Formula with specific beta-lactoglobulin peptides
20210227868 · 2021-07-29
Assignee
Inventors
- Joost Willem Gouw (Utrecht, NL)
- Laura Antoinette Petronella Maria Meulenbroek (Utrecht, NL)
- Juandy Jo (Singapore, SG)
- Leon Matthieu Johannes Knippels (Utrecht, NL)
- Johan Garssen (Utrecht, NL)
Cpc classification
A23L33/40
HUMAN NECESSITIES
A23V2002/00
HUMAN NECESSITIES
A23V2200/304
HUMAN NECESSITIES
A23V2200/3202
HUMAN NECESSITIES
A23V2002/00
HUMAN NECESSITIES
A23V2200/304
HUMAN NECESSITIES
A23V2200/3202
HUMAN NECESSITIES
A23L33/135
HUMAN NECESSITIES
International classification
A23L33/00
HUMAN NECESSITIES
A23L33/135
HUMAN NECESSITIES
Abstract
A formula comprising a whey protein hydrolysate comprising specific beta-lactoglobulin derived peptides and probiotics for inducing oral immune tolerance against milk protein, preventing or treating of oral immune intolerance against milk protein, and/or reducing the risk of developing oral immune intolerance against milk protein.
Claims
1.-29. (canceled)
30. A method for inducing oral immune tolerance against milk protein; and/or preventing or treating oral immune intolerance against milk protein; and/or reducing the risk of developing oral immune intolerance against milk protein, and/or improving or enhancing of oral immune tolerance against milk protein, in a human subject at risk of developing or suffering from allergy, wherein the method involves administering to the human subject a nutritional composition comprising a protein hydrolysate from mammalian milk, wherein the protein hydrolysate comprises at least a peptide having a sequence according to SEQ ID NO: 5 and at least one peptide having a sequence according to SEQ ID NO: 2, SEQ ID NO: 3 or SEQ ID NO: 4.
31. The method according to claim 30, wherein the human subject is at risk of developing or suffers from milk protein allergy.
32. The method according to claim 30, wherein the composition further comprising at least one strain of a lactic acid-producing bacterium.
33. The method according to claim 30, wherein the composition comprises less than 6 μg allergenic beta-lactoglobulin per g of total protein.
34. The method according to claim 30, wherein the composition comprises at least 50 wt % hydrolysed whey protein based on total protein.
35. The method according to claim 30, wherein the composition comprises less than 10 wt % of peptides or proteins having a size of 5 kDa or above, based on total protein.
36. The method according to claim 30, wherein at least 1 wt % of peptides or proteins present in the composition has a size of 1 kDa or above, based on total protein.
37. The method according to claim 30, wherein the human subject is an infant.
38. The method according to claim 30, wherein the composition comprises a strain of lactic acid-producing bacterium belonging to the genus Bifidobacterium.
39. The method according to claim 30, wherein the non-digestible oligosaccharides comprises at least two non-digestible oligosaccharide(s) selected from the group consisting of fructo-oligosaccharides and galacto-oligosaccharides.
40. The method according to claim 30, wherein the composition comprises long-chain polyunsaturated fatty acids.
41. The method according to claim 30, wherein the composition is an infant, follow-on formula or young child formula.
42. A nutritional composition comprising: a. a strain of lactic acid-producing bacterium belonging to the genus Bifidobacterium; b. a milk protein hydrolysate from a species of the genus Bos, Bison, Bubalus or Capra, more preferably from genus Bos, wherein the milk protein hydrolysate comprises at least a peptide having a sequence according to SEQ ID NO: 5 and at least one peptide having a sequence according to SEQ ID NO: 2, SEQ ID NO: 3 or SEQ ID NO: 4; c. less than 6 μg allergenic beta-lactoglobulin, preferably less than 3.5 μg beta-lactoglobulin, per g of total protein, d. less than 10 wt % of peptides or proteins having a size of 5 kDa or above, based on total protein, and e. at least 50 wt %, preferably at least 95 wt % of hydrolysed whey protein based on total protein, f. optionally one or more non-digestible oligosaccharide(s) selected from the group consisting of fructooligosaccharide, non-digestible dextrin, galactooligosaccharide, xylooligosaccharide, arabino-oligosaccharide, arabinogalacto-oligosaccharide, gluco-oligosaccharide, glucomanno-oligosaccharide, galactomanno-oligosaccharide, mannan-oligosaccharide, chito-oligosaccharide, uronic acid oligosaccharide, sialyloligosaccharide, and fucooligosaccharide, and mixtures thereof, preferably fructo-oligosaccharides, and g. optionally long-chain polyunsaturated fatty acids, preferably docosahexaenoic acid (DHA), more preferably at least 0.35 wt. % DHA based on total fatty acids.
43. The nutritional composition according to according to claim 42, wherein the amount of allergenic beta-lactoglobulin is above 0.8 μg per g protein and/or wherein the composition comprises more than 1 wt % of peptides or proteins with a size of 1 kDa or above, based on total protein.
44. The nutritional composition according to claim 42, wherein the strain of lactic acid-producing bacterium belongs to the species Bifidobacterium breve.
45. The nutritional composition according to claim 42, wherein the non-digestible oligosaccharides comprises at least two non-digestible oligosaccharide(s) selected from the group consisting of fructo-oligosaccharides and galacto-oligosaccharides.
46. The nutritional composition according to claim 42, comprising 105 to 1011 cfu of lactic acid-producing bacteria per g dry weight.
47. The nutritional composition according to claim 42, which is an infant formula, follow-on formula or young child formula.
Description
DETAILED DESCRIPTION OF THE INVENTION
[0077] The present invention thus concerns a nutritional composition comprising a protein hydrolysate from mammalian milk, [0078] for use in induction of oral immune tolerance against milk protein and/or [0079] for use in prevention or treatment of oral immune intolerance against milk protein and/or [0080] for reducing the risk of developing oral immune intolerance against milk protein and/or [0081] for improving or enhancing of oral immune tolerance against milk protein, in a human subject, wherein the protein hydrolysate comprises at least two of the peptides having an amino acid sequence corresponding to the consecutive amino acids represented by SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4 and SEQ ID NO: 5. In a preferred embodiment, the composition comprises at least a peptide having an amino acid sequence corresponding to the consecutive amino acids represented by SEQ ID NO: 2 and/or SEQ ID NO: 4. In a preferred embodiment, the composition comprises at least a peptide having an amino acid sequence corresponding to SEQ ID NO: 4. In a preferred embodiment, the composition comprises at least a peptide having an amino acid sequence corresponding to SEQ ID NO: 5. In a preferred embodiment, the composition comprises at least three peptides selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4 and SEQ ID NO: 5, more preferably at least four peptides or even all five peptides selected from this group.
[0082] In a preferred embodiment, the protein hydrolysate comprises: [0083] (i) at least a peptide consisting of an amino acid sequence corresponding to the consecutive amino acids represented by sequence SEQ ID NO: 5 and at least one peptide consisting of an amino acid sequence corresponding to the consecutive amino acids represented by SEQ ID NO: 2, SEQ ID NO: 3 and SEQ ID NO: 4; or [0084] (ii) at least a peptide consisting of an amino acid sequence corresponding to the consecutive amino acids represented by SEQ ID NO: 4; or at least one peptide consisting of an amino acid sequence corresponding to the consecutive amino acids represented by SEQ ID NO: 1 and at least one peptide consisting of an amino acid sequence corresponding to the consecutive amino acids represented by SEQ ID NO: 2, SEQ ID NO: 3 and SEQ ID NO: 5.
[0085] These peptides are herein also referred to as “BLG-derived peptides”. The composition preferably further comprises a strain of a lactic acid-producing bacterium, more preferably further comprises one or more non-digestible oligosaccharides (NDO(s)) as defined further below. The mammalian milk is preferably milk from a species of the genus Bos, Bison, Bubalus or Capra, more preferably from genus Bos, preferably from cow's milk. Worded differently, the invention pertains to the use of a protein hydrolysate or BLG-derived peptides in the manufacture of the aforementioned nutritional composition for inducing oral immune tolerance against milk protein and/or in prevention or treatment of oral immune intolerance against milk protein and/or for reducing the risk of developing oral immune intolerance against milk protein in a human subject, preferably against milk protein from a species of the genus Bos, Bison, Bubalus or Capra, more preferably from genus Bos, preferably against cow's milk, wherein the nutritional composition comprises the protein hydrolysate as defined above, preferably according to (i) or (ii) as defined here above, said composition preferably further comprising a lactic acid-producing bacterium, more preferably comprising one or more NDO(s) as defined further below. Also, the invention pertains to a method for inducing oral immune tolerance against milk protein and/or for use in prevention or treatment of oral immune intolerance against milk protein and/or for reducing the risk of developing oral immune intolerance against milk protein in a human subject, preferably against milk protein from a species of the genus Bos, Bison, Bubalus or Capra, more preferably from genus Bos, preferably against cow's milk, the method comprising administering to the human subject the aforementioned nutritional composition comprising the protein hydrolysate as defined above, preferably according to (i) or (ii) as defined here above, said composition preferably further comprising a strain of a lactic acid-producing bacterium, more preferably comprising one or more NDO(s) as defined further below.
[0086] The present invention also concerns one or more BLG-derived peptides [0087] for use in inducing oral immune tolerance against milk protein and/or [0088] for use in prevention or treatment of oral immune intolerance against milk protein and/or [0089] for reducing the risk of developing oral immune intolerance against milk protein and/or [0090] for improving or enhancing of oral immune tolerance against milk protein, in a human subject, preferably against milk protein from a species of the genus Bos, Bison, Bubalus or Capra, more preferably from genus Bos, preferably against cow's milk, wherein said one or more BLG-derived peptides are characterized by comprising at least two of the peptides having a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4 and SEQ ID NO: 5, preferably according to (i) or (ii) as defined here above. Worded differently, the invention pertains to the use of one or more BLG-derived peptides in the manufacture of a nutritional composition for inducing oral immune tolerance against milk protein and/or for use in prevention or treatment of oral immune intolerance against milk protein and/or for reducing the risk of developing oral immune intolerance against milk protein in a human subject, preferably against milk protein from a species of the genus Bos, Bison, Bubalus or Capra, more preferably from genus Bos, preferably against cow's milk, wherein said one or more BLG-derived peptides are characterized by comprising at least two of the peptides having a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4 and SEQ ID NO: 5, preferably according to (i) (ii) as defined here above.
[0091] The invention also pertains to a (non-therapeutic) method [0092] for use in induction of oral immune tolerance against milk protein and/or [0093] for use in prevention or treatment of oral immune intolerance against milk protein and/or [0094] for reducing the risk of developing oral immune intolerance against milk protein and/or [0095] for improving or enhancing of oral immune tolerance against milk protein, in a human subject, preferably against milk protein from a species of the genus Bos, Bison, Bubalus or Capra, more preferably from genus Bos, preferably against cow's milk, comprising administering one or more BLG-derived peptides to the human subject, wherein the peptides are characterized by comprising at least two of the peptides having a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4 and SEQ ID NO: 5, preferably according to (i) or (ii) as defined here above. In a preferred embodiment of the above use or method, the one or more BLG-derived peptides are preferably administered in combination with a strain of a lactic acid-producing bacterium, more preferably in further combination with one or more non-digestible oligosaccharides (NDO(s)) as defined further below.
[0096] In one embodiment, [0097] induction of oral immune tolerance against milk protein and/or [0098] prevention or treatment of oral immune intolerance against milk protein and/or [0099] reduction of the risk of developing oral immune intolerance against milk protein and/or [0100] improving or enhancing of oral immune tolerance against milk protein concerns milk protein from a particular mammalian species and the hydrolysed milk protein comprised in the composition is form the same mammalian species, preferably both are from the genus Bos.
[0101] The term ‘improving or enhancing of oral immune tolerance against milk protein’ is understood to mean that oral immune tolerance against milk protein is improved compared to oral immune tolerance against the milk protein before start of administering of the composition of the invention.
[0102] Associated therewith, the invention also pertains to a nutritional composition comprising: [0103] a. a strain of lactic acid-producing bacterium belonging to the genus Bifidobacterium; [0104] b. a milk protein hydrolysate from a species of the genus Bos, Bison, Bubalus or Capra, more preferably from genus Bos, wherein the milk protein hydrolysate comprises at least two of the peptides having a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4 and SEQ ID NO: 5 [0105] c. less than 6 μg allergenic beta-lactoglobulin, preferably less than 3.5 μg beta-lactoglobulin, per g of total protein, [0106] d. less than 3 wt % of peptides or proteins having a size of 5 kDa or above, based on total protein, [0107] e. at least 50 wt %, preferably at least 95 wt % of hydrolysed whey protein based on total protein, [0108] f. optionally one or more non-digestible oligosaccharide(s) selected from the group consisting of fructooligosaccharide, non-digestible dextrin, galactooligosaccharide, xylooligosaccharide, arabino-oligosaccharide, arabinogalacto-oligosaccharide, gluco-oligosaccharide, glucomanno-oligosaccharide, galactomanno-oligosaccharide, mannan-oligosaccharide, chito-oligosaccharide, uronic acid oligosaccharide, sialyloligosaccharide, and fucooligosaccharide, and mixtures thereof, preferably fructo-oligosaccharides, and [0109] g. optionally long-chain polyunsaturated fatty acids, preferably docosahexaenoic acid (DHA), more preferably at least 0.35 wt. % DHA based on total fatty acids.
[0110] Associated therewith, the invention also pertains to a method for providing nutrition to a human subject at risk of developing or suffering from allergy, more preferably milk protein allergy, comprising administering to the human subject the nutritional composition as defined above.
[0111] The nutritional composition in the context of the present invention is defined here below, and all embodiments apply to all aspects of the invention, including the composition, the composition for use, the methods and the use according to the invention.
Peptides/Hydrolysate
[0112] The composition according to the invention comprises at least two peptides consisting of an amino acid sequence corresponding to the consecutive amino acids represented by SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4 and SEQ ID NO: 5. These peptides are derived or derivable from beta-lactoglobulin and thus addressed as beta-lactoglobulin-derived peptides. Throughout the specification and claims, the amino acid sequences of the BLG-peptides with SEQ ID NO: 1-5 are identified here below:
TABLE-US-00001 SEQ ID NO: 1: XIVTQTMKGLDIQKVAGTWYSLAMAAS SEQ ID NO: 2: XIVTQTMKGLDIQKVAGTWYSLAMAASDISLL SEQ ID NO: 3: TMKGLDIQKVAGTWYSLAMAASDISLL SEQ ID NO: 4: TMKGLDIQKVAGTWYSLAMAASDISLLDAQ SEQ ID NO: 5: DIQKVAGTWYSLAMAASDISLLDAQSAPLRVY
[0113] Herein, X defines an amino acid selected from leucine (L) or isoleucine (I), preferably X is leucine. SEQ ID NO: 1 wherein X=L is herein also referred to as SEQ ID NO: 9. SEQ ID NO: 1 wherein X=I is herein also referred to as SEQ ID NO: 37. SEQ ID NO: 2 wherein X=L is herein also referred to as SEQ ID NO: 11. SEQ ID NO: 2 wherein X=I is herein also referred to as SEQ ID NO: 38. The choice for X being either leucine or isoleucine is a direct consequence of the source of mammalian milk. Leucine is preferred, since mammalian milk from the genus Bos, preferably cow's milk, is most preferred.
[0114] Preferred embodiment (i) is based on the ProImmune ProPresent® antigen presentation assay where this mixture of peptides was found to cover more HLA-DRB1 alleles tested; preferred embodiment (ii) is based on experiments directed to T cell recognition of T cells from cow's milk allergic infants, where it was found that these peptides covered reactivity of every cell line.
[0115] The peptides are preferably provided by a protein hydrolysate (i.e. hydrolysed proteins) derived from mammalian milk, preferably milk from a species of the genus Bos, Bison, Bubalus or Capra, more preferably from genus Bos, most preferably from cow's milk (Bos taurus). The amino acid sequence of BLG in species of Bos and Bison are similar, and SEQ ID NOs: 9, 11, 3, 4 and 5 are obtainable in hydrolysates from milk protein of these species. In species of Capra and Bubalus amino acid 1 is different (an isoleucine instead of a leucine in SEQ ID NOs: 37 and 38), and SEQ ID NOs: 37, 38, 3, 4 and 5 are obtainable in hydrolysates from milk protein of these species. In a preferred embodiment, the peptides are derived from whey protein. The nutritional composition preferably comprises at least 50 wt %, more preferably at least 70 wt %, even more preferably at least 95 wt % of hydrolysed whey protein based on total protein. A suitable source is a mixture of acid whey protein and demineralised sweet whey protein. Acid whey and sweet whey are commercially available. Sweet whey is the by-product of rennet-coagulated cheese and comprises caseinoglycomacropeptide (CGMP), and acid whey (also called sour whey) is the by-product of acid-coagulated cheese, and does not contain CGMP. Suitable sources for the whey protein are demineralised whey (Deminal, Friesland Campina, the Netherlands) and/or whey protein concentrate (WPC80, Friesland Campina, the Netherlands). The whey protein preferably comprises acid whey, more preferably at least 50 wt %, more preferably at least 70 wt % acid whey, based on total whey protein. Acid whey has an improved amino acid profile compared to sweet whey protein.
[0116] Hydrolysis may be achieved using a mixture of microbial endopeptidases and exopeptidases using the method as described in example 1 of WO 2011/151059, herein incorporated by reference. Hydrolysates with the BLG-peptides according to SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4 and SEQ ID NO: 5 can preferably be prepared using the recipe according to example 1. Preferably a mixture of an endoprotease and exoprotease is employed. To determine whether any given composition comprises one or more of the BLG-derived peptides, means for identification are described in the experimental parts.
[0117] The composition preferably comprises less than 10 wt %, preferably less than 6 wt % of peptides or proteins with a size of 5 kDa or above, based on total protein. In one embodiment, the composition comprises more than 0.3 wt %, preferably more than 0.5 wt %, more preferably more than 1 wt %, even more preferably more than 1.5 wt % of these peptides with a size of 5 kDa or above, based on total protein. It is preferred that more than 1 wt % of peptides or proteins present in the composition has a size of 1 kDa or above, based on total protein, more preferably at least 5 wt %, more preferably at least 10 wt %, based on total protein. It is more preferred that more than 1 wt % of peptides or proteins present in the composition has a size of 3 kDa or above, based on total protein, more preferably at least 5 wt %, more preferably at least 10 wt %, based on total protein.
[0118] The size distribution of the peptides in the protein hydrolysate can be determined by means of size exclusion high pressure liquid chromatography as known in the art. Saint-Sauveur et al. “Immunomodulating properties of a whey protein isolate, its enzymatic digest and peptide fractions” Int. Dairy Journal (2008) vol. 18(3) pages 260-270 describes an example thereof. In short, the total surface area of the chromatograms is integrated and separated into mass ranges expressed as percentage of the total surface area. The mass ranges are calibrated using peptides/proteins with a known molecular mass. The protein hydrolysate comprising said peptides is preferably characterised in that it comprises between 64 and 89 wt % peptides with a molecular weight below 1000 Da, between 10 and 30 wt % peptides with a molecular weight between 1000 and 5000 Da and between 1 and 6 wt % of peptides or proteins with a molecular weight above 5 kDa, all based on total protein.
[0119] While the peptide weight distribution is informative, it does not provide any information about the sequence and activity of the peptides present in the formula. Structural information is crucial to understand the overall biological activity a hydrolysed infant formula might possess.
[0120] Consistently several specific peptides that originated from a region in BLG known to contain T-cell epitopes have been identified in different production batches. Only two studies investigated the peptide profile of pHP previously (VVada et al. Peptides 2015 73:101-105; Catala-Clariana et al, Electrophoresis 2013 Jul; 34(13):1886-1894). Although these studies focused on bioactive peptides in general and not specifically on T-cell epitopes, none of the peptides with SEQ ID NO: 1-5 identified in the present application were found in these previously tested products. In addition to the profiles of these hydrolyzed protein products, the peptide profile of a non-commercial available BLG-based hydrolysate has been determined (Pecquet et al J Allergy Clin Immunol 2000 Mar; 105(3):514-521). Also in this hydrolysate, two peptides (AA #21-40 and AA #25-40) that overlap with the region of interest in suit, but again no peptides with SEQ ID NO: 1-5 were identified. In at least two of the three studies reported above, a hydrolysate from a different manufacturer was investigated (Wada, and Pecquets) and as indicated above the main reason for these differences might be differences in manufacturing processes. This is further corroborated by a recent study in which extensively hydrolysed infant formulas from different manufactures were characterized with peptidomics. The authors showed that infant formulas from different manufacturers had a distinct signature based on their peptide profile and therefore might have a different effect in clinical trials (Lambers et al. Food Sci Nutr 2015 Jan; 3(1):81-90. Hochwallner et al, 2017, Allergy 72: 416-425).
[0121] In a preferred embodiment of the present invention, the present composition comprises, per gram of total protein, at least 10 mcg (microgram), more preferably 10 to 5000 mcg, more preferably 20 to 2000 mcg, more suitable 30 to 500 mcg and particularly preferably 50 to 250 mcg of the sum of the beta-lactoglobulin-derived peptide(s) consisting of an amino acid sequence represented by SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4 and SEQ ID NO: 5, more preferably consisting of an amino acid sequence represented by SEQ ID NO: 9, SEQ ID NO: 11, SEQ ID NO: 3, SEQ ID NO: 4 and SEQ ID NO: 5. The BLG-derived peptides are preferably present in therapeutically effective amounts.
[0122] It is preferred that the nutritional composition comprises less than 6 μg allergenic beta-lactoglobulin BLG per g protein, preferably less than 5 μg per g protein, more preferably less than 3.5 μg per g protein. In the context of the invention, the expression ‘allergenic beta-lactoglobulin’ refers to intact or immunogenic BLG, and does not account for the hydrolysed BLG. It is preferred that the nutritional composition comprises an amount of allergenic beta-lactoglobulin above 0.8 μg per g protein. Allergenic BLG is determined by ELISA as known in the art and an amount exceeding 0.8 μg per g protein is indicative for a partial protein hydrolysate. For sake of comparison, an extensively hydrolysed whey protein exhibits less than 0.2 μg allergenic BLG per g protein. Small but significant amounts of allergenic BLG together with the hydrolysed BLG or BLG-derived peptides, more preferably also in combination with a strain of lactic-acid producing bacterium, even more preferably also in combination with a lactic-acid producing bacterium and one or more NDO(s), enhances the tolerogenic capacity of the composition, yet the amount of BLG is still sufficiently low to reduce the allergenicity of the nutritional composition and for the nutritional composition to be hypoallergenic. From this perspective it is preferred to use a protein hydrolysate comprising the minor amount of allergenic beta-lactoglobulin and comprising the BLG-derived peptides according to the invention, over synthetic peptides consisting of an amino acid sequence represented by SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4 and SEQ ID NO: 5, more preferably consisting of an amino acid sequence represented by SEQ ID NO: 9, SEQ ID NO: 11, SEQ ID NO: 3, SEQ ID NO: 4 and SEQ ID NO: 5 (with no allergenic BLG).
Lactic Acid Producing Bacteria
[0123] The composition according to the invention preferably comprises a strain of lactic acid producing bacterium species, which enhances the oral immune tolerogenic capacity of the BLG peptides of the invention. The bacterium strain is preferably a probiotic. Evidence is provided in examples 5 and 7. The presence of lactic acid producing bacteria was found to increase the expression of HLA-DR molecules on the surface of the dendritic cells. An increased expression of HLA-DR is also indicative for an improved presentation of peptides to T cells, and hence oral immune tolerance induction.
[0124] Suitable lactic acid producing bacteria include strains of the genus Bifidobacteria (e.g. B. breve, B. longum, B. infantis, B. bifidum), Lactobacillus (e.g. L. acidophilus, L. paracasei, L. johnsonii, L. plantarum, L. reuteri, L. rhamnosus, L. casei, L. lactis), and Streptococcus (e.g. S. thermophilus). Bifidobacterium breve and Bifidobacterium longum are especially suitable lactic acid producing bacteria.
[0125] The composition preferably comprises a strain of lactic acid-producing bacterium belonging to the genus Bifidobacterium, preferably to the species Bifidobacterium breve. The B. breve preferably has at least 95% identity of the 16 S rRNA sequence when compared to the type strain of B. breve ATCC 15700, more preferably at least 97% identity (Stackebrandt & Goebel, 1994, Int. J. Syst. Bacteriol. 44:846-849). Suitable B. breve strains may be isolated from the faeces of healthy human milk-fed infants. Typically, these are commercially available from producers of lactic acid bacteria, but they can also be directly isolated from faeces, identified, characterised and produced. According to one embodiment, the present composition contains a B. breve selected from the group consisting of B. breve Bb-03 (Rhodia/Danisco), B. breve M-16V (Morinaga), B. breve R0070 (Institute Rosell, Lallemand), B. breve BR03 (Probiotical), B. breve BR92) (Cell Biotech), DSM 20091, LMG 11613, YIT4065, FERM BP-6223 and CNCM 1-2219. B. breve can be B. breve M-16V and B. breve CNCM 1-2219, most preferably B. breve M-16V. B. breve 1-2219 was published in WO 2004/093899 and was deposited at the Collection Nationale de Cultures de Microorganisms, Institute Pasteur, Paris, France on 31 May 1999 by Compagnie Gervais Danone. B. breve M-16V was deposited as BCCM/LMG23729 and is commercially available from Morinaga Milk Industry Co., Ltd.
[0126] The lactic acid producing bacterium may be present in the composition at any suitable concentration, preferably in a therapeutically effective amount or “amount effective for treating” in the context of the invention. Preferably, the lactic acid producing bacterium strain is included in the present composition in an amount of 10.sup.4-10.sup.13 cfu per g dry weight of the composition, preferably 10.sup.5-10.sup.11 cfu/g, most preferably 10.sup.6-10.sup.10 cfu/g.
Non-Digestible Oligosaccharides
[0127] In a preferred embodiment, the present composition additionally comprises one or more non-digestible oligosaccharides [NDO]. Like the lactic acid-producing bacteria, these further increase the oral immune tolerance inducing properties of peptides of the BLG protein. Evidence of an enhanced effect is given in example 5.
[0128] Advantageously and most preferred, the non-digestible oligosaccharide is water-soluble (according to the method disclosed in L. Prosky et al, J. Assoc. Anal. Chem 71: 1017-1023, 1988) and is preferably an oligosaccharide with a degree of polymerisation (DP) of 2 to 200. The average DP of the non-digestible oligosaccharide is preferably below 200, more preferably below 100, even more preferably below 60, most preferably below 40.
[0129] The non-digestible oligosaccharide is preferably a prebiotic. It is not digested in the intestine by the action of digestive enzymes present in the human upper digestive tract (small intestine and stomach). The non-digestible oligosaccharide is fermented by the human intestinal microbiota. For example, glucose, fructose, galactose, sucrose, lactose, maltose and the maltodextrins are considered digestible.
[0130] The oligosaccharide raw materials may comprise monosaccharides such as glucose, fructose, fucose, galactose, rhamnose, xylose, glucuronic acid, GalNac etc., but these are not part of the oligosaccharides. The non-digestible oligosaccharide is preferably selected from the group consisting of fructooligosaccharide, non-digestible dextrin, galactooligosaccharide, xylooligosaccharide, arabino-oligosaccharide, arabinogalacto-oligosaccharide, gluco-oligosaccharide, glucomanno-oligosaccharide, galactomanno-oligosaccharide, mannan-oligosaccharide, chito-oligosaccharide, uronic acid oligosaccharide, sialyloligosaccharide and fucooligosaccharide, and mixtures thereof, preferably fructo-oligosaccharides. Examples of sialyloligosaccharide are 3-sialyllactose, 6″ sialyllactose, sialyllacto-N-tetraoses, disialyllactoNtertraoses. Examples of fucooligosaccharides are (un)sulphated fucoidan oligosaccharides, 2′fucosyllactose, 3′ fucosyllactose, lacto-N-fucopentaose I, II, III, LNDH, lactodifucotetraose, lacto-N difucohexaose I and II.
[0131] One suitable type of oligosaccharide is a short-chain oligosaccharide which has an average degree of polymerisation of less than 10, preferably at most 8, preferably in the range of 2-7. The short-chain oligosaccharide preferably comprises galacto-oligosaccharides and/or fructo-oligosaccharides (i.e. scGOS and/or scFOS). In one embodiment, the composition comprises galacto-oligosaccharides, preferablybeta-galacto-oligosaccharides, preferably trans-galacto-oligosaccharides. The galacto-oligosaccharides preferably have an average degree of polymerisation in the range of 2-8, preferably 3-7, i.e. are short-chain oligosaccharides in the context of the invention. (Trans)galactooligosaccharides are for example available under the trade name Vivinal®GOS (Friesland Campina Domo Ingredients, Netherlands), Bimuno (Clasado), Cup-oligo (Nissin Sugar) and Oligomate55 (Yakult). The composition preferably comprises short-chain fructo-oligosaccharides and/or short-chain galacto-oligosaccharides, preferably at least short-chain fructo-oligosaccharides. Fructooligosaccharides may be inulin hydrolysate products having an average DP within the aforementioned (sub-) ranges; such FOS products are for instance commercially available as Raftilose P95 (Orafti) or with Cosucra.
[0132] Another suitable type of oligosaccharide is long-chain fructo-oligosaccharides (IcFOS) which has an average degree of polymerisation above 10, typically in the range of 10-100, preferably 15-50, most preferably above 20. A particular type of long-chain fructo-oligosaccharides is inulin, such as Raftilin HP.
[0133] The present composition may contain a mixture of two or more types of non-digestible oligosaccharides, most preferably a mixture of two non-digestible oligosaccharides. In case the NDO comprises or consists of a mixture of two distinct oligosaccharides, one oligosaccharide may be short-chain as defined above and one oligosaccharide may be long-chain as defined above. Most preferably, short-chain oligosaccharides and long-chain oligosaccharides are present in a weight ratio short-chain to long-chain in the range of 1:99-99:1, more preferably 1:1-99:1, more preferably 4:1-97:3, even more preferably 5:1-95:5, even more preferably 7:1-95:5, even more preferably 8:1-10:1, most preferably about 9:1.
[0134] In one embodiment, the composition comprises at least two of fructo-oligosaccharides and/or galacto-oligosaccharides. Suitable mixtures include mixtures of long-chain fructo-oligosaccharides with short-chain fructo-oligosaccharides or with short-chain galacto-oligosaccharides, most preferably long-chain fructo-oligosaccharides with short-chain fructo-oligosaccharides.
[0135] The present composition preferably comprises 0.05 to 20 wt % of said non-digestible oligosaccharides, more preferably 0.5 to 15 wt %, even more preferably 1 to 10 wt %, most preferably 2 to 10 wt %, based on dry weight of the present composition. When in liquid form, the present composition preferably comprises 0.01 to 2.5 wt % non-digestible oligosaccharide, more preferably 0.05 to 1.5 wt %, even more preferably 0.25 to 1.5 wt %, most preferably 0.5-1.25 wt %, based on 100 ml.
[0136] In one embodiment, the NDO mixture does not comprises any detectable amounts of acid oligosaccharides.
[0137] When the non-digestible oligosaccharide is a mixture, the averages of the respective parameters are used for defining the present invention.
[0138] The combination of a NDO and a lactic acid producing bacterium as defined here above is also referred to as a “synbiotic”. The presence of therapeutically effective amounts of the NDO together with the lactic acid-producing bacterium are believed to further improve the oral immune tolerance inducing properties A strain of Bifidobacterium, preferably B. breve, together with fructo-oligosaccharides. Reference is made to example 5.
Other Components
[0139] The composition may further comprise long chain polyunsaturated fatty acids (LC-PUFA). LC-PUFA are fatty acids wherein the acyl chain has a length of 20 to 24 carbon atoms (preferably 20 or 22 carbon atoms) and wherein the acyl chain comprises at least two unsaturated bonds between said carbon atoms in the acyl chain. More preferably the present composition comprises at least one LC-PUFA selected from the group consisting of eicosapentaenoic acid (EPA, 20:5 n3), docosahexaenoic acid (DHA, 22:6 n3), arachidonic acid (ARA, 20:4 n6) and docosapentaenoic acid (DPA, 22:5 n3), preferably DHA, EPA and/or ARA. Such LC-PUFAs have a further beneficial effect on reducing the risk for allergy.
[0140] The preferred content of LC-PUFA in the present composition does not exceed 15 wt. % of total fatty acids, preferably does not exceed 10 wt. %, even more preferably does not exceed 5 wt. %. Preferably the present composition comprises at least 0.2 wt. %, preferably at least 0.25 wt. %, more preferably at least 0.35 wt. %, even more preferably at least 0.5 wt. % LC-PUFA of total fatty acids, more preferably DHA. The present composition preferably comprises ARA and DHA, wherein the weight ratio ARA/DHA preferably is above 0.25, preferably above 0.5, more preferably 0.75-2, even more preferably 0.75-1.25. The weight ratio is preferably below 20, more preferably between 0.5 and 5. The amount of DHA is preferably above 0.2 wt %, more preferably above 0.3 wt %, more preferably at least 0.35 wt %, even more preferably 0.35-0.6 wt % on total fatty acids.
Nutritional Composition
[0141] The composition according to the invention can be used as a nutritional composition, nutritional therapy, nutritional support, as a medical food, as a food for special medical purposes or as a nutritional supplement. The present composition is preferably an enteral (oral) composition. The composition is administered orally to, or intended to be administered orally to, a subject in need thereof, in particular to children and infants, including toddlers, preferably children up to 6 years of age, preferably infants or young children typically with an age of 0-36 months, more preferably infants 0-12 months of age, most preferably 0-6 months of age. Thus, in some embodiments, the present composition is an infant formula, follow-on formula or young child formula (also referred to as growing-up milk), preferably it is an infant formula or follow-on formula, most preferably an infant formula. The term ‘infant formula’ is well-defined and controlled internationally and consistently by regulatory bodies. In particular, CODEX STAN 73-1981 “Standard For Infant Formula and Formulas For Special Medical Purposes Intended for Infants” is widely accepted. It recommends for nutritional value and formula composition, which require the prepared milk to contain per 100 ml not less than 60 kcal (250 kJ) and no more than 70 kcal (295 kJ) of energy. FDA and other regulatory bodies have set nutrient requirements in accordance therewith.
[0142] Preferably, the present enteral, preferably nutritional composition is for providing the daily nutritional requirements to a human, in particular for administration to, in particular for feeding, humans, in particular infants including toddlers, preferably at risk for developing milk protein allergy, preferably against milk protein from a species of the genus Bos, Bison, Bubalus or Capra, more preferably from genus Bos, most preferably cow's milk protein allergy. In one embodiment, the milk protein allergy concerns milk from a particular mammalian species and the hydrolysed milk protein comprised in the composition is form the same mammalian species, preferably both are from the genus Bos.
[0143] In order to meet the caloric requirements of the infant, the present enteral composition preferably comprises 50 to 200 kcal/100 ml liquid, more preferably 60 to 90 kcal/100 ml liquid, even more preferably 60 to 75 kcal/100 ml liquid. This caloric density ensures an optimal ratio between water and calorie consumption. The osmolarity of the present composition is preferably between 150 and 420 mOsmol/l, more preferably 260 to 320 mOsmol/l. The low osmolarity aims to reduce the gastrointestinal stress.
[0144] Preferably, the present enteral composition is in a liquid form, preferably with a viscosity below 35 mPa.Math.s, more preferably below 6 mPa.Math.s as measured in a Brookfield viscometer at 20° C. at a shear rate of 100 s-1. Suitably, the present enteral composition is in a powdered from, which preferably can be reconstituted with water to form a liquid, or in a liquid concentrate form, which should be diluted with water. When the present enteral composition is in a liquid form, the preferred volume administered on a daily basis is in the range of about 80 to 2500 ml, more preferably about 450 to 1000 ml per day.
[0145] The composition according to the invention preferably comprises a lipid component, preferably a lipid component suitable for infant nutrition as known in the art. The lipid component of the present composition preferably provides 2.9 to 6.0 g, more preferably 4 to 6 g per 100 kcal of the composition. When in liquid form, the composition preferably comprises 2.1 to 6.5 g lipid per 100 ml, more preferably 3.0 to 4.0 g per 100 ml. Based on dry weight the present infant or follow on formula preferably comprises 12.5 to 40 wt % lipid, more preferably 19 to 30 wt %.
[0146] The composition according to the invention may comprise further proteinaceous material, in addition to the beta-lactoglobulin-derived peptide(s) according to the invention. In the context of the present invention the additional “protein” or “proteinaceous material” or “protein equivalents” encompasses proteins, peptides, free amino acids and partially or extensively hydrolysed proteins.
[0147] Preferably, the further proteinaceous material—additional to the beta-lactoglobulin-derived peptide(s)—does not evoke an allergic reaction or is hypoallergenic, such as free amino acids, and hydrolysed protein. As a further protein component, i.e. apart from the beta-lactoglobulin-derived peptide(s), the composition according to the present invention preferably comprises free amino acids, hydrolysed whey protein, preferably partially hydrolysed whey proteins.
[0148] The composition according to the present invention preferably contains less than 1 wt % intact mammalian (cow)'s milk protein. The composition may comprise an additional protein component selected from the group consisting of free amino acids, hydrolysed whey protein and proteins from other sources such as soy, pea, rice, collagen or the like, in intact form, in partially hydrolysed form, and/or in extensively hydrolysed form.
[0149] The present composition preferably contains at least 50 wt % protein component derived from non-human milk, more preferably at least 90 wt %, based on dry weight of total protein.
[0150] The present composition preferably contains 4 to 25%, more preferably 5 to 20%, more preferably 7 to 16%, most preferably 7 to 12% protein, based on total calories. The present composition, when in liquid form, preferably contains 0.5 to 6.0 g, more preferably 0.8 to 3.0 g, even more preferably 1.0 to 2.5 g of protein per 100 ml. The present composition preferably comprises at least 7.0 wt %, more preferably at least 8.0 wt %, most preferably at least 9 or at least 10 wt % protein based on dry weight of the total composition. Preferably, the present composition comprises at most 40 wt %, more preferably at most 15 wt %, preferably at most 20 wt % of protein based on dry weight of the total composition.
[0151] The composition may comprise digestible carbohydrate(s). Typically, digestible carbohydrates that are known in the art to be suitable for use in infant nutritional compositions are used, for example selected from digestible polysaccharides (e.g. starch, maltodextrin), digestible monosaccharides (e.g. glucose, fructose), and digestible disaccharides (e.g. lactose, sucrose). Particularly suitable is lactose and/or maltodextrin. In one embodiment, the composition does not comprise lactose.
[0152] The digestible carbohydrate component preferably comprises at least 60 wt % lactose based on total digestible carbohydrate, more preferably at least 75 wt %, even more preferably at least 90 wt % lactose based on total digestible carbohydrate.
Human Subjects
[0153] The human subjects or population targeted is preferably infants (0-12 months), preferably infants at risk of developing allergy, preferably milk protein allergy, preferably milk protein from a species of the genus Bos, Bison, Bubalus or Capra, more preferably from genus Bos, most preferably cow's milk protein allergy, preferably infants suffering from milk protein allergy preferably against milk protein from a species of the genus Bos, Bison, Bubalus or Capra, more preferably from genus Bos, most preferably cow's milk protein allergy. Infants at risk are preferably determined by the family history, preferably at least one parent being or having a history of being allergic.
[0154] The human being preferably has a specific HLA-DRB1 allele selected form the groups consisting of HLA-DRB1 *01:01, HLA-DRB1*04:01, HLA-DRB1*04:04, HLA-DRB1*04:05, HLA-DRB1 7:01 and HLA-DRB1*09:01. The HLA-DRB1 is the most predominant human MHC class II isotypes (>90%) the HLA-DRB1 gene locus is polymorphic while HLA-DRA1 gene locus is monomorphic (i.e., HLA-DRB1 genotype determines the whole HLA-DR molecule), and HLA-DRB1 allele is expressed five times higher than its paralogs (HLA-DRB3, -DRB4 or -DRB5) and is present in all human beings.
Oral Immune Tolerance Induction
[0155] The invention pertains to [0156] the induction of oral immune tolerance against milk protein preferably against milk protein from a species of the genus Bos, Bison, Bubalus or Capra, more preferably from genus Bos, most preferably cow's milk protein in a human subject or population, or [0157] prevention or treatment of oral immune intolerance against milk protein preferably against milk protein from a species of the genus Bos, Bison, Bubalus or Capra, more preferably from genus Bos, most preferably cow's milk protein in a human subject or population, or [0158] reducing the risk of occurrence or development of oral immune intolerance against milk protein preferably against milk protein from a species of the genus Bos, Bison, Bubalus or Capra, more preferably from genus Bos, most preferably cows' milk protein, in a human subject or population, or [0159] improving or enhancing oral immune tolerance against milk protein preferably against milk protein from a species of the genus Bos, Bison, Bubalus or Capra, more preferably from genus Bos, most preferably cows' milk protein, in a human subject or population.
As addressed here above, the human subject or population is preferably an infant subject or population.
[0160] In the context of the present invention the term ‘oral tolerance’ means oral immune tolerance.
[0161] In a preferred embodiment, the invention pertains to a nutritional composition as defined here above, for use in prevention of oral immune intolerance against cow's milk protein in an infant subject or infant population at risk of developing milk protein allergy, preferably against milk protein from a species of the genus Bos, Bison, Bubalus or Capra, more preferably from genus Bos, most preferably cow's milk protein allergy. In a preferred embodiment, the invention pertains to a nutritional composition as defined here above, for use in reducing the risk of occurrence or development of oral immune intolerance against milk protein preferably against milk protein from a species of the genus Bos, Bison, Bubalus or Capra, more preferably from genus Bos, most preferably cow's milk protein, in an infant subject or infant population at risk of developing milk protein allergy, preferably against milk protein from a species of the genus Bos, Bison, Bubalus or Capra, more preferably from genus Bos, most preferably cow's milk protein allergy, wherein the partial mammalian protein hydrolysate has at least 1 wt %, more preferably at least 5 wt %, even more preferably at least 10 wt % peptides with molecular weight above 1 kDa and/or more than 0.8 μg allergenic BLG per g total protein.
FIGURE LEGENDS
[0162]
[0163]
Example 1: Hydrolysed Whey Protein and New Method for Identification of Betalactoglobulin Peptides
[0164] A mixture of acid whey protein and demineralised sweet whey protein (wt ratio protein 77:23) was dissolved in water (purified by reversed osmosis) and afterwards hydrolysed under specific conditions. Acid whey and sweet whey are commercially available. Sweet whey is the by-product of rennet-coagulated cheese and comprises caseinoglycomacropeptide (CGMP), and acid whey (also called sour whey) is the by-product of acid-coagulated cheese, and does not contain CGMP. Suitable sources for the acid whey protein are demineralised whey (Deminal, Friesland Campina, the Netherlands) and whey protein concentrate (WPC80, Friesland Campina, the Netherlands). A mixture of microbial endopeptidases and exopeptidases was used for hydrolysing these two protein sources using the method as described in example 1 of WO 2011/151059. Subsequently, the hydrolysed protein solution was spray dried. The size distribution of the peptides in this protein hydrolysate was determined by means of size exclusion high pressure liquid chromatography as known in the art. In short the total surface area of the chromatograms is integrated and separated into mass ranges expressed as percentage of the total surface area. The mass ranges are calibrated using peptides/proteins with a known molecular mass. The whey protein hydrolysate can be categorized as a partial or moderate protein hydrolysate.
[0165] The resulting hydrolysate powder was used as sole protein source in infant formulas. 10 different batches of infant fomulae were produced in a similar way. The amount of betalactoglobulin as determined by ELISA method as known in the art was between about 0.8 and 3.5 μg/g total protein.
[0166] In order to determine the presence of specific sequences in biological samples, mass spectrometry (MS) is the method of choice as opposed to the more traditional techniques that are currently used to characterize protein hydrolysates. A recent development in MS, termed peptidomics, allows for the characterization of peptide sequences with great sensitivity and specificity (Dallas et al. J Nutr 2015; 145:425-433). This technique is capable of closing the gap between understanding the impact of sequence specificity in relation to the biological activity a protein hydrolysate might have.
[0167] Samples were essentially prepared as described by Butré et al with the addition of a reduction and alkylation step (Butre et al. Anal Bioanal Chem 2014; 406):5827-5841). All chemicals were obtained from Sigma Aldrich. Briefly, the partial Hydrolysate protein (pHP) batches were diluted to 0.5% (v/v) using 50 mM ammonium bicarbonate followed by the reduction of peptides with 4 mM DTT and alkylation with 8 mM iodoacetamide. The mixture was cleared by centrifugation at 20,000×g for 10 min and diluted to 0.1% (v/v) using 0.1 M acetic acid.
[0168] All samples were analysed by nanoflow liquid chromatography using an Agilent 1200 HPLC system (Agilent Technologies) coupled on-line to a LTQ Velos mass spectrometer (Thermo Fisher Scientific). The liquid chromatography part of the system was operated in a setup essentially as described previously (14). Peptides were trapped at 5 μl/min in 100% solvent A (0.1 M acetic acid in water) on a 2-cm trap column (100-μm inner diameter, packed in-house using Aqua C18, 5-μm resin (Phenomenex)) and eluted to a 20-cm IntegraFrit column (50-μm inner diameter, ReproSil-Pur C18-AQ 3-μm, New Objective) at ˜100 nl/min in a 90-min gradient from 10 to 40% solvent B (0.1 M acetic acid in 8:2 (v/v) acetonitrile/water). The eluent was sprayed via standard coated emitter tips (New Objective) butt-connected to the analytical column. The mass spectrometer was operated in data-dependent mode, automatically switching between MS and MS/MS. Full scan mass spectra (from m/z 300 to 1,200) were acquired at zoom scan rate after accumulation to a target value of 3,000. The five most intense ions at a threshold above 500 were selected for collision-induced at normalized collision energy of 35% after accumulation to a target value of 10,000.
[0169] All MS data was processed by Proteome Discoverer (version 2.1, Thermo Scientific). Peak lists were generated using a standard workflow. Peptide identification was performed by searching individual peak lists of CID fragmentation spectra against a database containing selected bovine whey and casein proteins using Mascot (version 2.4.1, Matrix Science). No enzyme was specified and no missed cleavages were allowed. Precursor ion mass tolerance was set to 0.2 Da and product ion mass tolerance to 0.5 Da. Carbamidomethylation (C) was set as fixed modification.
[0170] Of the 314 peptides identified by this approach, 101 could be assigned to betalactoglobulin (BLG) leading to a sequence coverage of BLG of 90%. Most of the remaining peptides originated from other abundant whey proteins such as α-lactalbumin and serum albumin. In total 13 betalactoglobulin peptides of minimal 9 AAs were identified in the region of interest (AA #13-48) (See Table 1 and
TABLE-US-00002 TABLE 1 Sequences of the beta-lactoglobulin peptides identified in 10 different batched of a partially hydrolysed whey-based infant formula Number of Amino acid batches where number the peptide was in BLG identified to SEQ sequence Sequence be present ID NO AA 1-22 LIVTQTMKGLDIQKVAGTWYSL 7 6 AA 1-25 LIVTQTMKGLDIQKVAGTWYSLAMA 9 7 AA 1-26 LIVTQTMKGLDIQKVAGTWYSLAMAA 10 8 AA 1-27 LIVTQTMKGLDIQKVAGTWYSLAMAAS 10 9 AA 1-30 LIVTQTMKGLDIQKVAGTWYSLAMAASDIS 2 10 AA 1-32 LIVTQTMKGLDIQKVAGTWYSLAMAASDISLL 10 11 AA 1-35 LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQ 5 12 AA 1-39 LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPL 2 13 AA 1-42 LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVY 2 14 AA 5-35 QTMKGLDIQKVAGTWYSLAMAASDISLLDAQ 2 15 AA 6-32 TMKGLDIQKVAGTWYSLAMAASDISLL 10 3 AA 6-35 TMKGLDIQKVAGTWYSLAMAASDISLLDAQ 10 4 AA 11-42 DIQKVAGTWYSLAMAASDISLLDAQSAPLRVY 10 5
[0171] A similar analysis was performed with batches of Nutrilon pepti, an extensively hydrolysed whey protein containing infant formula marketed for the dietary management of cow's milk allergy. The BLG peptides of Table 1 were not present in Nutrilon pepti.
Example 2 In Vitro Identification of HLA-DR-Restricted Peptides
[0172] Identification of BLG-derived peptides presented by human DCs was performed by ProImmune, as described (Lamberth et al, Sci Transl Med 2017 11; 9(372):10.1126/scitranslmed.aag1286.). Briefly, peripheral blood mononuclear cell samples from 12 HLA-DR-typed healthy adult donors were obtained. The donors were selected based on common 11 HLA-DRB1 alleles (Table 2). The HLA-DRB1 was prioritized in this study due to the facts that the HLA-DR molecule is the most predominant human MHC class II isotypes (>90%) (Sturniolo et al. Nat Biotechnol 1999; 17:555-561.) and that HLA-DRB1 gene locus is polymorphic while HLA-DRA1 gene locus is monomorphic (i.e., HLA-DRB1 genotype determines the whole HLA-DR molecule) (Marsh et al, 2010. Tissue Antigens 75:291-455.). Furthermore, HLA-DRB1 allele is expressed five times higher than its paralogs (HLA-DRB3, -DRB4 or -DRB5) and is present in all individuals (O'Leary et al. Nucleic Acids Res 2016 4; 44(D1):D733-45.).
TABLE-US-00003 TABLE 2 Donors with HLA-DRB1 typing information Donor ID DRB1_1 DRB1_2 P1 *03:01 *03:01 P2 *01:01 *04:01 P3 *01:01 *07:01 P4 *01:01 *04:05 P5 *04:01 *07:01 P6 *13:02 *14:01 P7 *03:01 *09:01 P8 *11:01 *15:01 P9 *03:01 *11:01 P10 *07:01 *15:01 P11 *03:01 *15:01 P12 *01:01 *04:04
[0173] Immature monocyte-derived DCs were generated in vitro and matured in the presence of tested hydrolysed protein (HP). DCs were harvested and lysed in order to obtain HLA-DR complexes by using a specific immunoaffinity method. Peptides were eluted from the HLA-DR complexes and subsequently analyzed by high resolution sequencing LC-MS/MS. The presence of six endogenous relevant proteins (i.e., ITGAM, ApoB, CLIP, TFRC, FcER2/FcGR2 and LAMP-1/3) was assessed as a control for this assay. Each donor sample had to express a minimum of 3 relevant proteins to be qualified for subsequent analysis. The resulting data of HLA-DR-restricted peptides were compiled and assessed using sequence analysis software referencing the Swiss-Prot Human Proteome Database with the incorporated test item sequences. The likelihood of peptides to be real findings is described by their expect value 0.05. The false discovery rate was determined to be <1%.
[0174] Using the ProPresent® antigen presentation assay by focusing on BLG-derived sequences, 15 relevant peptides with an expect value 0.05 were identified within 5 donor samples (Table 3). These peptides could be further grouped into 2 unique sequence groups, i.e., DIQ . . . DIS (AA #11-30) and AMA . . . APL (AA #23-39) (Table 4). Importantly, both sequence groups overlapped with the region of interest (i.e., AA #13-48 of mature BLG). This finding demonstrated that BLG-derived peptides of interest can be presented by HLA-DR molecules on human DCs when incubated with a specific HP.
TABLE-US-00004 TABLE 3 Significant fragments identified from peptide-HLA-DR complexes with expect value <0.05. Donor Sequence of Fragment Amino Acid ID DRB1_1 DRB1_2 (Mature BLG) [SEQ ID NO] Start/End Expect Value P2 *01:01 *04:01 AMAASDISLLDAQSAPL-[16] 23-39 0.043 -MAASDISLLDAQSAPLR[17] 24-40 0.0013 P3 *01:01 *07:01 -MAASDISLLDAQSAPL-[18] 24-39 0.009 P4 *01:01 *04:05 DIQKVAGTWYSLAMAASDI-[19] 11-29 0.000052 ----VAGTWYSLAMAASDIS[20] 15-30 0.00021 ------GTWYSLAMAASDIS[21] 17-30 0.00037 P7 *03:01 *09:01 DIQKVAGTWYSLAMAASDI--[19] 11-29 0.00019 DIQKVAGTWYSLAMAASDIS-[22] 11-30 0.00053 ----VAGTWYSLAMAASDI--[23] 15-29 0.002 ----VAGTWYSLAMAASDIS-[20] 15-30 0.000019 -----AGTWYSLAMAASDIS-[24] 16-30 0.0014 ------GTWYSLAMAASDI--[25] 17-29 0.00023 ------GTWYSLAMAASDIS-[21] 17-30 0.000015 P12 *01:01 *04:04 AMAASDISLLDAQSAPL-[16] 23-39 0.028 -MAASDISLLDAQSAPL-[16] 24-39 0.042
TABLE-US-00005 TABLE 4 HLA-DR allele association on unique region of mature BLG with significant fragments were defined by having expect value <0.05. Number of Unique Region Significant (Mature BLG) Amino acid Fragments and Donor ID DRB1_1 DRB1_2 [SEQ ID NO] start-end individual fragment P2 *01:01 *04:01 AMAASDISLLDAQSAPLR [39] 23-40 2 (23-39 and 24-40) P3 *01:01 *07:01 MAASDISLLDAQSAPL [18] 24-39 1 (24-39) P4 *01:01 *04:05 DIQKVAGTWYSLAMAASDIS [22] 11-30 3 VAGTWYSLAMAASDIS [20] (11-29, 15-30, GTWYSLAMAASDIS [21] and 17-30) P7 *03:01 *09:01 DIQKVAGTWYSLAMAASDIS [22] 11-30 7 (11-29, 11-30, 25-29, 15-30, 16-30, 17-29, 17-30) P12 *01:01 *04:04 AMAASDISLLDAQSAPL [16] 23-39 2 (23-39, 24-39)
[0175] Not all donor antigen presenting cells bound to peptides. This concerned HLA-DRB1*03:01 in homozygous donor P1. Similar arguments could be applied for donors P6 and P11.
Example 3 MHC Class II Binding in Silico Assessment
[0176] A limitation of the ProPresent® antigen presentation assay is the usage of general anti-HLA-DR antibody, and not a specific antibody against a particular HLA-DRB1 allele (e.g., anti-DRB1*01:01 antibody), to isolate peptide-HLA-DR complexes of interest. Hence, with a donor with heterozygous genotypes of HLA-DRB1, e.g., *01:01 and *04:01, it is uncertain which allele will present the identified peptide.
[0177] Hence, the identified HLA-DR-restricted peptides were computed into the IEDB MHC Class II Binding Prediction software (http://tools.iedb.org/mhcii/) in order to assess binding of discovered peptides to the selected HLA-DRB1 alleles, as described (Wang P, et al. PLoS Comput Biol 2008 4; 4(4):e1000048.; Wang et al, BMC Bioinformatics 2010, 11:568-2105-11-568.) The default IEDB recommended prediction method was selected. For each peptide sequence (15 mers long), a percentile rank was generated by comparing the peptide's score against the scores of five million random 15 mers selected from the Swiss-Prot database. A lower percentile rank indicates a higher affinity of peptide binding to a particular MHC class II allele, in which the IEDB recommends to make a selection based on a consensus percentile rank of the top 10%. In order to be more stringent with the in silico assessment, a selection based on a consensus percentile rank of the top 3% was made.
[0178] The MHC class II prediction software was utilized to assess whether fragments of the identified two unique sequence groups of BLG would have high affinity to bind to the selected HLA-DRB1 alleles of the characterized donors from the ProPresent® assay, i.e., HLA-DRB1 *01:01, *03:01, *04:01, *04:04, *04:05, *07:01 and *09:01. As shown in Table 5, with an arbitrary threshold of percentile rank set at <3% (i.e., top 3% high binders), fragments of DIQ . . . DIS (AA #11-30) were predicted to have high affinity to bind to 5 HLA-DRB1 alleles, i.e., DRB1*01:01, *04:01, *04:04, *04:05 and *09:01. In contrast, it was estimated that only one fragment of AMA . . . APL (AA #23-39) bound to HLA-DRB1*07:01 with high affinity. Taken together, these findings suggest that fragments from AA #11-30 had a higher likelihood to be presented as T-cell epitopes than the ones from AA #23-39. Moreover, the data suggest that several common HLA-DRB1 alleles could present fragments derived from the identified two BLG-derived unique sequence groups.
[0179] These unique sequence groups of BLG (AA #11-30 and #23-39) overlapped and could be joined into one sequence (i.e., AA #11-39). This joined sequence was highly correlated with one constantly identified peptide in the tested HP (AA #11-42; DIQ . . . RVY). Therefore the sequence of AA #11-42 was subjected into the MHC class II prediction software. Importantly, the predicted complexes of AA #11-42 reconfirmed the predicted results of two in vitro identified unique sequences (Table 6), suggesting that both unique sequences of BLG could be derived from the AA #11-42 peptide that exists in the tested formula. Furthermore, parts of AA #11-42 were predicted to have high affinity to the same sets of identified HLA-DRB1 alleles, i.e., DRB1*01:01, *04:01, *04:04, *04:05, *07:01 and *09:01. In conclusion, the in silico assessment confirms the in vitro findings that BLG-derived peptides can bind to common HLA-DRB1 alleles.
TABLE-US-00006 TABLE 5 In silico assessment on potential peptide-HLA-DRB1 complexes of two identified BLG- derived peptides with percentile rank <3%. Predicted 15-mer Fragment of DIQKVAGTWYSLAMAASDIS (SEQ ID NO: 25) or HLA-DRB1 AMAASDISLLDAQSAPL (SEQ ID NO: 19) Percentile Allele [SEQ ID NO] Rank HLA-DRB1*09:01 AGTWYSLAMAASDIS [24] 0.86 HLA-DRB1*04:05 AGTWYSLAMAASDIS [24] 1.38 HLA-DRB1*04:05 VAGTWYSLAMAASDI [23] 1.40 HLA-DRB1*09:01 VAGTWYSLAMAASDI [23] 1.56 HLA-DRB1*04:05 KVAGTWYSLAMAASD [26] 2.26 HLA-DRB1*01:01 AGTWYSLAMAASDIS [24] 2.37 HLA-DRB1*04:04 AGTWYSLAMAASDIS [24] 2.44 HLA-DRB1*09:01 KVAGTWYSLAMAASD [26] 2.53 HLA-DRB1*04:01 AGTWYSLAMAASDIS [24] 2.84 HLA-DRB1*07:01 AASDISLLDAQSAPL [27] 2.39
TABLE-US-00007 TABLE 6 In silico assessment on potential peptide-HLA-DRB1 complexes of a BLG-derived long peptide with percentile rank <3 (top 3% binders). Predicted 15-mer Fragment of HLA-DRB1 DIQKVAGTWYSLAMAASDISLLDAQSAPLRVY Allele (SEQ ID NO: 5) [SEQ ID NO] Percentile Rank HLA-DRB1*09:01 GTWYSLAMAASDISL [28] 0.65 HLA-DRB1*09:01 AGTWYSLAMAASDIS [24] 0.86 HLA-DRB1*04:05 GTWYSLAMAASDISL [28] 1.30 HLA-DRB1*09:01 TWYSLAMAASDISLL [29] 1.32 HLA-DRB1*04:05 AGTWYSLAMAASDIS [24] 1.38 HLA-DRB1*04:05 VAGTWYSLAMAASDI [23] 1.40 HLA-DRB1*04:05 TWYSLAMAASDISLL [29] 1.40 HLA-DRB1*09:01 VAGTWYSLAMAASDI [23] 1.56 HLA-DRB1*09:01 WYSLAMAASDISLLD [30] 2.12 HLA-DRB1*09:01 YSLAMAASDISLLDA [31] 2.14 HLA-DRB1*01:01 GTWYSLAMAASDISL [28] 2.18 HLA-DRB1*04:05 KVAGTWYSLAMAASD [26] 2.26 HLA-DRB1*01:01 AGTWYSLAMAASDIS [24] 2.37 HLA-DRB1*07:01 AASDISLLDAQSAPL [27] 2.39 HLA-DRB1*07:01 SDISLLDAQSAPLRV [32] 2.44 HLA-DRB1*04:04 AGTWYSLAMAASDIS [24] 2.44 HLA-DRB1*04:04 GTWYSLAMAASDISL [28] 2.44 HLA-DRB1*04:04 TWYSLAMAASDISLL [29] 2.44 HLA-DRB1*01:01 TWYSLAMAASDISLL [29] 2.46 HLA-DRB1*09:01 KVAGTWYSLAMAASD [26] 2.53 HLA-DRB1*04:04 YSLAMAASDISLLDA [31] 2.57 HLA-DRB1*04:01 GTWYSLAMAASDISL [28] 2.83 HLA-DRB1*04:01 AGTWYSLAMAASDIS [24] 2.84 HLA-DRB1*04:04 WYSLAMAASDISLLD [30] 2.91
[0180] Several in silico assessments confirmed the in vitro ProPresent® findings on the peptide-HLA-DR complexes. However, we observed that some in silico predicted complexes did not correlate to the ones found in the ProPresent® assay, e.g., DRB1*04:04 with AGT . . . DIS. This discrepancy can be explained either by a small size of tested cohort in the ProPresent® assay (n=12), by the fact that each donor had a different combination of HLA-DRB1 allele types (i.e., interindividual variation) and/or by a tendency of in silico assessment to be over predictive (thus requires a stringent cut-off). Therefore, it is prudent to combine both in vitro and in silico approaches in order to identify peptide-MHC class II complexes.
Example 4 T-Cell Proliferation Assay
[0181] Synthetic peptides were obtained from JPT technologies. Only peptides containing at least 9 AAs were taken into account, as this is the minimal size for binding to MHC class II molecules and subsequent T-cell recognition (Holland et al, Front Immunol 2013 Jul 1; 4:172.) Synthetic peptides (JPT technologies) identical to the peptides identified in all batches of the HP of example 1 were dissolved in dimethylsulfoxide (Sigma Aldrich) at a concentration of 5.3 mM. The peptides were tested on cow's milk-specific T-cell lines (TCLs) from three different donors. The peptides were tested on cow's milk protein-specific T-cell lines (TCLs) from three infant donors, diagnosed with cow's milk protein allergy, aged <1 year, 7.5 months and 6 years old. These TCLs were generated previously and have been shown to recognize epitopes in the region of interest (AA #13-48 of mature BLG). Proliferation was determined as described previously (Ruiter et al, Clin Exp Allergy 2006, 36(3):303-310). Stimulation indexes (Sls, ratio between proliferation of allergen/peptide-stimulated and non-stimulated T cells) were calculated and a SI≥2 was considered positive.
[0182] To confirm that the peptides identified in HP were recognized by T cells, synthetic peptides identical to these identified peptides were tested on cow's milk-specific human TCLs. As there was a considered overlap between the identified peptides, five peptides were tested (Table 7) that were identified in all batches and differed with more than 9A from each other. All tested peptides were able to induce proliferation (
TABLE-US-00008 TABLE 7 Sequences of the beta-lactoglobulin peptides identified in 10 different batched of a partially hydrolysed whey-based infant formula and tested for T cell proliferation activity Amino acid number in BLG SEQ sequence Sequence ID NO AA 1-27 LIVTQTMKGLDIQKVAGTWYSLAMAAS 9 AA 1-32 LIVTQTMKGLDIQKVAGTWYSLAMAASDISLL 11 AA 6-32 TMKGLDIQKVAGTWYSLAMAASDISLL 3 AA 6-35 TMKGLDIQKVAGTWYSLAMAASDISLLDAQ 4 AA 11-42 DIQKVAGTWYSLAMAASDISLLDAQSAPLRVY 5
[0183] Not all peptides were recognized by each donor, which is an indicative for the variation between donors. Each donor expressed a different panel of MHC class II molecules. To determine if and which HLA-DRB1 allele expressed by the donors presented the peptides the same algorithm as described above was used. The in silico prediction confirmed that HLA-DRB1 alleles (*11:01 & *04:04) expressed by donor B were able to present all peptides. Based on the algorithm data TCL A should only recognize peptide DIQ . . . RVY (AA #11-42), however, this TCL showed a proliferative response after stimulation with four of the five peptides. A possible explanation might be that the other three peptides were not presented by HLA-DRB1 but by other MHC class II molecules.
[0184] In conclusion, example 1 to 4 demonstrate that a specific whey protein hydrolysate contains functional T-cell epitopes. Specific, beta-lactoglobulin peptides were identified to be present, that are HLA-DRB1 restricted peptides. These are presented to and recognized by T cells from different donors, including healthy donors and cow's milk protein allergic infants. This interaction was confirmed by in silico analysis. The HP may therefore stimulate the development of oral immunotolerance to protein.
Example 5: Synbiotic Mixture Shows a Further Improved Effect of Tolerance Induction Compared to Probiotics or Prebiotics Alone
[0185] Several published studies support a notion that dietary antigens (including peptides) within the intestinal lumen can be absorbed and subsequently captured and presented by intestinal antigen-presenting cells, i.e., antigen sampling mechanisms, without the need of a disrupted intestinal barrier. There are at least two distinct mechanisms that continuously work to sample dietary antigens at the healthy state, i.e., microfold/M cell-mediated transcytosis and goblet-cell-associated antigen passage. Both pathways provide dietary antigens to intestinal lamina propria CD103+ DCs, which in return could imprint gut-homing molecules on T and B cells, could promote differentiation of intestinal IgA-producing plasma cells as well as could generate intestinal Tregs, a key player in the state of hyporesponsiveness to fed antigen known as oral tolerance. This suggests that peptides within the tested HP can be orally absorbed, followed by antigen capture and presentation by intestinal CD103+ DCs and subsequently culminated in generation of functional Tregs.
[0186] For the development of oral tolerance, T-cell epitopes within the tested HP need to be presented under the right circumstances. In addition to TCR activation, co-stimulation and cytokine signalling play an important role in the generation of Tregs. Pro- or prebiotics play an important role in creating the right environment for this predisposition towards Tregs. The preventive effect of synthetic BLG peptides was strengthened in combination with a probiotic or prebiotic diet.
[0187] To demonstrate the effect of pro-, pre- and synbiotics an experiment was performed similar as described in example 4 of WO 2016/148572, with the same protocol, and the same concentration and mixture of synthetic peptides (‘Pepmix’), the pepmix identified in Table 8.
TABLE-US-00009 TABLE 8 pepmix according to WO 2016/148572 Peptide Sequence 1 (18AA) SEQ ID NO: 33 QKVAGTWYSLAMAASDIS 2 (18AA) SEQ ID NO: 34 WYSLAMAASDISLLDAQS 3 (18AA) SEQ ID NO: 35 AASDISLLDAQSAPLRVY 4 (18AA) SEQ ID NO: 36 LLDAQSAPLRVYVEELKP
[0188] A number of diets were compared: [0189] (a) synbiotic diet of example 1 of WO 2016/14472 (1 wt % scFOS/IcFOS in a wt ratio 9:1+2 wt % 2×10.sup.9 cfu/g Bifidobacterium breve M-16V, [0190] (b) probiotic diet of example 4 of WO 2016/148572 with 2 wt % 2×10.sup.9 cfu/g Bifidobacterium breve M-16V, and [0191] (c) prebiotic diet containing 1 wt % of scFOS/IcFOS wt ratio 9/1.
[0192] The short-chain (Sc-) and long-chain (Ic-) fructo-oligosaccharides (FOS) were commercially available as Raftilose P95 (Orafti) and Raftiline HP, respectively.
[0193] All groups were pretreated with the pepmix and one of the above diets, were sensitized with whey+cholera toxin and challenged with whey.
[0194] After challenge with whey, the delta ear swelling of the mice having consumed (c) scFOS/IcFOS diet was about 174 μm, of the mice having consumed (b) the probiotic diet was about 158 μm, and of the mice having consumed (a) the synbiotic diet was about 112 μm. The ear swelling in the synbiotic group (a) was statistically significantly lower than in the corresponding scFOS/IcFOS group (c), and there was a trend of a lower response when compared with probiotic group (b) (p=0.08). These results are indicative for a further improved effect on oral immunotolerance induction: [0195] when using a lactic acid-producing bacterium, in particular a Bifidobacterium strain from the species B. breve, and [0196] particularly when using a lactic-acid producing bacterium in combination with NDOs.
Example 6: MHC Binding Domains in the Natural, Identified Peptides of the Hydrolysate Vs Synthetic Beta-Lactoglobulin Peptides
[0197] Method: The sequences of the beta-lactoglobulin peptides that were identified in hydrolyzed infant formula (ID_PEP) and the sequences of the synthetic beta-lactoglobulin peptides that have been published in WO2016/148572 (SYN_PEP, Table 9) were tested in silico with the IEDB MHC Class II Binding Prediction Software (http://tools.iedb.org/mhcii/) to determine the number of MHC Class II binding domains in each peptide. In the software the IEDB recommended prediction method and the full HLA reference set were selected. This HLA reference set provides a population coverage of >99%. The software calculates a percentile rank by comparing the binding affinity of the predicted binding domain to a large set of peptides. The higher affinity, the lower the percentile rank. In this experiment, the top 2% binders were selected.
Results
[0198] The number of MHC class II binding domains in the identified peptides is higher than in synthetic peptides (see Table 9). The software predicted at least one binding domain for all identified peptides and in total six different domains. For the synthetic peptides four different domains were predicted. However, these domains were all derived from one sequence, namely SYN_PEP_1. No MHC Class II binding domains were predicted for the other two synthetic peptides.
TABLE-US-00010 TABLE 9 Number of MHC class II binding domains per betalactoglobulin peptide predicted IEBD Number of MHC class II binding Peptide Sequence domains ID_PEP_1 LIVTQTMKGLDIQKVAGTWYSLAMAAS 1 ID_PEP_2 LIVTQTMKGLDIQKVAGTWYSLAMAASDIS 6 LL ID_PEP_3 TMKGLDIQKVAGTWYSLAMAASDISLL 6 ID_PEP_4 TMKGLDIQKVAGTWYSLAMAASDISLLDAQ 6 ID_PEP_5 DIQKVAGTWYSLAMAASDISLLDAQSAPLR 6 VY SYN_PEP_1 QKVAGTWYSLAMAASDIS 4 SYN_PEP_2 WYSLAMAASDISLLDAQS 0 SYN_PEP_3 AASDISLLDAQSAPLRVY 0
[0199] The number of MHC Class II binding domains is higher in the identified peptides than in the synthetic peptides. In other words, more T cell epitopes can be derived from the identified peptides than from the synthetic peptides. Therefore, the likelihood that the identified peptides will be presented to T cells is higher. This presentation to T cells is a requirement for oral immune tolerance induction.
Example 7: HLA-DR Expression on Dendritic Cells after Maturation with a Lactic Acid Producing Bacterium
[0200] Method: Monocytes (CD14+ cells) were cultured for 7 days with GM-CSF and IL-4 to generate immature dendritic cells (DCs). After 7 days, the immature DCs were washed and incubated with either medium, LPS (100 ng/ml) or Bifidobacterium breve M-16V (Morinaga) in a 10:1 bacteria:DC ratio. After 48 hrs, the mature DCs were harvested and stained with APC-Cyanine7 labelled anti-human HLA-DR antibody to determine HLA-DR expression on the surface of the cells. The samples were analyzed on a BD FACS Canto flow cytometer with FACS DIVA software. Expression of HLA-DR is presented in mean fluorescence intensity (MFI).
[0201] Results: Maturation with Bifidobacterium breve M-16V (M16v-DCs) increases the expression of HLA-DR to a similar level as LPS (LPS-DCs, see Table 10).
TABLE-US-00011 TABLE 10 The expression of HLA-DR on different subtypes of dendritic cells DCs HLA-DR expression MFI (SD) Immature DCs 11338 (1919, 1) LPS-DCs 24676 (9694, 4) M16v-DCs 21714 (1516) DCs = dendritic cells, MFI = mean fluorescence intensity, SD = standard deviation
[0202] Bifidobacterium breve M-16V increases the expression of HLA-DR molecules on the surface of the dendritic cells. An increased expression of HLA-DR is indicative for an increased presentation of peptides to T cells.
Example 8: Infant Formula
[0203] A powdered infant formula packed with instructions that it should be reconstituted with water of 40° C. with 3 scoops of powder (13.74 g) added to 90 ml water, giving a final volume of 100 ml. The product is suitable from birth up to 6 months.
[0204] Per 100 ml the infant formula contains 66 kcal, 1.5 g protein (the hydrolysed whey protein of example 1), 3.3 g fat (vegetable oils, single cell oil and fish oil, comprising 0.4 wt % DHA and 0.35 wt % ARA based on total fatty acids), 7.2 g digestible carbohydrates (mainly lactose), 0.8 g non-digestible oligosaccharides (a 9/1 w/w mix of scGOS and IcFOS), Bifidobacterium breve M-16V in an amount of about 3*10.sup.7 cfu/g, and vitamins, minerals, trace elements and other micronutrients according to international directives for infant formulae.