. Even with no adjuvant, for survival the subjects receiving the 5 μg and 45 μg concentrations fared the best, with the latter having 100% survival after 12 days post infection.

[0355] In the second evaluation, a recombinant RBD protein (6-His fusion) was used as the capture protein and antigen specific antibodies were measured and expressed as ng IgG bound/mL of pooled group sera. FIG. 68 illustrates the measured response titers following vaccine 1 (prime; day 12) and vaccine 2 (boost, day 28) induced in mice by TMV:RBD-Fc 121 vaccines. The samples represent analysis of pooled sera from 5 animals in each group and the capture antigen is a recombinant RBD-6-His protein. As shown in FIG. 68, measurable responses were observed at day 12 (following vaccine 1−prime vaccination) for the TMV:RBD-Fc 121 vaccine at 45 mcg neat or mixed with CpG adjuvant. Following vaccination 2 (indicated by “boost” in FIG. 67) at day 28, similar titers were present for TMV:RBD-Fc 121 vaccine at 45 mcg neat or mixed with CpG antigen group sear. Moreover, these titers appear significantly greater than that induced by TMV:RBD-Fc 121 vaccine at 15 mcg neat or mixed with CpG antigen. In FIG. 68, all TMV:RBD-Fc 121 groups are significantly higher than the immune response induced by RBD-Fc antigen alone. These trials show dose dependency of the TMV:RBD-Fc 121 vaccine and reveal that adjuvant does not make a significant contribution to enhanced immune responses to the RBD-Fc 121 antigen when conjugated to inactivated TMV particles. Moreover, as shown in FIG. 68, the TMV:RBD-Fc 121 vaccine induced a level of response greater than 600 mcg/mL when provided at the 45 mcg dose.

[0356] Using a SARS-2 plaque assay, the sera was tested for the generation of virus neutralizing antibody (Nab) titers in immunologically naïve animals. Nab titer was detectable following a single immunization but was greatly increased to <4000 GMT following a second (booster immunization). As shown in Table 68 below, two different neutralization assay methods were used showing comparable titers and providing a high degree of validity to the results. It should be noted that adjuvant did not increase the Nab titer in either experiment. Data support the effectiveness of as little as 15 mcg of TMV:RBD-Fc 121 vaccine—as it shows Nab titer of ˜200 post first dosing and >4,000 after second dose in one trial and >600 titer in second trial.

TABLE-US-00079 TABLE 68 Neutralizing Antibody Titers Induced by TMV:RBD-Fc 121 vaccines in Two Murine Pre-Clinical Trials as Measured by Geometric Mean Titer (GMT) Using CPE Neutralizing Assay and PRNT50 Methods Murine Trial 1 Murine Trial 2 Vaccination Group Post- Post- Post- Post- Post- Post- Vaccine 1: Vaccine 2: Vaccine 1: Vaccine 2: Vaccine 2: Vaccine Day 14* Day 28* Day 12** Day 28** Day 42** Day 42* GMT GMT Pooled Pooled Pooled GMT PRNT50 PRNT50 PRNT50 Vehicle Only <32 <64 <20 <20 <20 <64 TMV + RBD-121-Fc 56 1176 <20 NA NA NA (45 mcg) RBD-121-Fc (45 mcg) NA NA <20 <20 80 294 TMV:RBD-Fc 121 194 4096 <20 20 640 676 Conjugate (15 mcg) TMV:RBD-Fc 121 128 1783 <20 320 5120 2702 (45 mcg) TMV:RBD-Fc 121 169 1176 <20 20 320 338 (15 mcg) + CpG (50 mcg) TMV:RBD-Fc 121 388 1552 <20 320 1280 1552 (45 mcg) + CpG (50 mcg) *TCID50 value: CPE neutralization assay **PRNT50: p < 0.05 compared with virus control

[0357] Further analysis of murine sera showed a balanced Th1/Th2 immune response elicited by TMV:RBD-Fc 121 vaccines and, immunogenicity to the vaccine was heavily reliant upon conjugation to the TMV NtK carrier. In one in vitro model to assess the potential of the TMV:RBD-Fc vaccine to induce antibody-enhanced disease (ADE), sera containing neutralizing antibody titers of >2700 displayed no evidence of enhanced SARS-CoV-2 entry into macrophages. This indicates the vaccine strategy stimulates Nab titers without promoting ADE.

[0358] In addition, Th1 immune responses were explored through cellular stimulation analysis. In this study, groups of 5 mice were immunized by subcutaneous dosing once at day 1 and day 14, with either 15 μg or 45 μg antigen dose, with or without CpG, in 50 mcL total volume (PBS comprising buffer). On days 0, 12, 18 and 42 sera were collected, and the magnitude of the antibody response to the vaccine antigen was assessed as total titers against the target antigen and compared with PBS immune sera or pre-immune sera. Unconjugated protein RBD-Fc was used as the target for IgG assessment as well as RBD-HIS to assess response to total antigen and RBD (spike S1 domain) component of antigen. Approximately 6 weeks after the first immunization, vaccinated mice were euthanized and terminal sera collected, and spleens harvested for IFNγ ELISpot analysis. An overview of the study is shown in Table 69.

TABLE-US-00080 TABLE 69 Overview of Matrix Study Antigen Immunization Group Vaccine Dose (μg) Adjuvant Days Bleed Dates 1 Vehicle Only n/a none 0, 14 0, 12, 28, 42 2 RBD-Fc 45 none 0, 14 0, 12, 28, 42 3 TMV:RBD-Fc 15 none 0, 14 0, 12, 28, 42 4 TMV:RBD-Fc 45 none 0, 14 0, 12, 28, 42 5 TMV:RBD-Fc 15 CpG 0, 14 0, 12, 28, 42 (50 μg) 6 TMV:RBD-Fc 45 CpG 0, 14 0, 12, 28, 42 (50 μg)

[0359] Spleens from two animals of each group were harvested at day 42, single cell suspensions were generated, cells were stimulated for 36 hours with the SARS-CoV-2 RBD-HIS protein and the number of IFNγ secreting cells were measured. The results are shown in FIG. 70, wherein FIG. 70(A) illustrates the IFNγ ELISpot analysis for vehicle and RBD-Fc only, FIG. 70(B) illustrates the IFNγ ELISpot analysis for unadjuvanted TMV:RBD-Fc vaccine, and FIG. 70(C) illustrates the IFNγ ELISpot analysis for TMV:RBD-Fc vaccine with the CpG adjuvant.

[0360] As shown in FIG. 70, only cells recovered from mice vaccinated with TMV:RBD-Fc vaccines containing the CpG adjuvant induced statistically significant numbers of IFNγ secreting cells at day 42 (four weeks post-2nd immunization), with equivalent numbers in both 15 and 45 μg dose groups (FIG. 70(C)). This data is supportive of the IgG isotype analysis which indicates that TMV:RBD-Fc vaccine with CpG adjuvant co-delivery stimulates Th1 responses in mice.

[0361] In addition, a VaxArray® SeroAssay analysis of murine sera was conducted from mice immunized with various TMV:RBD-Fc vaccine dosages, and both with and without adjuvant, to evaluate the relevance of binding to heterologous coronavirus antigens. In FIG. 72, nCoV antigen (i) is full SARS-CoV2 spike protein, (ii) is the S1 (RBD) domain, SARS(i) is full SARS-1 spike as is MERS(i) and HKU1(i), each produced in mammalian systems. The relative titer is represented as fold enhancement of signal over controls reported. Strong reactivity was noted to both SARS-2 antigens and apparent cross reactivity to SARS-1 antigen. As shown in FIG. 72, no binding was observed to divergent MERS or HKU1 spike proteins. Accordingly, the results in FIG. 72 indicate that anti-sera from mice with neutralization titers recognized heterologously produced (mammalian cell) SARS-2 Spike proteins, RBD, and SARS-1 Spike Proteins (i.e. exhibit cross reactivity).

[0362] The specificity and relative titer of sera from terminal bleed (day 42) were analyzed by VaxArray®. Nine different capture antigens were used, including 8 heterologous antigens to SARS-CoV2 vaccine components, including: SARS-CoV2 Spike (produced in insect cells); SARS-CoV2 Spike (produced in mammalian cells); RBD (S1)-human Fc produced in plants (homologous antigen); SARS-CoV2 RBD (S1) (produced in mammalian cells); SARS-CoV2 S2 domain (produced in insect cells); SARS-CoV2 S1-sheep Fc (produced in mammalian cells); SARS-CoV1 S1-Rabbit Fc (produced in insect cells); MERS Spike (produced in mammalian cells); and HKU1 Spike (produced in mammalian cells). The VaxArray® assay was conducted with individual sera from each group and read at 100, 350 and 700 ms exposures. Reactivity to each antigen by each group of sera is shown in FIGS. 73(A) and 73(B). FIG. 73(A) shows reactivity as measured to each capture antigen. FIG. 73(B) shows comparative reactivity among each study group to specific capture antigens. The 100 ms exposure resulted in reactivity of vaccine sera to all capture antigens except the SARS-CoV2 S2 domain, MERS and HKU1 spike proteins. However, meaningful reaction was observed for SARS-COV1 S1 domain. Different overall reactivity was observed with full and S1 capture antigens from SARS-CoV2 origin. In terms of overall reactivity, strong reactivity was observed in descending order from 45 μg+CpG, 45 μg neat, 15 μg neat, 15 μg+CpG and RBD alone, while sera from PBS treated animals showed no reactivity. Furthermore, FIG. 74 provides further concordance when correlating the individual animal responses measured by CPE seen in Table 52 with plaque group microneutralization titers measured by VaxArray®. In FIG. 74, the lower titers noted with CoV2 RBD-Fc immunized animals 1 and 3, TAP 15 μg animal 2, or 15 mcg+CpG animal 3 all show lower titrating titers and lower neutralization titers. On the other hand, higher titers, as noted by absolute numbers and inability to be reduced by dilution, show higher neutralizing values. The overall correlation between titer across a group and group neutralization titer coincides with absolute numbers of individual titers, GMT and pooled sera values.

[0363] Additional data on survival is found in FIGS. 79(A)-(B), respectively. The former provides information from a mouse challenge study directed to survival, while the latter provides information from a ferret challenge study on survival. In the 14-day mouse study (FIG. 79(A)), at or near the time of infection, the subjects (other than the group receiving placebo) received either an 8:1 ratio or a 1:1 ratio of an HA7 pandemic influenza vaccine (i.e. TMV:H7 antigen vaccine either with or without a CpG adjuvant). Subjects receiving adjuvant had a 100% survival rate to day 14. FIG. 79(B) provides information about the results of the ferret challenge study. Again this was conducted with a TMV-H7 conjugate with and without CpG adjuvant. Based on virus titers collected from nasal turbinates, the results showed that the vaccine improves the rate of recovery with lower titers in the adjuvant groups compared to non-adjuvanted.

[0364] The murine testing also studied a murine macrophage line (Raw 264.7) lacking ACE-2 binding domains, which found that anti-spike RBD neutralizes viral killing and does not promote antibody-dependent enhancement of infection in murine macrophages. In humans, ACE-2 functions as a cell surface receptor for the spike protein of SARS-CoV2 during the invasion of respiratory epithelial cells. Concomitantly, in humans, mice and other organisms, neutralizing antibodies against the receptor binding domain of this spike protein have been found in patients that have recovered from SARS-CoV and are believed to be protective against infection with SARS-CoV2. However, it has also been shown that non-neutralizing antibodies are able to enhance the severity of SARS-CoV infections, and have impeded successful vaccine development for coronaviruses, including SARS-CoV1 and SARS-CoV2.

[0365] In the murine testing study, the abilities of certain antibodies including ones generated by the subject TMV:RBD-Fc vaccines were compared in regards to antibody-dependent enhancement of SARS-CoV2 infection. Raw 264.7 cells were grown into a 96 well plate in VGCM and allowed to adhere overnight. Cells were washed extensively prior to the addition of sera or antibodies. The antibodies of the study (or pooled sera) were simultaneously incubated for 1 hour to facilitate viral inactivation by neutralizing antibodies prior to incubation with macrophages. Following this incubation, media containing both antibodies and SARS-CoV2 was added to the macrophages and incubated for 48 hours, at which time viability was assessed thru the addition of Cell Titer Glo (Promega) and evaluated on the basis of luminescence output.

[0366] As further shown in FIGS. 75(A-B), non-neutralizing antibodies against the nucleocapsid and spike proteins of SARS-CoV2 enhanced viral entry into murine macrophages, a cell type that does not express ACE2 on the cell surface and is normally resistant to infection. Viability of macrophages exposed to the virus in the absence of antibody averaged 91.5% of the cell viability control at 48 hours post-infection (n=10). FIG. 75(A); FIG. 75(B), first and fifth bars. In the presence of anti-nucleocapsid antibodies raised against the whole spike protein at 6.25 ug/ml, viability fell to an average of 55.69% with the greatest concentration-dependent drop above 1 ug/ml. FIG. 75(A). In the presence of polyclonal antibodies raised against the whole spike protein at 6.25 ug/ml, viability fell to an average of 59.78%. FIG. 75(A). In contrast, pooled murine sera from the study in Example 15(b) against TAP COVID-19 vaccine at 6.25 ug/ml showed high neutralization titers without observable antibody-dependent enhancement, as indicated by an average viability of 125.56% compared to the cell viability control. Statistical differences were measured using one-way ANOVA with Tukey's P values, with the results provided in FIG. 75(C). Accordingly, non-neutralizing antibodies (against the nucleocapsid or spike protein) promoted viral entry into the macrophages, while antibodies generated from the TMV:RBD-Fc vaccines did not demonstrate this effect.

[0367] Accordingly, the in vivo testing shows that TMV:RBD-Fc 121 vaccines induce measurable and statistically significant SARS-2 neutralizing antibody titers over controls. The TMV:RBD-Fc 121 vaccine of the present example shows a strong, vigorous, and promising immune response. Besides IgG, Immunoglobulin M (IgM) is another indicator of vaccine efficacy. In subjects receiving vaccinations, IgM levels can be evaluated by ELISA and neutralizing antibody titers. In general, IgM antibody levels are predicted to rise following vaccine administration, typically for a period of time on the order of weeks, e.g., two weeks approximately. Accordingly, while other time periods could be used, testing by ELISA or neutralizing antibody titers, or both, at day 0, day 7, day 14, and day 28 can be performed following administration of a Covid-19 vaccine in accordance with the present embodiments. Such testing following such administration is predicted to confirm the production of IgM, and increase in its levels between day 0 and day 14, serving as an indicator of immunogenic response to vaccine administration. Subsequently, IgM levels would be predicted to decrease by day 28 as IgG antibody titers increase. It should also be noted that the entire vaccine manufacturing process, from the initial sequencing of the Covid-19 antigen to the final production of the cGMP vaccine for drug product sterility and release, can be accomplished in 8 weeks of time, which is a significant advantage over conventional vaccine production methods which typically take more than 6 months.

[0368] To assess potential adverse reaction to vaccination, exemplary TMV:RBD-Fc 121 vaccines as described herein were studied for effects on weight of animals. Female mice (n=5) not exposed to the virus were vaccinated with the concentrations shown in FIG. 80 at an 8:1 TMV to antigen ratio, and body weights for each animal were recorded weekly following vaccination. The data graphed in FIG. 80 represents the animals received vaccine one (Day 0) and vaccine two (Day 14) with study terminating on Day 28. All subjects increased in weight as shown in FIG. 80.

[0369] In a separate challenge study, New Zealand White Rabbits were administered an exemplary vaccine at different ratios, with and without adjuvant, and assessed against a control group with respect to post-challenge weight (FIG. 81A) and survival (FIG. 81(B). Results were recorded over 12 days with the vaccine groups faring markedly better over placebo in both categories, as shown in these figures.

[0370] Furthermore, as described in Example 14, the studies with the QIV vaccine show very high promise in experimental animals for H1, H3, H5, and H7 influenza models, and no toxicologically significant findings were observed. This data, as well as the role of inactivated TMV as a carrier, suggests similar potential for the Covid-19 vaccines disclosed herein due to the similar structural components and development platforms. As discussed in Example 16 below, the Covid-19 vaccines disclosed herein exhibit high stability at room temperature and under room temperature conditions for at least a six month period.

[0371] Accordingly, through the practice of certain embodiments herein, a conjugable antigen can be manufactured, suitable for conjugation with a carrier. The teachings herein contemplate and are otherwise directed to antigens which can be conjugated to virus particles, virus particles, vaccines, constructs, and other compositions of matter as well as all methods employed in the making of these. Such an antigen may be a recombinant antigen, and generally comprises a fusion peptide having a first peptide which comprises a receptor binding domain of a pathogen, a non-limiting example being a coronavirus, and a second peptide which comprises a fragment crystallizable (Fc) region of an antibody capable of binding to a Fc receptor. In some embodiments, the first peptide and the second peptide are linked by a hinge portion. Optionally, this hinge portion may be a portion of the Fc region. In some embodiments, the hinge portion contains an amino acid sequence as set forth in SEQ ID NO: 3. Exemplary coronaviruses from which a receptor binding domain may be obtained include without limitation SARS-CoV-1, SARS-CoV-2, and MERS.

[0372] Now with reference to FIG. 51(A), an exemplary receptor binding domain of a SARS-CoV-2, the receptor binding domain is contained in a S-1 subunit of a spike protein of the coronavirus, and it comprises contact residues which are located in a range from about position 289 to about position 662. In some embodiments, the second peptide may comprise an Fc domain of an IgG1 antibody, with such domain containing as noted herein an amino acid sequence as set forth in SEQ ID NO: 4.

[0373] Consistent with the teachings herein, in some embodiments a vaccine is manufactured, comprising at least one conjugable antigen, as described according to the multiple embodiments and alternatives of this disclosure, and a carrier comprising a virus particle. In some embodiments, such a virus particle is a virus, for example TMV. The first peptide of the conjugable antigen may contain an amino acid sequence as set forth in SEQ ID NO: 2, alternatively the amino acid sequence may be as set forth in SEQ ID NO: 8. The first peptide may contain contact residues located in a range from about position 289 to about position 662 of a S-1 subunit of a spike protein of the coronavirus, which will contact an ACE-2 receptor on a cell of a mammalian subject to whom such a vaccine is administered, after the antigen is released from the virus particle carrier following administration. For the RBD-FC 121 antigen, the contact residues may be located in a range from about position 301 to about position 662 of the S-1 subunit. It has been found that with regard to the conjugable antigen referred to herein as the RBD-FC 121 antigen, the first peptide lacks an amino acid sequence as set forth in SEQ ID NO: 5, while the first peptide of RBD-Fc 139 antigen does contain this sequence. In both cases, when the conjugable antigen of the vaccine is released in a mammalian subject, having cells that include one or more ACE-2 receptors, the at least one conjugable antigen binds to the one or more ACE-2 receptors. In some embodiments, a virus particle used in the manufacture of such a vaccine has surface lysine residues, which chemically associate with the fusion peptide, more specifically the first peptide, resulting from the conjugation reaction.

[0374] Consistent with the breadth of teachings herein, in some embodiments a vaccine in accordance with teachings herein is multivalent and comprises at least one conjugable antigen having a receptor binding domain of a type A influenza virus and at least one conjugable antigen having a receptor binding domain of a coronavirus. Other possible combinations are within the scope of present embodiments, and the combinations provided herein are illustrative and non-limiting. In some embodiments, a vaccine in accordance with teachings herein is multivalent and comprises at least one conjugable antigen having a receptor binding domain of a type B influenza virus and at least one conjugable antigen having a receptor binding domain of a coronavirus. Alternatively, a vaccine in accordance with teachings herein is multivalent and comprises at least one conjugable antigen having a receptor binding domain of a type A influenza virus, at least one conjugable antigen having a receptor binding domain of a type B influenza virus, and at least one conjugable antigen having a receptor binding domain of a coronavirus. Various ratios may be selected and expressed as follows, virus particle:antigen by wt (i.e., ratio of the virus particle and the at least one conjugable antigen by weight). As desired, this ratio may be in a range between about 1:1 and about 8:1, more specifically 8:1. Optionally, CpG may be included with a vaccine in accordance with the teachings herein as an adjuvant for enhancing the immune response of the mammalian subject to the vaccine.

Example 16—Stability Under Refrigerated and Room Temperature Conditions for the Coronavirus Vaccine Candidate: TMV:RBD-Fc 121 Vaccine

[0375] Similar to the stability of the QIV vaccine discussed in Example 13, both the RBD-Fc 121 antigen and the TMV:RBD-Fc 121 vaccine exhibited consistency and stability under refrigerated and room temperature conditions for at least six months. In this example, the stability of the RBD-Fc 121 antigen was measured, as well as the stability of the TMV:RBD-Fc 121 vaccine, using the tests discussed in Example 13.

[0376] As previously mentioned, the RBD-Fc 121 antigen was purified and produced according to multiple embodiments. In this example, the stability of the purified RBD-Fc 121 antigen was then analyzed. The following table provides the stability data and storage potency for purified RBD-Fc 121 antigen as measured at release and various times after filling into vials and stored under refrigerated conditions (2° to 8° C.) and at room temperature (22° to 28° C.). In these tables, “HMW” is an abbreviation for high molecular weight.

TABLE-US-00081 TABLE 70 Stability of Purified RBD-Fc 121 Antigen Under Refrigerated Conditions Test Test Parameters Methods Initial (CoA) 1 month 3 months 6 months Physical/ pH 7.5 7.3 7.3 7.3 Chemical Properties Protein Absorbance 0.877 mg/mL 0.888 mg/mL 0.896 mg/mL 0.888 mg/mL Concentration at 280 nm Potency VaxArray ® 950 μg/mL 1150 μg/mL 822 μg/mL 1027 μg/mL Purity SDS PAGE >99% >99% >99% >99% Purity Size 94% Monomer 94% Monomer 90% Monomer 90% Monomer Exclusion 6% HMW 6% HMW 10% HMW 10% HMW HPLC

TABLE-US-00082 TABLE 71 Stability of Purified RBD-Fc 121 Antigen Under Room Temperature Conditions Test Test Parameters Methods Initial (CoA) 1 month 3 months 6 months Physical/ pH 7.5 7.2 7.3 7.3 Chemical Properties Protein Absorbance 0.877 mg/mL 1.04 mg/mL 1.02 mg/mL 1.15 mg/mL Concentration at 280 nm Potency VaxArray ® 950 μg/mL 972 μg/mL 553 μg/mL 977 μg/mL Purity SDS PAGE >99% >99% >99% >99% Purity Size 94% Monomer 95% Monomer 90% Monomer 89% Monomer Exclusion 6% HMW 6% HMW 6% HMW 11% HMW HPLC

[0377] Following the production and purification methods according to multiple embodiments and alternatives, Tables 70&71 show that the purified RBD-Fc 121 antigen is highly stable and potent.

[0378] Likewise, when the same purified RBD-Fc 121 antigen is conjugated to TMV, according to multiple embodiments and alternatives, the stability profile and storage potency remains consistent. The following table provides the stability data of the TMV:RBD-Fc 121 vaccine (at a TMV to antigen ratio of 8:1) at release and various times after filling into vials and stored under refrigerated conditions (2° to 8° C.):

TABLE-US-00083 TABLE 72 Stability of TMV:RBD-Fc 121 Vaccine Under Refrigerated Conditions Test Test Initial Parameters Methods (CoA) 1 month 3 months 6 months Appearance Appearance Cloudy, Cloudy, Cloudy, Cloudy, Liquid Liquid Liquid Liquid Physical/ pH 7.3 7.3 7.4 7.4 Chemical Properties Protein BCA 1.5 mg/mL 1.2 mg/mL 1.4 mg/mL 1.4 mg/mL Concentration Purity AUC 98.0% 97.9% 88.5% 91.2% Conjugate Conjugate Conjugate Conjugate Potency VaxArray ® 148 μg/mL 160 μg/mL 166 μg/mL 180 μg/mL Average Size Dynamic 174.3 nm 149.3 nm 160.3 nm 169.6 nm Radius Light Scattering Safety Endotoxin 713 EU/mg 806 EU/mg 908 EU/mg 451 EU/mg Safety Bioburden TAMC ≤ 100 CFU/mL TCYM ≤ 100 CFU/mL

[0379] The following tables provide the stability data of the TMV:RBD-Fc 121 vaccine (at a TMV to antigen ratio of 8:1) at release and various times after filling into bags and stored under refrigerated conditions (2° to 8° C.) and room temperature conditions (22° to 28° C.):

TABLE-US-00084 TABLE 73 Stability of TMV:RBD-Fc 121 Vaccine Under Refrigerated Conditions Test Parameters Test Methods Initial (CoA) 1 month 3 months 6 months Appearance Appearance Cloudy, Cloudy, Cloudy, Cloudy, Liquid Liquid Liquid Liquid Physical/ pH 7.5 7.4 7.4 7.5 Chemical Properties Protein BCA 1.5 mg/mL 1.2 mg/mL 1.4 mg/mL 1.5 mg/mL Concentration Purity AUC >99% 97.4% 97.9% 91.2% Conjugate Conjugate Conjugate Conjugate Potency VaxArray ® 57 μg/mL 72 μg/mL 73 μg/mL 98 μg/mL Average Size Dynamic 162.9 nm 170.6 nm 157.9 nm 166.8 nm Radius Light Scattering Safety Endotoxin 612 EU/mg 456 EU/mg 699 EU/mg 337 EU/mg Safety Bioburden Pass

TABLE-US-00085 TABLE 74 Stability of TMV:RBD-Fc 121 Vaccine Under Room Temperature Conditions Test Parameters Test Methods Initial (CoA) 1 month 3 months 6 months Appearance Appearance Cloudy, Cloudy, Cloudy, Cloudy, (USP <1>) Liquid Liquid Liquid Liquid Physical/ pH 7.5 7.4 7.4 7.5 Chemical Determination Properties (USP<791>) Protein BCA USP 1.5 mg/mL 1.3 mg/mL 1.4 mg/mL 1.5 mg/mL Concentration <1057>, Method 4 Purity AUC >99% 99.4% 94.9% 91.0% Conjugate Conjugate Conjugate Conjugate Potency VaxArray ® 57 μg/mL 70 μg/mL 6 μg/mL 76 μg/mL Average Size Dynamic Light 162.9 nm 189.8 nm 191.5 nm 204.4 nm Radius Scattering Safety Endotoxin 612 EU/mg 431 EU/mg 405 EU/mg 349 EU/mg (USP <185>) Safety Bioburden Pass

[0380] Tables 72 and 73 illustrate that the TMV:RBD-Fc 121 vaccine exhibited strong stability measures for at least six months under refrigerated conditions. Likewise, Table 74 illustrates that the TMV:RBD-Fc 121 vaccine, produced according to multiple embodiments and alternatives, exhibited strong stability measures for at least six months at room temperature storage (22° to 28° C.). This is in contrast to the conventional SARS-2 vaccines which in most situations require storage in an ultra-cold freezer (e.g. −20° C. to −70° C.) or, under refrigerated conditions, or at most offer but a few hours of stability at room temperature. Moreover, the purification and formulation processes according to multiple embodiments and alternatives stabilizes the RBD-Fc 121 antigen by itself—far beyond the stability limits of conventional approaches.

Example 17—Coronavirus Vaccine Candidate: Plant Expression, Purification, Characterization, and Conjugation of RBD-Fc 139 (SARS-2) to TMV

[0381] In addition to the RBD-Fc 121 antigen, it is expected that any type of virus antigen, including other Covid-19 antigens, may be purified and conjugated to inactivated TMV for use as an effective vaccine candidate according to multiple embodiments and alternatives. In some embodiments, the following antigen sequence (referred to herein as “RBD-Fc 139 Construct”) is used for the synthesis of a Covid-19 antigen:

TABLE-US-00086 1. “(SEQ ID NO: 1”) Signal Peptide: MGKMASLFATFLVVLVSLSLASESSA 2. “(SEQ ID NO: 5”) SARS-2 virus Spike amino acids numbered 319-330: RVQPTESIVRFP 3. (SEQ ID NO: 6”) SARS-2 virus Spike amino acids numbered 331-591: NITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCY GVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFT GCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPC NGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKS TNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQ TLEILDITPCS 4. “(SEQ ID NO: 7”) Tobacco etch virus NIA cleavage sequence: enlyfqg 5. “(SEQ ID NO: 3”) Fc Hinge: VEPKSCDKTHTCPPCP 6 “(SEQ ID NO: 4”) IgG1 171 allotype Fc: APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKAL PAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDI AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS VMHEALHNHYTQKSLSLSPG

[0382] In an embodiment of the RBD-FC 139 Construct, the following antigen sequence is used for the synthesis of a Covid-19 antigen:

TABLE-US-00087 “(SEQ ID NO: 8”) SARS-2 virus Spike amino acids numbered 319-591: RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVL YNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKI ADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDI STEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELL HAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRD IADTTDAVRDPQTLEILDITPCS

[0383] Multigenic constructs were designed and built to contain genes encoding the proteins necessary to synthesize the RBD-Fc 139 antigen, which also targets the RBD domain of SARS-2 in a similar manner to RBD-Fc 121. According to multiple embodiments and alternatives, the RBD-Fc 139 construct was ligated into the TRBO vector (as a non-limiting example) and subsequent colonies were screened to confirm clones. The assembled expression plasmids containing the RBD-Fc 139 Construct, similar to the plasmid shown in FIG. 52, were amplified, and then purified for use in the production of a Master Cell Bank.

[0384] According to multiple embodiments and alternatives, the RBD-Fc 139 antigen is expressed in plants and purified using an antigen purification platform described herein. As shown in FIGS. 76-77, the antigen purification platform, according to multiple embodiments and alternatives, successfully purified RBD-Fc 139 resulting in high yields with pure, stable antigen as RBD-Fc monomer in a manner that is compliant with GLP regulations. FIG. 76, taken from the conclusion of the antigen purification platform, contains a SDS page gel indicating purity and successful purification for the RBD-Fc 139 antigen in both reducing and non-reducing conditions. In FIG. 76, the lanes include: lane 1—11.8 ug of purified antigen in reducing conditions, lane 2—blank, lanes 3-5: 1.5 ug of purified antigen in reducing conditions, lane 6—blank, lane 7—marker, lane 8—blank, lanes 9-11—1.5 ug of purified antigen in non-reducing conditions, lane 12—blank, and lane 13, 11.8 ug of purified antigen in non-reducing conditions. The clear and visible bands indicate the RBD-Fc 139 antigen product is highly pure.

[0385] FIG. 77 is the SEC-HPLC report of the free RBD-Fc 139 antigen, which produced the signal detailed in Table 75 below. The 100% area under the peak indicates that 100% of the RBD-Fc 139 antigen is in monomeric form.

TABLE-US-00088 TABLE 75 SEC-HPLC Data of free, purified RBD-Fc 139 Antigen RT Width Peak [min] [min] Area Height Area % Symmetry 17.110 1.18 2220.84 23.81 100 0.78

[0386] Therefore, the SDS page gel and the SEC-HPLC report of the free RBD-Fc 139 antigen confirm the antigen purification platform which was used, according to multiple embodiments and alternatives, successfully purified the RBD-Fc 139 antigen.

[0387] In parallel to the Covid-19 antigen production, the TMV NtK virions with surface lysine residues for efficient conjugation are manufactured in plants and purified according to the virus purification platform described herein. Following purification, the TMV NtK is subject to micron filtration and immediately treated with UV inactivation. The RBD-Fc 139 antigen is then conjugated to the inactivated TMV via the surface exposed lysine residues utilizing the conjugation of recombinant antigen embodiments described herein.

[0388] Also in accordance with the present embodiments herein, a TMV:RBD-Fc 139 conjugate is currently being studied as a vaccine candidate for Covid-19 Disease. However, based on the success of the quadrivalent vaccine and the strong immune responses by the initial TMV:RBF-Fc 121 conjugate, the TMV:RBD-Fc 139 conjugate is also expected to be a viable Covid-19 vaccine.

[0389] It will be readily appreciated that the breadth of teachings herein accords with multiple embodiments with a broad array of options in alternative manners for practicing the embodiments. Accordingly, and without limitation, in an embodiment, referred to herein as embodiment A, directed to an antigen, a fusion peptide is formed of a first peptide which comprises a receptor binding domain of a pathogen, and a second peptide which comprises a fragment crystallizable (Fc) region of an antibody capable of binding to a Fc receptor. In an embodiment within the scope of embodiment A, and referred to herein as embodiment B, the antigen further comprises a hinge portion linking the first peptide and the second peptide. Being a portion of the Fc region and more specifically as referred to herein as embodiment C, the hinge portion may contain an amino acid sequence as set forth in SEQ ID NO: 3. In an embodiment within the scope of embodiment A and referred to herein as embodiment D, the pathogen is a coronavirus having a receptor binding domain, and more specifically as referred to herein as embodiment E, the coronavirus is chosen from the group consisting of SARS-CoV-1 and SARS-CoV-2. In an embodiment within the scope of embodiment E, and referred to herein as embodiment F, the receptor binding domain of the coronavirus comprises contact residues are located in a range from about position 289 to about position 662 of a S-1 subunit of a spike protein of the coronavirus, wherein the contact residues contact an ACE-2 receptor on a cell of a mammalian subject, or alternatively, in an embodiment referred to herein as embodiment G, the contact residues are located in a range from about position 301 to about position 662 of the S-1 subunit. In an embodiment within the scope of embodiment F, and referred to herein as embodiment H, the receptor binding domain of the coronavirus lacks an amino acid sequence as set forth in SEQ ID NO: 5.

[0390] In an embodiment within the scope of embodiment D, and referred to herein as embodiment I, the coronavirus is a Middle East respiratory syndrome coronavirus. In an embodiment within the scope of embodiment A, and referred to herein as embodiment J, the second peptide is an Fc domain of an IgG1 antibody and more specifically as referred to herein as embodiment K, the Fc domain contains an amino acid sequence as set forth in SEQ ID NO: 4 and the first peptide contains an amino acid sequence as set forth in either SEQ ID NO: 2 or SEQ ID NO: 8. Accordingly, an antigen may be practiced (i.e., made, formed, designed, used, and so forth) in accordance with embodiment A as more fully described herein. Optionally and as desired by those practicing the embodiments herein, an antigen as described herein may be practiced by incorporating with embodiment A any one or more of embodiments B, C, D, E, F, G, H, I, or J, and embodiments may be directed to compounds, methods, and genetic constructs in the practice of any one or more of these alternative embodiments. Likewise, embodiments may be directed to a vaccine comprising an antigen, a method of forming an antigen, or a genetic construct useful in forming an antigen, as recited in embodiment A, B, C, D, E, F, G, H, I, or J, and further comprising in combination with any aforementioned embodiment, a carrier comprising a virus particle, wherein the virus in some embodiments is a virus, and more particularly a tobacco mosaic virus, and wherein the fusion peptide chemically associates with lysine residues on a surface of the carrier.

[0391] Still further, and without limitation, in an embodiment referred to herein as embodiment K, a vaccine comprises an influenza hemagglutinin antigen (HA) and a carrier comprising a virus particle having surface lysine residues, wherein the HA chemically associates with the surface lysine residues. In an embodiment within the scope of embodiment K, and referred to herein as embodiment L, the virus particle releases the at least one antigen in a mammalian subject having cells that include one or more ACE-2 receptors, the at least one antigen binds to the one or more ACE-2 receptor. In an embodiment within the scope of embodiment K, and referred to herein as embodiment M, the virus particle is a virus, or more specifically as referred to herein as embodiment N, the virus is a tobacco mosaic virus. In an embodiment within the scope of any of embodiment K, L, M, or N, and referred to herein as embodiment O, the vaccine is multivalent, and the HA is chosen from the group consisting of type A HA and type B HA, and the vaccine further comprises at least one antigen having a receptor binding domain of a coronavirus, wherein the at least one antigen having a receptor binding domain of a coronavirus chemically associates with the surface lysine residues. In an embodiment within the scope of embodiment O, and referred to herein as embodiment P, the HA comprises two or more type A hemagglutinin antigens (HAs) and two or more type B HAs. Also, in an embodiment within the scope of embodiment O, and referred to herein as embodiment Q, additional features found in any one or more of embodiments A, B, C, D, E, F, G, H, I, or J are incorporated with the coronavirus element of the vaccine. Further, in an embodiment referred to herein as embodiment R, in a vaccine within the scope of embodiment Q, a ratio of virus particle and at least one antigen (by weight) is in a range between 1:1 and 8:1 and, more particularly in an embodiment referred to as embodiment S that range is 8:1.

Additional Embodiments and Uses of Novel Subject Matter Herein

[0392] In addition to antigens described above, including the RBD-Fc antigens for treatment against SARS-CoV2, myriad other antigens can be formed according to the multiple embodiments and alternatives described herein. The scope of the descriptions and teachings herein are intended to be limited only in accordance with the claims. For example, a strategy similar to Examples 14, 15, and 16 can be employed to derive candidate vaccines from other human-infecting coronaviruses, including acute respiratory syndrome coronavirus (SARS-1) and Middle East respiratory syndrome coronavirus (MERS). As illustrated in FIG. 78, domains of homology can be identified into functional regions in the Spike S1 domain which correlated with receptor binding and other essential activities.

[0393] In this regard, FIG. 78 shows the Receptor Binding Domain of the spike protein sequence alignment of SARS-CoV-2 and other related Coronaviruses. Shown here is a sequence alignment for the interacting (i.e. binding) domain of SARS-CoV-2 (MN938384), Bat-CoV (MN996532 and MG772933) and SARS-CoV (NC004718). The key amino acids described for the interaction with ACE2 and SARS-CoV2 are underlined. (Lines (−)=same amino acid, dots (.)=deletion). FIG. 78 is from Ortega J T, Serrano M L, Pujol F H, Rangel H R. Role of changes in SARS-CoV-2 spike protein in the interaction with the human ACE-2 receptor: An in silico analysis. EXCLI J. 2020; 19:410-417. Published 2020 Mar. 18. Doi:10.17179/excli2020-1167.

[0394] As seen in the constructs for the RBD-Fc 121 antigen and RBD-Fc 139 antigen, and reading the N-terminus, the core elements of functionality extend from the “RVQPT” motif for the RBD-Fc 139 Construct to the “CGPKK” domain for both the RBD-Fc 121 and RBD-Fc 139 Constructs. Looking more closely at the RBD-Fc 121 Constructs, there extends beyond the core domain a more extended protein domain which facilitates appropriate folding. Indeed, this strategy is expected to extend to any type of coronovirus antigen, through the processes of:

[0395] 1. Protein homology analysis—shown in FIG. 78,

[0396] 2. In silico protein folding using extant coronavirus Spike models,

[0397] 3. Creation of extensin signal peptide—RBD genetic fusion that promotes efficient cleavage as judged by SignalIP or Phobius;

[0398] 4. Genetic fusion with Fc reading frame—as illustrated by the RBD-Fc 121 and 139 Constructs;

[0399] 5. Expression in plants,

[0400] 6. Purification by Protein A and other methods illustrated in this patent application,

[0401] 7. Conjugation to TMV in accordance with multiple embodiments and alternatives described herein

[0402] Such a vaccine can be formed to contain a number of different and diverse antigens, and used to prevent an identified coronavirus pathogen such as SARS-1 or MERS, or formulated with either the RBD-Fc 121 or 139 antigen into a multivalent vaccine to prevent SARS-1, SARS-2, and MERS, as non-limiting examples. In accordance with multiple embodiments and alternatives described herein, for example with influenza A and B antigens, multivalent TMV conjugate vaccines can be mixed as equal or proportional quantities of each TMV-antigen conjugate and applied in a single immunization. As described herein, multivalent TMV-conjugate vaccines do not show immune dominance of one antigen preventing response to a second or third or fourth. Indeed, both HAI and neutralizing antibodies were generated against all strains in animals immunized with a quadrivalent TMV influenza vaccine, as seen with Example 14. Using this quadrivalent vaccine, protection can be measured against more than one individual influenza vaccine.

[0403] Thus, it is anticipated that the approaches described herein, in accordance with multiple embodiments and alternatives, are likely to provide a wide and varied range of antigens upon a single virus particle carrier. To illustrate in a non-limiting way, in an embodiment a multivalent vaccine is provided in accordance with the teachings herein, comprising two, three, four, five, or more different antigens against various viruses and other pathogens. At least one antigen may neutralize or stimulate an immune response against one type of virus (e.g., influenza), while at least one other antigen may do the same against another type of virus (e.g., a pandemic virus like coronavirus or HA7). An antigen occupying a position on the carrier could be comprised of a fusion protein modeled after the receptor binding domain of a virus, combined with a fusion partner, such as the Fc domain of an antibody from the tail region of an IgG molecule. The influenza portion of the at least one antigen on a single vaccine may comprise both type A and type B influenza. Likewise, an approach may provide at least one antigen directed against one or more coronaviruses. The flexibility of the approaches herein and wide scope of combinable antigen-virus conjugates contemplated herein promote the ability to manufacture broad spectrum vaccines at a large scale in a compressed time period, often measuring weeks as opposed to many months.

[0404] It will be understood that the embodiments described herein are not limited in their application to the details of the teachings and descriptions set forth, or as illustrated in the accompanying figures. Rather, it will be understood that the present embodiments and alternatives, as described and claimed herein, are capable of being practiced or carried out in various ways. Also, it is to be understood that words and phrases used herein are for the purpose of description and should not be regarded as limiting. The use herein of “including,” “comprising,” “e.g.,” “containing,” or “having” and variations of those words is meant to encompass the items listed thereafter, and equivalents of those, as well as additional items.

[0405] Accordingly, the foregoing descriptions of several embodiments and alternatives are meant to illustrate, rather than to serve as limits on the scope of what has been disclosed herein. The descriptions herein are not intended to be exhaustive, nor are they meant to limit the understanding of the embodiments to the precise forms disclosed. It will be understood by those having ordinary skill in the art that modifications and variations of these embodiments are reasonably possible in light of the above teachings and descriptions.