Modified Red Blood Cells and Uses Thereof for Delivering Agents
20230399616 · 2023-12-14
Inventors
- Xiaofei Gao (Hangzhou, Zhejiang, CN)
- Yanjie Huang (Hangzhou, Zhejiang, CN)
- Xiaoqian Nie (Hangzhou, Zhejiang, CN)
Cpc classification
International classification
Abstract
Provided is a method for covalently modifying at least one membrane protein of a red blood cell (RBC), comprising contacting the RBC with a sortase substrate that comprises a sortase recognition motif and an agent, in the presence of a sortase under conditions suitable for the sortase to conjugate the sortase substrate to the at least one membrane protein of the RBC by a sortase-mediated reaction, wherein the sortase recognition motif comprising an optionally substituted hydroxyl carboxylic acid d located at position 5 from the direction of N-terminal to C-terminal. Also provided is a red blood cell (RBC) having an agent linked thereto obtained by the method, as well as the use of the RBC for delivering agents such as drugs and probes.
Claims
1. A method for covalently modifying at least one membrane protein of a red blood cell (RBC), comprising contacting the RBC with a sortase substrate that comprises a sortase recognition motif and an agent, in the presence of a sortase under conditions suitable for the sortase to conjugate the sortase substrate to the at least one membrane protein of the RBC by a sortase-mediated reaction, wherein the sortase substrate comprises a structure of A.sup.1-Sp-M, in which A.sup.1 represents an agent, Sp represents one or more optional spacers, and M represents a sortase recognition motif comprising an unnatural amino acid located at position 5 from the direction of N-terminal to C-terminal of the sortase recognition motif, wherein the unnatural amino acid is an optionally substituted hydroxyl carboxylic acid having a formulae of CH.sub.2OH—(CH.sub.2).sub.n—COOH, n being an integer from 0 to 3, preferably n=0.
2. The method of claim 1, wherein M comprises or consists essentially of or consists of an amino acid sequence selecting from a group consisting of LPXT*Y, LPXA*Y, LPXS*Y, LPXL*Y, LPXV*Y, LGXT*Y, LAXT*Y, LSXT*Y, NPXT*Y, MPXT*Y, IPXT*Y, SPXT*Y, VPXT*Y and YPXR*Y, wherein * represents the optionally substituted hydroxyl carboxylic acid; and X and Y independently represent any amino acid.
3. The method of claim 2, wherein M comprises or consists essentially of or consists of an amino acid sequence selecting from a group consisting of LPXT*G, LPXA*G, LPXS*G, LPXL*G, LPXV*G, LGXT*G, LAXT*G, LSXT*G, NPXT*G, MPXT*G, IPXT*G, SPXT*G, VPXT*G, YPXR*G, LPXT*S and LPXT*A, preferably M is LPET*G with * being 2-hydroxyacetic acid.
4. The method of any of claims 1-3, wherein the one or more Sp is selected from a group consisting of the following types: (1) zero-length type; (2) amine-sulfhydryl type; (3) homobifunctional NHS esters type; (4) homobifunctional imidoesters type; (5) carbonyl-sulfydryl type; (6) sulfhydryl reactive type; and (7) sulfhydryl-hydroxy type; and preferably the one or more Sp is an NHS ester-maleimide heterobifunctional crosslinker such as 6-Maleimidohexanoic acid and 4-Maleimidobutyric acid and the agent comprises an exposed sulfydryl, preferably an exposed cysteine, more preferably a terminal cysteine, most preferably a C-terminal cysteine.
5. The method of any of claims 1-4, wherein the at least one membrane protein is at least one endogenous, non-engineered membrane protein and the sortase substrate is conjugated to the at least one endogenous, non-engineered membrane protein of the RBC by a sortase-mediated glycine conjugation and/or a sortase-mediated lysine side chain ε-amino group conjugation.
6. The method of claim 5, wherein the sortase-mediated glycine conjugation and/or the sortase-mediated lysine side chain ε-amino group conjugation occur at least on glycine.sub.(n) and/or lysine ε-amino group, preferably at internal sites of the extracellular domain of the at least one endogenous, non-engineered membrane protein, preferably n being 1 or 2.
7. The method of claim 5 or 6, wherein the RBC has not been genetically engineered to express a protein comprising a sortase recognition motif or a nucleophilic acceptor sequence, and preferably the RBC is a natural RBC such as a natural human RBC.
8. The method of any of claims 1-7, wherein the sortase is capable of mediating a glycine.sub.(n) conjugation and/or a lysine side chain ε-amino group conjugation, preferably at internal sites of the extracellular domain of the at least one endogenous, non-engineered membrane protein, preferably n being 1 or 2.
9. The method of claim 8, wherein the sortase is a Sortase A (SrtA) such as a Staphylococcus aureus transpeptidase A variant (mgSrtA).
10. The method of claim 9, wherein the mgSrtA comprises or consists essentially of or consists of an amino acid sequence having at least 60% identity to an amino acid sequence as set forth in SEQ ID NO: 3.
11. The method of any of claims 1-10, wherein the agent comprises a binding agent, a therapeutic agent, or a detection agent, including for example a protein, a peptide such as an extracellular domain of oligomeric ACE2, an antibody or its functional antibody fragment, an antigen or epitope such as a tumor antigen, a MHC-peptide complex such as a complex comprising antigenic peptide of HPV (e.g., peptide of YMLDLQPET), a drug such as a small molecule drug (e.g., an antitumor agent such as a chemotherapeutic agent), an enzyme (e.g., a functional metabolic or therapeutic enzyme such as urate oxidase), a hormone, a cytokine, a growth factor, an antimicrobial agent, a probe, a ligand, a receptor, an immunotolerance-inducing peptide, a targeting moiety, a prodrug or any combination thereof.
12. The method of any of claims 1-11, wherein the covalently modified at least one membrane protein on the surface of the BRC comprises a structure of A.sup.1-L.sup.1-P.sup.1, in which L.sup.1 is linked to a glycine.sub.(n) in P.sup.1, and/or a structure of A.sup.1-L.sup.1-P.sup.2, in which L.sup.1 is linked to the side chain ε-amino group of lysine in P.sup.2, wherein n is preferably 1 or 2; A.sup.1 represents the agent; L.sup.1 is selected from the group consisting of LPXT, LPXA, LPXS, LPXL, LPXV, LGXT, LAXT, LSXT, NPXT, MPXT, IPXT, SPXT, VPXT, and YPXR; P.sup.1 and P.sup.2 independently represent the at least one membrane protein; and X represents any amino acid.
13. A red blood cell (RBC) obtained by the method of any of claims 1-12.
14. A composition comprising the red blood cell of any of claim 13 and optionally a physiologically acceptable carrier.
15. A method for diagnosing, treating or preventing a disorder, condition or disease in a subject in need thereof, comprising administering the red blood cell of claim 13 or the composition of claim 14 to the subject.
16. The method of claim 15, wherein the disorder, condition or disease is selected from a group consisting of tumors or cancers such as cervical carcinoma, metabolic diseases such as lysosomal storage disorders (LSDs) and gout, bacterial infections, virus infections such as human papilloma virus (HPV) infection and coronavirus infection for example SARS-COV or SARS-COV-2 infection, autoimmune diseases and inflammatory diseases.
17. A method of delivering an agent to a subject in need thereof, comprising administering the red blood cell of claim 13 or the composition of claim 14 to the subject.
18. A method of increasing the circulation time or plasma half-life of an agent in a subject, comprising providing a sortase substrate that comprises a sortase recognition motif and an agent, and conjugating the sortase substrate in the presence of a sortase under conditions suitable for the sortase to conjugate the sortase substrate to at least one membrane protein of a red blood cell by a sortase-mediated reaction, wherein the sortase substrate comprises a structure of A.sup.1-Sp-M, in which A.sup.1 represents an agent, Sp represents one or more optional spacers, and M represents a sortase recognition motif comprising an unnatural amino acid located at position 5 from the direction of N-terminal to C-terminal of the sortase recognition motif, wherein the unnatural amino acid is an optionally substituted hydroxyl carboxylic acid having a formulae of CH.sub.2OH—(CH.sub.2).sub.n—COOH, n being an integer from 0 to 3, preferably n=0.
19. The method of claim 18, wherein M comprises or consists essentially of or consists of an amino acid sequence selecting from a group consisting of LPXT*Y, LPXA*Y, LPXS*Y, LPXL*Y, LPXV*Y, LGXT*Y, LAXT*Y, LSXT*Y, NPXT*Y, MPXT*Y, IPXT*Y, SPXT*Y, VPXT*Y and YPXR*Y, wherein * represents the optionally substituted hydroxyl carboxylic acid; and X and Y independently represent any amino acid.
20. The method of claim 19, wherein M comprises or consists essentially of or consists of an amino acid sequence selecting from a group consisting of LPXT*G, LPXA*G, LPXS*G, LPXL*G, LPXV*G, LGXT*G, LAXT*G, LSXT*G, NPXT*G, MPXT*G, IPXT*G, SPXT*G, VPXT*G, YPXR*G, LPXT*S and LPXT*A, preferably M is LPET*G with * being 2-hydroxyacetic acid.
21. The method of any of claims 18-20, wherein the one or more Sp is selected from a group consisting of the following types: (1) zero-length type; (2) amine-sulfhydryl type; (3) homobifunctional NHS esters type; (4) homobifunctional imidoesters type; (5) carbonyl-sulfydryl type; (6) sulfhydryl reactive type; and (7) sulfhydryl-hydroxy type; and preferably the one or more Sp is an NHS ester-maleimide heterobifunctional crosslinker such as 6-Maleimidohexanoic acid and 4-Maleimidobutyric acid and the agent comprises an exposed sulfydryl, preferably an exposed cysteine, more preferably a terminal cysteine, most preferably a C-terminal cysteine.
22. The method of any of claims 18-21, wherein the at least one membrane protein is at least one endogenous, non-engineered membrane protein and the sortase substrate is conjugated to the at least one endogenous, non-engineered membrane protein of the RBC by a sortase-mediated glycine conjugation and/or a sortase-mediated lysine side chain ε-amino group conjugation.
23. The method of claim 22, wherein the sortase-mediated glycine conjugation and/or the sortase-mediated lysine side chain ε-amino group conjugation occur at least on glycine.sub.(n) and/or lysine ε-amino group, preferably at internal sites of the extracellular domain of the at least one endogenous, non-engineered membrane protein, preferably n being 1 or 2.
24. The method of claim 22 or 23, wherein the RBC has not been genetically engineered to express a protein comprising a sortase recognition motif or a nucleophilic acceptor sequence, and preferably the RBC is a natural RBC such as a natural human RBC.
25. The method of any of claims 18-24, wherein the sortase is capable of mediating a glycine.sub.(n) conjugation and/or a lysine side chain ε-amino group conjugation, preferably at internal sites of the extracellular domain of the at least one endogenous, non-engineered membrane protein, preferably n being 1 or 2.
26. The method of claim 25, wherein the sortase is a Sortase A (SrtA) such as a Staphylococcus aureus transpeptidase A variant (mgSrtA).
27. The method of claim 26, wherein the mgSrtA comprises or consists essentially of or consists of an amino acid sequence having at least 60% identity to an amino acid sequence as set forth in SEQ ID NO: 3.
28. The method of any of claims 18-27, wherein the agent comprises a binding agent, a therapeutic agent, or a detection agent, including for example a protein, a peptide such as an extracellular domain of oligomeric ACE2, an antibody or its functional antibody fragment, an antigen or epitope such as a tumor antigen, a MHC-peptide complex such as a complex comprising antigenic peptide of HPV (e.g., peptide of YMLDLQPET), a drug such as a small molecule drug (e.g., an antitumor agent such as a chemotherapeutic agent), an enzyme (e.g., a functional metabolic or therapeutic enzyme such as urate oxidase), a hormone, a cytokine, a growth factor, an antimicrobial agent, a probe, a ligand, a receptor, an immunotolerance-inducing peptide, a targeting moiety, a prodrug or any combination thereof.
29. The method of any of claims 18-28, wherein the covalently modified at least one membrane protein on the surface of the BRC comprises a structure of A.sup.1-L.sup.1-P.sup.1, in which L.sup.1 is linked to a glycine.sub.(n) in P.sup.1, and/or a structure of A.sup.1-L.sup.1-P.sup.2, in which L.sup.1 is linked to the side chain ε-amino group of lysine in P.sup.2, wherein n is preferably 1 or 2; A.sup.1 represents the agent; L.sup.1 is selected from the group consisting of LPXT, LPXA, LPXS, LPXL, LPXV, LGXT, LAXT, LSXT, NPXT, MPXT, IPXT, SPXT, VPXT and YPXR; P.sup.1 and P.sup.2 independently represent the at least one membrane protein; and X represents any amino acid.
30. Use of the red blood cell of claim 13 or the composition of claim 14 in the manufacture of a medicament for diagnosing, treating or preventing a disorder, condition or disease, or a diagnostic agent for diagnosing a disorder, condition or disease or for delivering an agent.
31. The use of claim 30, wherein the disorder, condition or disease is selected from a group consisting of tumors or cancers such as cervical carcinoma, metabolic diseases such as lysosomal storage disorders (LSDs) and gout, bacterial infections, virus infections such as human papilloma virus (HPV) infection and coronavirus infection for example SARS-COV or SARS-COV-2 infection, autoimmune diseases and inflammatory diseases.
32. The use of claim 31, wherein the medicament is a vaccine.
33. A red blood cell of claim 13 or the composition of claim 14 for use in diagnosing, treating or preventing a disorder, condition or disease in a subject in need thereof.
34. The red blood cell or composition of claim 33, wherein the disorder, condition or disease is selected from a group consisting of tumors or cancers such as cervical carcinoma, metabolic diseases such as lysosomal storage disorders (LSDs) and gout, bacterial infections, virus infections such as human papilloma virus (HPV) infection and coronavirus infection for example SARS-COV or SARS-COV-2 infection, autoimmune diseases and inflammatory diseases.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0045] In the drawings, embodiments of the present disclosure are illustrated by way of example. It is to be expressly understood that the description and drawings are only for the purpose of illustration and as an aid to understanding, and are not intended as a definition of the limits of the invention.
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
DETAILED DESCRIPTION
[0074] For the purposes of promoting an understanding of the principles of the present disclosure, reference will now be made to the embodiments illustrated in the drawings, and specific language will be used to describe the same. It will nevertheless be understood that no limitation of the scope of this disclosure is thereby intended.
[0075] In the present disclosure, unless otherwise specified, the scientific and technical terms used herein have the meanings as generally understood by a person skilled in the art. Although any methods and materials similar or equivalent to those described herein find use in the practice of the present invention, the preferred methods and materials are described herein. Accordingly, the terms defined herein are more fully described by reference to the Specification as a whole.
[0076] As used herein, the singular terms “a,” “an,” and “the” include the plural reference unless the context clearly indicates otherwise. Unless otherwise indicated, nucleic acids are written left to right in 5′ to 3′ orientation; amino acid sequences are written left to right in amino to carboxy orientation, respectively. It is to be understood that this invention is not limited to the particular methodology, protocols, and reagents described, as these may vary, depending upon the context they are used by those of skills in the art.
[0077] As used herein, the term “consisting essentially of” in the context of an amino acid sequence is meant the recited amino acid sequence together with additional one, two, three, four or five amino acids at the N- or C-terminus.
[0078] Unless the context requires otherwise, the terms “comprise”, “comprises” and “comprising”, or similar terms are intended to mean a non-exclusive inclusion, such that a recited list of elements or features does not include those stated or listed elements solely, but may include other elements or features that are not listed or stated.
[0079] As used herein, the terms “patient”, “individual” and “subject” are used in the context of any mammalian recipient of a treatment or composition disclosed herein. Accordingly, the methods and composition disclosed herein may have medical and/or veterinary applications. In a preferred form, the mammal is a human.
[0080] As used herein, the term “sequence identity” is meant to include the number of exact nucleotide or amino acid matches having regard to an appropriate alignment using a standard algorithm, having regard to the extent that sequences are identical over a window of comparison. Thus, a “percentage of sequence identity” is calculated by comparing two optimally aligned sequences over the window of comparison, determining the number of positions at which the identical nucleic acid base (e.g., A, T, C, G) occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison (i.e., the window size), and multiplying the result by 100 to yield the percentage of sequence identity. For example, “sequence identity” may be understood to mean the “match percentage” calculated by the DNASIS computer program (Version 2.5 for windows; available from Hitachi Software engineering Co., Ltd., South San Francisco, California, USA).
[0081] Recent studies have discovered mutant sortases with different specificities in motif recognition [4]. For instance, Ge et al. showed that an evolved SrtA variant (mg SrtA) is capable of recognizing the N-terminus of Gi-modified peptide, which cannot be achieved by wt SrtA [5]. In addition, membrane proteins with a single glycine at the N-terminus are much more abundant than those with 3× glycines. Ge et al. made an N-terminal sequence analysis of human membrane proteome with a predicted N-terminal glycine(s). The list of 182 proteins that contain N-terminal glycine residues after enzymatic removal of the signal peptide or the initiator methionine residue according to the previous study [7]. Among them, 176 proteins (96.70%) contain a single glycine residue at the N-terminus, 4 proteins (2.20%) contain a GG residue at the N-terminus, while only 2 proteins (1.10%) contain a G.sub.(n≥3) residue at the N-terminus. None of the 182 proteins is known to be expressed on the surface of mature human red blood cells.
[0082] Herein, the present disclosure is at least partially based on a surprising finding that in spite of the absence of known N-terminal glycine(s), it is possible to conjugate a sortase substrate to at least one endogenous, non-engineered membrane protein of natural human RBC by a sortase-mediated glycine conjugation and/or a sortase-mediated lysine side chain conjugation occurring at least on glycine.sub.(n=1 or 2) and lysine ε-amino group at internal sites of the extracellular domain of the at least one endogenous, non-engineered membrane protein. Without being limited by theory, it is contemplated that a non-canonical function of sortase enables conjugation of a sortase substrate to internal glycines.sub.(n=1 or 2) and/or lysine side chain ε-amino group in the extracellular domain of endogenous, non-engineered membrane protein. Also, without being limited by any theory, extensive tissue-specific mRNA splicing and protein translation during erythropoiesis might lead to exposure of glycine.sub.(n=1 or 2).
[0083] The inventors therefore develop a new strategy to covalently modify endogenous, non-engineered membrane proteins of natural RBCs with peptides and/or small molecules through a sortase-mediated reaction. The technology allows for producing RBC products by directly modifying natural RBCs instead of HSPCs which are limited by their resources. Also, the modified RBCs preserve their original biological properties well and remain stable as their native state.
[0084] Our results have shown that such a SrtA-mediated cell membrane protein labeling generally requires e.g. 200-1000 μM substrate protein. In order to more effectively increase the yield of the product and reduce the occurrence of reverse reactions, the inventors of the present disclosure further surprisingly found that modifying proteins by chemical coupling can greatly reduce the protein concentration required during a cell labeling process.
Red Blood Cells (RBCs)
[0085] In some aspects, the present disclosure provides a red blood cell (RBC) having an agent linked thereto, wherein the agent is linked to at least one endogenous, non-engineered membrane protein of the RBC by a sortase-mediated reaction. In some embodiments, the agent is linked to at least one endogenous, non-engineered membrane protein through a sortase-mediated glycine conjugation and/or a sortase-mediated lysine side chain ε-amino conjugation. In some embodiments, the sortase-mediated glycine conjugation and/or the sortase-mediated lysine side chain ε-amino group conjugation occur at least on glycine.sub.(n) and/or lysine ε-amino group in the extracellular domain (for example at internal sites of the extracellular domain) of the at least one endogenous, non-engineered membrane protein, preferably n being 1 or 2. In some embodiments, without being limited to any theory, the sortase-mediated glycine conjugation may occur at exposed glycine.sub.(n=1 or 2) of previously unreported membrane proteins due to tissue-specific mRNA splicing and protein translation during erythropoiesis. In some embodiments, the exposed glycine.sub.(n=1 or 2) may be N-terminal exposed glycine.sub.(n=1 or 2). In some embodiments, the sortase-mediated lysine side chain ε-amino group conjugation occurs at ε-amino group of terminal lysine or internal lysine of the extracellular domain. In some embodiments, the sortase-mediated glycine conjugation and/or the sortase-mediated lysine side chain ε-amino group conjugation may occur at glycine.sub.(n) and/or lysine ε-amino group at terminal (e.g., N-terminal) and/or internal sites of the extracellular domain of at least one endogenous, non-engineered membrane protein, preferably n being 1 or 2.
[0086] Unless otherwise indicated or clearly evident from the context, where the present disclosure refers to a red blood cell (RBC), it is generally intended to mean a mature red blood cell. In certain embodiments, the RBC is a human RBC, such as a human natural RBC.
[0087] In some embodiments, the RBC is a red blood cell that has not been genetically engineered to express a protein comprising a sortase recognition motif or a nucleophilic acceptor sequence. In some embodiments the RBC has not been genetically engineered. Unless otherwise indicated or clearly evident from the context, where the present disclosure refers to sortagging red blood cells it is generally intended to mean red blood cells that have not been genetically engineered for sortagging. In certain embodiments the red blood cells are not genetically engineered.
[0088] A red blood cell is considered “not genetically engineered for sortagging” if the cell has not been genetically engineered to express a protein comprising a sortase recognition motif or a nucleophilic acceptor sequence in a sortase-catalyzed reaction.
[0089] In some embodiments, the present disclosure provides red blood cells having an agent conjugated thereto via a sortase-mediated reaction. In some embodiments, a composition comprising a plurality of such cells is provided. In some embodiments, at least a selected percentage of the cells in the composition are modified, i.e., having an agent conjugated thereto by sortase. For example, in some embodiments at least 5%, 10%, 15%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99%, or more of the cells have an agent conjugated thereto. In some embodiments, the conjugated agent may be one or more of the agents described herein. In some embodiments, the agent may be conjugated to glycine.sub.(n) and/or lysine ε-amino group in one or more or all of the sequences as listed in Table 5 (e.g., SEQ ID NOs: 5-26). In some embodiments, the agent may be conjugated to glycine.sub.(n) and/or lysine ε-amino group in a sequence comprising SEQ ID NO: 5.
[0090] In some embodiments, the present disclosure provides a red blood cell that comprises an agent conjugated via a sortase-mediated reaction to a non-genetically engineered endogenous polypeptide expressed by the cell. In some embodiments, two, three, four, five or more different endogenous non-engineered polypeptides expressed by the cell have an agent conjugated thereto via a sortase-mediated reaction. The agents attached to different polypeptides may be the same or the cell may be sortagged with a plurality of different agents.
[0091] In some embodiments, the present disclosure provides a red blood cell (RBC) having an agent linked via a sortase mediated reaction to a glycine.sub.(n) or a side chain of lysine located anywhere (preferably internal sites) in an extracellular domain of at least one endogenous, non-engineered membrane protein on the surface of the BRC, wherein n is preferably 1 or 2. In some embodiments, the agent is linked to one or more (e.g., two, three, four or five) glycine.sub.(n) or lysine side chain ε-amino groups in or within the extracellular domain. In certain embodiment, the at least one endogenous, non-engineered membrane protein may be selected from a group consisting of the membrane proteins listed in Table 5 below or any combination thereof. In certain embodiment, the at least one endogenous non-engineered membrane protein may be selected from a group consisting of the 22 membrane proteins listed in Table 5 or any combination thereof. In some embodiments, the sortase-mediated glycine conjugation and/or the sortase-mediated lysine side chain ε-amino group conjugation may occur at glycine.sub.(n) and/or lysine ε-amino group in one or more or all of the sequences as listed in Table 5 (e.g., SEQ ID NOs: 5-26). In certain embodiments, the at least one endogenous non-engineered membrane protein may comprise extracellular calcium-sensing receptor (CaSR) (a parathyroid cell calcium-sensing receptor, PCaR1). In certain embodiments, the linking may be one or more or all of the modifications as shown in Table 5 below. In certain embodiments, the linking may occur on one or more positions selected from the modification positions as listed in Table 5 and any combination thereof, e.g., positions comprising G526 and/or K527 positions of CaSR; G158 and/or K162 of CD antigen CD3g; and/or G950 and/or K964 of TrpC2.
[0092] In some embodiments, without being limited to any theory, the agent may be linked to a protein selected from a group consisting of proteins listed in Tables 2, 3 and/or 4 below or any combination thereof.
[0093] In some embodiments, the present disclosure provides a red blood cell (RBC) having an agent linked to at least one endogenous, non-engineered membrane protein on the surface of the BRC. In some embodiments, the agent is linked via a sortase recognition motif to the at least one endogenous, non-engineered membrane protein. In some embodiments, the sortase recognition motif may be selected from a group consisting of LPXTG, LPXAG, LPXSG, LPXLG, LPXVG, LGXTG, LAXTG, LSXTG, NPXTG, MPXTG, IPXTG, SPXTG, VPXTG, YPXRG, LPXTS and LPXTA, wherein X is any amino acid. In some embodiments, the sortase recognition motif may comprise an unnatural amino acid located at position 5 from the direction of N-terminal to C-terminal of the sortase recognition motif, wherein the unnatural amino acid is an optionally substituted hydroxyl carboxylic acid having a formulae of CH.sub.2OH—(CH.sub.2).sub.n—COOH, n being an integer from 0 to 3, preferably n=0. In some embodiments, the sortase recognition motif comprising an unnatural amino acid may be selected from a group consisting of LPXT*Y, LPXA*Y, LPXS*Y, LPXL*Y, LPXV*Y, LGXT*Y, LAXT*Y, LSXT*Y, NPXT*Y, MPXT*Y, IPXT*Y, SPXT*Y, VPXT*Y and YPXR*Y, wherein * represents the optionally substituted hydroxyl carboxylic acid; and X and Y independently represent any amino acid. In some embodiments, the sortase recognition motif comprising a unnatural amino acid may be selected from a group consisting of LPXT*G, LPXA*G, LPXS*G, LPXL*G, LPXV*G, LGXT*G, LAXT*G, LSXT*G, NPXT*G, MPXT*G, IPXT*G, SPXT*G, VPXT*G, YPXR*G, LPXT*S and LPXT*A, preferably M is LPET*G with * preferably being 2-hydroxyacetic acid.
[0094] It can be understood that after the agent linked to the membrane protein, the last one or two residues from 5.sup.th position (from the direction of N-terminal to C-terminal) of the sortase recognition motif is replaced by the amino acid on which the linkage occurs, as described elsewhere herein. For example, the agent linked to the at least one endogenous, non-engineered membrane protein comprises A.sup.1-L.sup.1-P.sup.1, in which L.sup.1 is linked to a glycine.sub.(n) in P.sup.1, and/or a structure of A.sup.1-L.sup.1-P.sup.2, in which L.sup.1 is linked to the side chain ε-amino group of lysine in P.sup.2, wherein n is preferably 1 or 2; L.sup.1 is selected from the group consisting of LPXT, LPXA, LPXS, LPXL, LPXV, LGXT, LAXT, LSXT, NPXT, MPXT, IPXT, SPXT, VPXT and YPXR; A.sup.1 represents the agent; P.sup.1 and P.sup.2 independently represent the at least one endogenous, non-engineered membrane protein; and X represents any amino acids. In some embodiments, the agent linked to the at least one endogenous, non-engineered membrane protein comprises A.sup.1-LPXT-P.sup.1, in which LPXT is linked to a glycine.sub.(n) in P.sup.1, and/or a structure of A.sup.1-LPXT-P.sup.2, in which LPXT is linked to the side chain ε-amino group of lysine in P.sup.2, wherein n is preferably 1 or 2, A.sup.1 represents the agent, P.sup.1 and P.sup.2 independently represent the at least one endogenous, non-engineered membrane protein, and X represents any amino acids. In some embodiments, P.sup.1 and P.sup.2 may be the same or different. In some embodiments, the agent is linked to one or more (e.g., two, three, four, five or more) glycine.sub.(n) or lysine side chain ε-amino groups in or within an extracellular domain of the at least one endogenous, non-engineered membrane protein. In certain embodiment, the at least one endogenous, non-engineered membrane protein may be selected from a group consisting of the membrane proteins listed in Table 5 below or any combination thereof. In certain embodiment, the at least one endogenous non-engineered membrane protein may be selected from a group consisting of the 22 membrane proteins listed in Table 5 or any combination thereof. In some embodiments, the sortase-mediated glycine conjugation and/or the sortase-mediated lysine side chain ε-amino group conjugation may occur at glycine.sub.(n) and/or lysine ε-amino group in one or more or all of the sequences as listed in Table 5 (e.g., SEQ ID NOs: 5-26). In certain embodiments, at least one endogenous non-engineered membrane protein may comprise extracellular calcium-sensing receptor (CaSR) (a parathyroid cell calcium-sensing receptor, PCaR1). In certain embodiments, the linking may be one or more or all of the modifications as shown in Table 5 below. In certain embodiments, the linking may occur on one or more positions selected from the modification positions as listed in Table 5 and any combination thereof, e.g., positions comprising G526 and/or K527 positions of CaSR; G158 and/or K162 of CD antigen CD3g; and/or G950 and/or K964 of TrpC2.
[0095] In some embodiments, genetically engineered red blood cells are modified by using sortase to attach a sortase substrate to a non-genetically engineered endogenous polypeptide of the cell. The red blood cell may, for example, have been genetically engineered to express any of a wide variety of products, e.g., polypeptides or noncoding RNAs, may be genetically engineered to have a deletion of at least a portion of one or more genes, and/or may be genetically engineered to have one or more precise alterations in the sequence of one or more endogenous genes. In certain embodiments, a non-engineered endogenous polypeptide of such genetically engineered cell is sortagged with any of the various agents described herein.
[0096] In some embodiments, the present disclosure contemplates using autologous red blood cells that are isolated from an individual to whom such isolated red blood cells, after modified in vitro, are to be administered. In some embodiments, the present disclosure contemplates using immuno-compatible red blood cells that are of the same blood group as an individual to whom such cells are to be administered (e.g., at least with respect to the ABO blood type system and, in some embodiments, with respect to the D blood group system) or may be of a compatible blood group.
Endogenous, Non-Engineered Membrane Proteins
[0097] The terms “non-engineered, “non-genetically modified” and “non-recombinant” as used herein are interchangeable and refer to not being genetically engineered, absence of genetic modification, etc. Non-engineered membrane proteins encompass endogenous proteins. In certain embodiments, a non-genetically engineered red blood cell does not contain a non-endogenous nucleic acid, e.g., DNA or RNA that originates from a vector, from a different species, or that comprises an artificial sequence, e.g., DNA or RNA that was introduced artificially. In certain embodiments, a non-engineered cell has not been intentionally contacted with a nucleic acid that is capable of causing a heritable genetic alteration under conditions suitable for uptake of the nucleic acid by the cells.
[0098] In some embodiments, the endogenous non-engineered membrane proteins may encompass any or at least one of the membrane proteins listed in Table 5 below or any combination thereof. In certain embodiments, the endogenous non-engineered membrane proteins may encompass any or at least one of the 22 membrane proteins listed in Table 5 or any combination thereof. In certain embodiments, the endogenous non-engineered membrane proteins may encompass extracellular calcium-sensing receptor (CaSR) (a parathyroid cell calcium-sensing receptor, PCaR1).
Sortase
[0099] Enzymes identified as “sortases” have been isolated from a variety of Gram-positive bacteria. Sortases, sortase-mediated transacylation reactions, and their use in protein engineering are well known to those of ordinary skills in the art (see, e.g., PCT/US2010/000274 (WO/2010/087994), and PCT/US2011/033303 (WO/2011/133704)). Sortases have been classified into 4 classes, designated A, B, C, and D, based on sequence alignment and phylogenetic analysis of 61 sortases from Gram-positive bacterial genomes (Dramsi S, Trieu-Cuot P, Bierne H, Sorting sortases: a nomenclature proposal for the various sortases of Gram-positive bacteria. Res Microbiol. 156(3):289-97, 2005). Those skilled in the art can readily assign a sortase to the correct class based on its sequence and/or other characteristics such as those described in Drami, et al., supra. The term “sortase A” as used herein refers to a class A sortase, usually named SrtA in any particular bacterial species, e.g., SrtA from S. aureus or S. pyogenes.
[0100] The term “sortase” also known as transamidases refers to an enzyme that has transamidase activity. Sortases recognize substrates comprising a sortase recognition motif, e.g., the amino acid sequence LPXTG. A molecule recognized by a sortase (i.e., comprising a sortase recognition motif) is sometimes termed a “sortase substrate” herein. Sortases tolerate a wide variety of moieties in proximity to the cleavage site, thus allowing for the versatile conjugation of diverse entities so long as the substrate contains a suitably exposed sortase recognition motif and a suitable nucleophile is available. The terms “sortase-mediated transacylation reaction”, “sortase-catalyzed transacylation reaction”, “sortase-mediated reaction”, “sortase-catalyzed reaction”, “sortase reaction”, “sortase-mediated transpeptide reaction” and like terms, are used interchangeably herein to refer to such a reaction. The terms “sortase recognition motif”, “sortase recognition sequence” and “transamidase recognition sequence” with respect to sequences recognized by a transamidase or sortase, are used interchangeably herein. The term “nucleophilic acceptor sequence” refers to an amino acid sequence capable of serving as a nucleophile in a sortase-catalyzed reaction, e.g., a sequence comprising an N-terminal glycine (e.g., 1, 2, 3, 4, or 5 N-terminal glycines) or in some embodiments comprising internal glycines.sub.(n=1 or 2) or lysine side chain ε-amino group.
[0101] The present disclosure encompasses embodiments relating to any of the sortase classes known in the art (e.g., a sortase A, B, C or D from any bacterial species or strain). In some embodiments, sortase A is used, such as SrtA from S. aureus. In some embodiments it is contemplated to use two or more sortases. In some embodiments the sortases may utilize different sortase recognition sequences and/or different nucleophilic acceptor sequences.
[0102] In some embodiments, the sortase is a sortase A (SrtA). SrtA recognizes the motif LPXTG, with common recognition motifs being, e.g., LPKTG, LPATG, LPNTG. In some embodiments LPETG is used. However, motifs falling outside this consensus may also be recognized. For example, in some embodiments the motif comprises an ‘A’, ‘S’, ‘L’ or ‘V’ rather than a ‘T’ at position 4, e.g., LPXAG, LPXSG, LPXLG or LPXVG, e.g., LPNAG or LPESG, LPELG or LPEVG. In some embodiments the motif comprises an ‘A’ rather than a ‘G’ at position 5, e.g., LPXTA, e.g., LPNTA. In some embodiments the motif comprises a ‘G’ or ‘A’ rather than ‘P’ at position 2, e.g., LGXTG or LAXTG, e.g., LGATG or LAETG. In some embodiments the motif comprises an ‘I’ or ‘M’ rather than ‘L’ at position 1, e.g., MPXTG or IPXTG, e.g., MPKTG, IPKTG, IPNTG or IPETG. Diverse recognition motifs of sortase A are described in Pishesha et al. 2018.
[0103] In some embodiments, the sortase recognition sequence is LPXTG, wherein X is a standard or non-standard amino acid. In some embodiments, X is selected from D, E, A, N, Q, K, or R. In some embodiments, the recognition sequence is selected from LPXTG, LPXAG, LPXSG, LPXLG, LPXVG, LGXTG, LAXTG, LSXTG, NPXTG, MPXTG, IPXTG, SPXTG, VPXTG, YPXRG, LPXTS and LPXTA, wherein X may be any amino acids, such as those selected from D, E, A, N, Q, K, or R in certain embodiments.
[0104] In some embodiments, the sortase may recognizes a motif comprising an unnatural amino acid, preferably located at position 5 from the direction of N-terminal to C-terminal of the sortase recognition motif. The unnatural amino acid is a substituted or unsubstituted hydroxyl carboxylic acid having a formulae of CH.sub.2OH—(CH.sub.2).sub.n—COOH, n being an integer from 0 to 5, e.g., 0, 1, 2, 3, 4 and 5, preferably n=0. In some embodiments, the unnatural amino acid is a substituted hydroxyl carboxylic acid and in some further embodiments, the hydroxyl carboxylic acid is substituted by one or more substituents selected from halo, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, hydroxyl, C.sub.1-6 alkoxy, and C.sub.1-6 haloalkoxy. The term “halo” or “halogen” means fluoro, chloro, bromo, or iodo, and preferred are fluoro and chloro. The term “alkyl” by itself or as part of another substituent refers to a hydrocarbyl radical of Formula C.sub.nH.sub.2n+1 wherein n is a number greater than or equal to 1. In some embodiments, alkyl groups useful in the present disclosure comprise from 1 to 6 carbon atoms, preferably from 1 to 4 carbon atoms, more preferably from 1 to 3 carbon atoms, still more preferably 1 to 2 carbon atoms. Alkyl groups may be linear or branched and may be further substituted as indicated herein. C.sub.x-y alkyl refers to alkyl groups which comprise from x to y carbon atoms. Suitable alkyl groups include methyl, ethyl, n-propyl, i-propyl, n-butyl, i-butyl, s-butyl and tert-butyl, pentyl and its isomers (e.g. n-pentyl, iso-pentyl), and hexyl and its isomers (e.g. n-hexyl, iso-hexyl). Preferred alkyl groups include methyl, ethyl, n-propyl, i-propyl, n-butyl, i-butyl, s-butyl and tert-butyl. The term “haloalkyl” alone or in combination, refers to an alkyl radical having the meaning as defined above, wherein one or more hydrogens are replaced with a halogen as defined above. Non-limiting examples of such haloalkyl radicals include chloromethyl, 1-bromoethyl, fluoromethyl, difluoromethyl, trifluoromethyl, 1,1,1-trifluoroethyl and the like.
[0105] In some embodiments, the sortase recognition motif comprising an unnatural amino acid may be selected from a group consisting of LPXT*Y, LPXA*Y, LPXS*Y, LPXL*Y, LPXV*Y, LGXT*Y, LAXT*Y, LSXT*Y, NPXT*Y, MPXT*Y, IPXT*Y, SPXT*Y, VPXT*Y and YPXR*Y, wherein * represents the optionally substituted hydroxyl carboxylic acid; and X and Y independently represent any amino acid. In some embodiments, the sortase recognition motif comprising a unnatural amino acid may be selected from a group consisting of LPXT*G, LPXA*G, LPXS*G, LPXL*G, LPXV*G, LGXT*G, LAXT*G, LSXT*G, NPXT*G, MPXT*G, IPXT*G, SPXT*G, VPXT*G, YPXR*G, LPXT*S and LPXT*A, preferably M is LPET*G with * preferably being 2-hydroxyacetic acid.
[0106] In some embodiments, the present disclosure contemplates using a variant of a naturally occurring sortase. In some embodiments, the variant is capable of mediating a glycine.sub.(n) conjugation and/or a lysine side chain ε-amino group conjugation, preferably at internal sites of the extracellular domain of the at least one endogenous, non-engineered membrane protein of a red blood cell, preferably n being 1 or 2. Such variants may be produced through processes such as directed evolution, site-specific modification, etc. Considerable structural information regarding sortase enzymes, e.g., sortase A enzymes, is available, including NMR or crystal structures of SrtA alone or bound to a sortase recognition sequence (see, e.g., Zong Y, et al. J. Biol Chem. 2004, 279, 31383-31389). The active site and substrate binding pocket of S. aureus SrtA have been identified. One of ordinary skills in the art can generate functional variants by, for example, avoiding deletions or substitutions that would disrupt or substantially alter the active site or substrate binding pocket of a sortase. In some embodiments, directed evolution on SrtA can be performed by utilizing the FRET (Fluorescence Resonance Energy Transfer)-based selection assay described in Chen, et al. Sci. Rep. 2016, 6 (1), 31899. In some embodiments, a functional variant of S. aureus SrtA may be those described in CN10619105A and CN109797194A. In some embodiments, the S. aureus SrtA variant can be a truncated variant with e.g. 25-60 (e.g., 30, 35, 40, 45, 50, 55, 59 or 60) amino acids being removed from N-terminus.
[0107] In some embodiments, a functional variant of S. aureus SrtA useful in the present disclosure may be a S. aureus SrtA variant comprising one or more mutations on amino acid positions of D124, Y187, E189 and F200 of D124G, Y187L, E189R and F200L and optionally further comprising one or more mutations of P94S/R, D160N, D165A, K190E and K196T. In certain embodiments, the S. aureus SrtA variant may comprise D124G; D124G and F200L; P94S/R, D124G, D160N, D165A, K190E and K196T; P94S/R, D160N, D165A, Y187L, E189R, K190E and K196T; P94S/R, D124G, D160N, D165A, Y187L, E189R, K190E and K196T; D124G, Y187L, E189R and F200L; or P94S/R, D124G, D160N, D165A, Y187L, E189R, K190E, K196T and F200L. In some embodiments, the S. aureus SrtA variants have 59 or 60 (e.g., 25, 30, 35, 40, 45, 50, 55, 59 or 60) amino acids being removed from N-terminus. In some embodiments, the mutated amino acid positions above are numbered according to the numbering of a wild type S. aureus SrtA, e.g., as shown in SEQ ID NO: 1. In some embodiments, the full length nucleotide sequence of the wild type S. aureus SrtA is shown as in e.g., SEQ ID NO: 2.
TABLE-US-00001 (full length, GenBank Accession No.: CAA3829591.1) SEQ ID NO: 1 1 MKKWINRLMT IAGVVLILVA AYLESKPHID NYLHDKDKDE KIEQYDKNVK 51 EQASKDKKQQ AKPQIPKDKS KVAGYIEIPD ADIKEPVYPG PATPEQLNRG 101 VSFAEENESL DDQNISIAGH TFIDRPNYQF TNLKAAKKGS MVYFKVGNET 151 RKYKMTSIRD VKPTDVGVLD EQKGKDKOLT LITCDDYNEK TGVWEKRKIF 201 VATEVK (full length, wild type) SEQ ID NO: 2 ATGAAAAAATGGACAAATCGATTAATGACAATCGCTGGTGTGGTACTTATCCTAGTGGCAGC ATATTTGTTTGCTAAACCACATATCGATAATTATCTTCACGATAAAGATAAAGATGAAAAGA TTGAACAATATGATAAAAATGTAAAAGAACAGGCGAGTAAAGATAAAAAGCAGCAAGCTAAA CCTCAAATTCCGAAAGATAAATCGAAAGTGGCAGGCTATATTGAAATTCCAGATGCTGATAT TAAAGAACCAGTATATCCAGGACCAGCAACACCTGAACAATTAAATAGAGGTGTAAGCTTTG CAGAAGAAAATGAATCACTAGATGATCAAAATATTTCAATTGCAGGACACACTTTCATTGAC CGTCCGAACTATCAATTTACAAATCTTAAAGCAGCCAAAAAAGGTAGTATGGTGTACTTTAA AGTTGGTAATGAAACACGTAAGTATAAAATGACAAGTATAAGAGATGTTAAGCCTACAGATG TAGGAGTTCTAGATGAACAAAAAGGTAAAGATAAACAATTAACATTAATTACTTGTGATGAT TACAATGAAAAGACAGGCGTTTGGGAAAAACGTAAAATCTTTGTAGCTACAGAAGTCAAA
[0108] In some embodiments, as compared to a wild type S. aureus SrtA, the S. aureus SrtA variant may comprise one or more mutations at one or more of the positions corresponding to 94, 105, 108, 124, 160, 165, 187, 189, 190, 196 and 200 of SEQ ID NO: 1. In some embodiments, as compared to a wild type S. aureus SrtA, the S. aureus SrtA variant may comprise one or more mutations corresponding to P94S/R, E105K, E108A, D124G, D160N, D165A, Y187L, E189R, K190E, K196T and F200L. In some embodiments, as compared to a wild type S. aureus SrtA, the S. aureus SrtA variant may comprise one or more mutations corresponding to D124G, Y187L, E189R and F200L and optionally further comprises one or more mutations corresponding to P94S/R, D160N, D165A, K190E and K196T and optionally further one or more mutations corresponding to E105K and E108A. In certain embodiments, as compared to a wild type S. aureus SrtA, the S. aureus SrtA variant may comprise mutations corresponding to D124G; D124G and F200L; P94S/R, D124G, D160N, D165A, K190E and K196T; P94S/R, D160N, D165A, Y187L, E189R, K190E and K196T; P94S/R, D124G, D160N, D165A, Y187L, E189R, K190E and K196T; D124G, Y187L, E189R and F200L; or P94S/R, D124G, D160N, D165A, Y187L, E189R, K190E, K196T and F200L. In some embodiments, the S. aureus SrtA variant may comprise one or more mutations of P94S/R, E105K, E108A, D124G, D160N, D165A, Y187L, E189R, K190E, K196T and F200L relative to SEQ ID NO: 1. In some embodiments, the S. aureus SrtA variant may comprise D124G, Y187L, E189R and F200L and optionally further comprises one or more mutations of P94S/R, D160N, D165A, K190E and K196T and optionally further comprises E105K and/or E108A relative to SEQ ID NO: 1. In certain embodiments, the S. aureus SrtA variant may, comprise, relative to SEQ ID NO: 1, D124G; D124G and F200L; P94S/R, D124G, D160N, D165A, K190E and K196T; P94S/R, D160N, D165A, Y187L, E189R, K190E and K196T; P94S/R, D124G, D160N, D165A, Y187L, E189R, K190E and K196T; D124G, Y187L, E189R and F200L; or P94S/R, D124G, D160N, D165A, Y187L, E189R, K190E, K196T and F200L. In some embodiments, mutations E105K and/or E108A/Q allows the sortase-mediated reaction to be Ca.sup.2+ independent. In some embodiments, the S. aureus SrtA variants as described herein may have 25-60 (e.g., 25, 30, 35, 40, 45, 50, 55, 56, 57, 58, 59, or 60) amino acids being removed from N-terminus. In some embodiments, the mutated amino acid positions above are numbered according to the numbering of a full length of a wild type S. aureus SrtA, e.g., as shown in SEQ ID NO: 1.
[0109] In some embodiments, a functional variant of S. aureus SrtA useful in the present disclosure may be a S. aureus SrtA variant comprising one or more mutations of P94S/R, E105K, E108A/Q, D124G, D160N, D165A, Y187L, E189R, K190E, K196T and F200L. In certain embodiments, the S. aureus SrtA variant may comprise P94S/R, E105K, E108Q, D124G, D160N, D165A, Y187L, E189R, K190E, K196T and F200L; or P94S/R, E105K, E108A, D124G, D160N, D165A, Y187L, E189R, K190E, K196T and F200L. In some embodiments, the S. aureus SrtA variant may comprise one or more mutations of P94S/R, E105K, E108A/Q, D124G, D160N, D165A, Y187L, E189R, K190E, K196T and F200L relative to SEQ ID NO: 1. In certain embodiments, the S. aureus SrtA variant may comprise P94S/R, E105K, E108Q, D124G, D160N, D165A, Y187L, E189R, K190E, K196T and F200L relative to SEQ ID NO: 1; or P94S/R, E105K, E108A, D124G, D160N, D165A, Y187L, E189R, K190E, K196T and F200L relative to SEQ ID NO: 1. In some embodiments, the S. aureus SrtA variants have 25-60 (e.g., 25, 30, 35, 40, 45, 50, 55, 56, 57, 58, 59, or 60) amino acids being removed from N-terminus. In some embodiments, the mutated amino acid positions above are numbered according to the numbering of a wild type S. aureus SrtA, e.g., as shown in SEQ ID NO: 1.
[0110] In some embodiments, the present disclosure contemplates a S. aureus SrtA variant (mg SrtA) comprising or consisting essentially of or consisting of an amino acid sequence having at least 60% (e.g., at least 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.9% or higher) identity to an amino acid sequence as set forth in SEQ ID NO: 3. In some embodiments, SEQ ID NO: 3 is a truncated SrtA and the mutations corresponding to wild type SrtA are shown in bold and underlined below. In some embodiments, the SrtA variant comprises or consists essentially of or consists of an amino acid sequence having at least 60% (e.g., at least 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.9% or higher) identity to an amino acid sequence as set forth in SEQ ID NO: 3 and comprises the mutations of P94R/S, D124G, D160N, D165A, Y187L, E189R, K190E, K196T and F200L and optionally E105K and/or E108A/Q (numbered according to the numbering of SEQ ID NO: 1).
TABLE-US-00002 (mutations shown in bold and underlined) SEQ ID NO: 3 1 KPHIDNYLHD KDKDEKIEQY DKNVKEQASK DKKQQAKPQI PKDKSKVAGY 51 IEIPDADIKE PVYPGPATRE QLNRGVSFAE ENESLDDONI SIAGHTFIGR 101 PNYQFTNLKA AKKGSMVYFK VGNETRKYKM TSIRNVKPTA VGVLDEQKGK 151 DKOLTLITCD DLNRETGVWE TRKILVATEV K
[0111] In some embodiments, the present disclosure provides a nucleic acid encoding the S. aureus SrtA variant, and in some embodiments the nucleic acid is set forth in SEQ ID NO: 4.
TABLE-US-00003 SEQ ID NO: 4 AAACCACATATCGATAATTATCTTCACGATAAAGATAAAGA TGAAAAGATTGAACAATATGATAAAAATGTAAAAGAACAG GCGAGTAAAGATAAAAAGCAGCAAGCTAAACCTCAAATTC CGAAAGATAAATCGAAAGTGGCAGGCTATATTGAAATTCC AGATGCTGATATTAAAGAACCAGTATATCCAGGACCAGCA ACACGTGAACAATTAAATAGAGGTGTAAGCTTTGCAGAAG AAAATGAATCACTAGATGATCAAAATATTTCAATTGCAGG ACACACTTTCATTGGCCGTCCGAACTATCAATTTACAAAT CTTAAAGCAGCCAAAAAAGGTAGTATGGTGTACTTTAAAG TTGGTAATGAAACACGTAAGTATAAAATGACAAGTATAAG AAATGTTAAGCCTACAGCTGTAGGAGTTCTAGATGAACAA AAAGGTAAAGATAAACAATTAACATTAATTACTTGTGATG ATCTTAATCGGGAGACAGGCGTTTGGGAAACACGTAAAAT CTTGGTAGCTACAGAAGTCAAA
[0112] In some embodiments, a sortase A variant may comprise any one or more of the following: an S residue at position 94 (S94) or an R residue at position 94 (R94), a K residue at position 105 (K105), an A residue at position 108 (A108) or a Q residue at position 108 (Q 108), a G residue at position 124 (G124), an N residue at position 160 (N160), an A residue at position 165 (A165), a R residue at position 189 (R189), an E residue at position 190 (E190), a T residue at position 196 (T196), and an L residue at position 200 (L200) (numbered according to the numbering of a wild type SrtA, e.g., SEQ ID NO: 1), optionally with about 25-60 (e.g., 25, 30, 35, 40, 45, 50, 55, 56, 57, 58, 59, or 60) amino acids being removed from N-terminus of the wild type S. aureus SrtA. For example, in some embodiments a sortase A variant comprises two, three, four, or five of the afore-mentioned mutations relative to a wild type S. aureus SrtA (e.g., SEQ ID NO: 1). In some embodiments a sortase A variant comprises an S residue at position 94 (S94) or an R residue at position 94 (R94), and also an N residue at position 160 (N160), an A residue at position 165 (A165), and a T residue at position 196 (T196) relative to a wild type S. aureus SrtA (e.g., SEQ ID NO: 1). For example, in some embodiments, a sortase A variant comprises P94S or P94R, and also D160N, D165A, and K196T relative to a wild type S. aureus SrtA (e.g., SEQ ID NO: 1). In some embodiments a sortase A variant comprises an S residue at position 94 (S94) or an R residue at position 94 (R94) and also an N residue at position 160 (N160), A residue at position 165 (A165), an E residue at position 190, and a T residue at position 196 relative to a wild type S. aureus SrtA (e.g., SEQ ID NO: 1). For example, in some embodiments a sortase A variant comprises P94S or P94R, and also D160N, D165A, K190E, and K196T relative to a wild type S. aureus SrtA (e.g., SEQ ID NO: 1). In some embodiments a sortase A variant comprises an R residue at position 94 (R94), an N residue at position 160 (N160), a A residue at position 165 (A165), E residue at position 190, and a T residue at position 196 relative to a wild type S. aureus SrtA (e.g., SEQ ID NO: 1). In some embodiments a sortase comprises P94R, D160N, D165A, K190E, and K196T relative to a wild type S. aureus SrtA (e.g., SEQ ID NO: 1). In some embodiments, the S. aureus SrtA variants may have 25-60 (e.g., 25, 30, 35, 40, 45, 50, 55, 56, 57, 58, 59 or 60) amino acids being removed from N-terminus.
[0113] In some embodiments, a sortase A variety having higher transamidase activity than a naturally occurring sortase A may be used. In some embodiments the activity of the sortase A variety is at least about 10, 15, 20, 40, 60, 80, 100, 120, 140, 160, 180, or 200 times as high as that of wild type S. aureus sortase A. In some embodiments such a sortase variant is used in a composition or method of the present disclosure. In some embodiments a sortase variant comprises any one or more of the following substitutions relative to a wild type S. aureus SrtA: P94S/R, E105K, E108A, E108Q, D124G, D160N, D165A, Y187L, E189R, K190E, K196T and F200L mutations. In some embodiments, the SrtA variant may have 25-60 (e.g., 30, 35, 40, 45, 50, 55, 59 or 60) amino acids being removed from N-terminus.
[0114] In some embodiments, the amino acid mutation positions are determined by an alignment of a parent S. aureus SrtA (from which the S. aureus SrtA variant as described herein is derived) with the polypeptide of SEQ ID NO: 1, i.e., the polypeptide of SEQ ID NO: 1 is used to determine the corresponding amino acid sequence in the parent S. aureus SrtA. Methods for determining an amino acid position corresponding to a mutation position as described herein is well known in the art. Identification of the corresponding amino acid residue in another polypeptide can be confirmed by using the Needleman-Wunsch algorithm (Needleman and Wunsch, 1970, J. Mol. Biol. 48: 443-453) as implemented in the Needle program of the EMBOSS package (EMBOSS: The European Molecular Biology Open Software Suite, Rice et al., 2000, Trends Genet. 16: 276-277), preferably version 3.0.0 or later. Based on above well-known computer programs, it is routine work for those of skills to determine the amino acid position of a polypeptide of interest as described herein.
[0115] In some embodiments, the sortase variant may further comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 conservative amino acid mutations. Conservative amino acid mutations that will not substantially affect the activity of a protein are well known in the art.
[0116] In some embodiments, the present disclosure provides a method of identifying a sortase variant candidate for conjugating an agent to at least one endogenous, non-engineered membrane protein of a red blood cell, comprising contacting the red blood cell with a sortase substrate that comprises a sortase recognition motif and an agent, in the presence of the sortase variant candidate under conditions suitable for the sortase variant candidate to conjugate the sortase substrate to the at least one endogenous, non-engineered membrane protein of the RBC by a sortase-mediated reaction, preferably by a sortase-mediated glycine conjugation and/or a sortase-mediated lysine side chain ε-amino group conjugation. In some embodiments, the sortase-mediated glycine conjugation and/or the sortase-mediated lysine side chain ε-amino group conjugation occur at least on glycine.sub.(n) and/or lysine ε-amino group at internal sites of the extracellular domain of the at least one endogenous, non-engineered membrane protein, preferably n being 1 or 2. In some embodiments, the method further comprises selecting the sortase variant capable of conjugating an agent to at least one endogenous, non-engineered membrane protein of a red blood cell.
[0117] In some embodiments, the present disclosure contemplates administering a sortase and a sortase substrate to a subject to conjugate in vivo the sortase substrate to red blood cells. For this purpose, it is desirable to use a sortase that has been further modified to enhance its stabilization in circulation and/or reduce its immunogenicity. Methods for stabilizing an enzyme in circulation and for reducing enzyme immunogenicity are well known in the art. For example, in some embodiments, the sortase has been PEGylated and/or linked to an Fc fragment at a position that will not substantially affect the activity of the sortase.
Irreversible Linkers
[0118] Since a SrtA-mediated protein-cell conjugation is a reversible reaction, to improve the efficiency of cell labeling, it would be beneficial to minimize the occurrence of reverse reactions. One solution to increase the product yield is to increase the concentration of the reaction substrates, but it may be difficult to achieve a very high concentration for macromolecular proteins in practical applications; and even if the high concentration could be reached, the high cost may limit the use of this technology. Another solution is to continuously remove the products from the reaction system so that the reaction will not stop due to equilibrium, but since the reaction is carried out on the cell, product separation may be difficult. The inventors of the present application found that surprisingly for cell labelling, the reverse reaction can be prevented by introducing hydroxyacetyl-like byproduct which is not a substrate for the reverse reaction, thus rendering the labeling reaction irreversible.
[0119] To obtain hydroxyacetyl-like byproduct, the present disclosure contemplates using a sortase recognition motif comprising an unnatural amino acid, preferably located at position 5 from the direction of N-terminal to C-terminal of the sortase recognition motif. In some embodiments, the unnatural amino acid is a substituted or unsubstituted hydroxyl carboxylic acid having a formulae of CH.sub.2OH—(CH.sub.2).sub.n—COOH, n being an integer from 0 to 5, e.g., 0, 1, 2, 3, 4 and 5, preferably n=0. In some embodiments, the sortase recognition motif comprising an unnatural amino acid may be selected from a group consisting of LPXT*Y, LPXA*Y, LPXS*Y, LPXL*Y, LPXV*Y, LGXT*Y, LAXT*Y, LSXT*Y, NPXT*Y, MPXT*Y, IPXT*Y, SPXT*Y, VPXT*Y and YPXR*Y, wherein * represents the optionally substituted hydroxyl carboxylic acid; and X and Y independently represent any amino acid. In some embodiments, the sortase recognition motif comprising a unnatural amino acid may be selected from a group consisting of LPXT*G, LPXA*G, LPXS*G, LPXL*G, LPXV*G, LGXT*G, LAXT*G, LSXT*G, NPXT*G, MPXT*G, IPXT*G, SPXT*G, VPXT*G, YPXR*G, LPXT*S and LPXT*A, preferably M is LPET*G with * preferably being 2-hydroxyacetic acid. In some embodiments, Leu-Pro-Glu-Thr-2-hydroxyacetic acid-Gly (LPET-(2-hydroxyacetic acid)-G) is used as a linker to ensure that the byproduct would make the reaction irreversible.
[0120] To introduce the irreversible linker to an agent, in some embodiments, the sortase recognition motif comprising an unnatural amino acid as a linker is chemically synthesized and can be directly conjugated to an agent such as a protein or polypeptide.
[0121] In some embodiments, the sortase recognition motif comprising an unnatural amino acid can be conjugated to an agent by various chemical means to generate a desired sortase substrate. These methods may include chemical conjugation with bifunctional cross-linking agents such as, e.g., an NHS ester-maleimide heterobifunctional crosslinker to connect a primary amine group with a reduced thiol group. Other molecular fusions may be formed between the sortase recognition motif and the agent, for example through a spacer.
[0122] Various chemical conjugation means, bifunctional crosslinker or spacer can be used in the present disclosure, including but not limited to: (1) zero-length type (e.g., EDC; EDC plus sulfo NHS; CMC; DCC; DIC; N,N′-carbonyldiimidazole; Woodward's reagent K); (2) amine-sulfhydryl type such as an NHS ester-maleimide heterobifunctional crosslinker (e.g., Maleimido carbonic acid (C.sub.2-8) (e.g., 6-Maleimidohexanoic acid and 4-Maleimidobutyric acid); EMCS; SPDP, LC-SPDP, sulfo-LC-SPDP; SMPT and sulfo-LC-SMPT; SMCC, LC-SMCC and sulfo-SMCC; MBS and sulfo-MBS; SIAB and sulfo-SIAB; SMPB and sulfo-SMPB; GMBS and sulfo-GMBS; SIAX and SIAXX; SIAC and SIACX; NPIA); (3) homobifunctional NHS esters type (e.g., DSP; DTSSP; DSS; DST and Sulfo-DST; BSOCOES and Sulfo-BSOCOES; EGS and Sulfo-EGS); (4) homobifunctional imidoesters type (e.g., DMA; DMP; DMS; DTBP); (5) carbonyl-sulfydryl type (e.g., KMUH; EMCH; MPBH; M2C2H; PDPH); (6) sulfhydryl reactive type (e.g., DPDPB; BMH; HBVS); (7) sulfhydryl-hydroxy type (e.g., PMPI); or the like.
[0123] In some embodiments, an amine-sulfhydryl type or an NHS ester-maleimide heterobifunctional crosslinker is a preferred spacer that can be used herein. In certain embodiments, the NHS ester-maleimide heterobifunctional crosslinker such as 6-Maleimidohexanoic acid and 4-Maleimido butyric acid are particularly useful spacers for the construction of desired sortase substrates. The NHS ester-maleimide heterobifunctional crosslinker such as 6-Maleimidohexanoic acid and 4-Maleimido butyric acid can undergo a Michael addition reaction with an exposed sulfhydryl group, e.g., on an exposed cysteine, but this reaction will not occur with an unexposed cysteine. In one embodiment, 6-Maleimidohexanoic acid was introduced in the irreversible linker of the present disclosure, to obtain 6-Maleimidohexanoic acid-Leu-Pro-Glu-Thr-2-hydroxyacetic acid-Gly as shown in
[0124] By using the spacers as described herein, especially NHS ester-maleimide heterobifunctional crosslinkers such as 6-Maleimidohexanoic acid and 4-Maleimido butyric acid, the inventors successfully designed linkers with different structures, including double forks, triple forks and multiple forks. These different linkers can be used to label RBCs according to actual needs, for example to obtain multi-modal therapeutics. In the multi-fork structure design of some embodiments, one or more spacers can be linked to the amino group of N-terminal amino acid and/or the amino group of the side chain of lysine and the same or different agents like proteins or polypeptides can be linked to the one or more spacers, as shown in
Sortase Substrates
[0125] Substrates suitable for a sortase-mediated conjugation can readily be designed. A sortase substrate may comprises a sortase recognition motif and an agent. For example, an agent such as polypeptides can be modified to include a sortase recognition motif at or near their C-terminus, thereby allowing them to serve as substrates for sortase. The sortase recognition motif need not be positioned at the very C-terminus of a substrate but should typically be sufficiently accessible by the enzyme to participate in the sortase reaction. In some embodiments a sortase recognition motif is considered to be “near” a C-terminus if there are no more than 5, 6, 7, 8, 9, 10 amino acids between the most N-terminal amino acid in the sortase recognition motif (e.g., L) and the C-terminal amino acid of the polypeptide. A polypeptide comprising a sortase recognition motif may be modified by incorporating or attaching any of a wide variety of moieties (e.g., peptides, proteins, compounds, nucleic acids, lipids, small molecules and sugars) thereto.
[0126] In some embodiments, the present disclosure provides a sortase substrate comprising a structure of A.sup.1-Sp-M, in which A.sup.1 represents an agent, Sp represents one or more optional spacers, and M represents a sortase recognition motif comprising an unnatural amino acid as set forth herein. In some embodiments, the one or more Sp is selected from a group consisting of the following types of crosslinkers: (1) zero-length type; (2) amine-sulfhydryl type; (3) homobifunctional NHS esters type; (4) homobifunctional imidoesters type; (5) carbonyl-sulfydryl type; (6) sulfhydryl reactive type; and (7) sulfhydryl-hydroxy type; preferably the one or more Sp is an NHS ester-maleimide heterobifunctional crosslinker such as 6-Maleimidohexanoic acid and 4-Maleimidobutyric acid and the agent comprises an exposed sulfydryl, preferably an exposed cysteine, more preferably a terminal cysteine, most preferably a C-terminal cysteine. In some embodiments, when two or more spacers are presents, the agents linked to the spacers can be the same or different.
Agents
[0127] Depending on the intended applications of the modified red blood cells, a wide variety of agents such as a binding agent, a therapeutic agent or a detection agent can be contemplated in the present disclosure. In some embodiments, an agent may comprise a protein, a peptide (e.g., an extracellular domain of oligomeric ACE2), an antibody or its functional antibody fragment, an antigen or epitope, a MHC-peptide complex such as a complex comprising antigenic peptide of HPV16 (e.g., peptide of YMLDLQPET), a drug such as a small molecule drug (e.g., an antitumor agent such as a chemotherapeutic agent), an enzyme (e.g., a functional metabolic or therapeutic enzyme, such as urate oxidase), a hormone, a cytokine, a growth factor, an antimicrobial agent, a probe, a ligand, a receptor, an immunotolerance-inducing peptide, a targeting moiety or any combination thereof.
[0128] In some embodiments, in addition to a therapeutically active domain such as an enzyme, a drug, a small molecule (such as a small molecule drug (e.g., an antitumor agent such as a chemotherapeutic agent)), a therapeutic protein and a therapeutic antibody as described herein, the agent may further comprise a targeting moiety for targeting the cells and/or agent to a site in the body where the therapeutic activity is desired. The targeting moiety binds to a target present at such a site. Any targeting moiety may be used, e.g., an antibody. The site may be any organ or tissue, e.g., respiratory tract (e.g., lung), bone, kidney, liver, pancreas, skin, cardiovascular system (e.g., heart), smooth or skeletal muscle, gastrointestinal tract, eye, blood vessel surfaces, etc.
[0129] In some embodiments, a protein is an enzyme such as a functional metabolic or therapeutic enzyme, e.g., an enzyme that plays a role in metabolism or other physiological processes in a mammal. In some embodiments a protein is an enzyme that plays a role in carbohydrate metabolism, amino acid metabolism, organic acid metabolism, porphyrin metabolism, purine or pyrimidine metabolism, and/or lysosomal storage. Deficiencies of enzymes or other proteins can lead to a variety of diseases, e.g., diseases associated with defects in carbohydrate metabolism, amino acid metabolism, organic acid metabolism, purine or pyrimidine metabolism, lysosomal storage disorders, and blood clotting, among others. Metabolic diseases are characterized by the lack of functional enzymes or excessive intake of metabolites. Thus, the metabolites deposition in the circulation and tissues causes tissue damage. Due to the wide distribution in human body of RBCs, the present disclosure contemplates modifying membrane proteins of RBCs with functional metabolic enzymes. The enzymes targeted RBCs will uptake metabolites in plasma of patients. Exemplary enzymes include urate oxidase for gout, phenylalanine ammonia-lyase for Phenylketonuria, acetaldehyde dehydrogenase for alcoholic hepatitis, butyrylcholinesterase for cocaine metabolite, and the like. In some embodiments, red blood cells having urate oxidase conjugated thereto may be administered to a subject in need of treatment of chronic hyperuricemia, e.g., a patient with gout, e.g., gout that is refractory to other treatments.
[0130] Enzyme replacement therapy has been a specific treatment for patients with e.g. lysosomal storage disorders (LSDs) over the past three decades. However, this medication has some limitations such as immune system problems and financial burden. In addition, the therapeutic enzymes are rapidly cleared in human body for their extensive catabolism. In some embodiments, the present disclosure contemplates binding the therapeutic enzymes to RBC membrane proteins through the sortase reaction as described herein. The use of RBCs as carriers will target the functional enzymes to macrophages in liver, where RBCs are cleared, and also reduce the dosage and frequency of drug interventions for the enhanced half-time of enzymes. Exemplary enzymes include glucocerebrosidase for Gaucher disease, α-galactosidase for Fabry disease, alanine glycoxylate aminotransferase and glyoxylate reductase/hydroxypyruvate reductase for primary hyperoxaluria.
[0131] In some embodiments, the agent may comprise a peptide. Various functional peptides can be contemplated in the present disclosure. In certain embodiment, the peptide may comprise an oligomeric ACE2 extracellular domain.
[0132] SARS-CoV-2, which causes a respiratory disease named COVID-19, belongs to the same coronaviridea as SARS-CoV. The genome of SARS-CoV-2 is very similar to SARS-CoV sharing ˜80% nucleotide sequence identity and 94.6% amino acid sequence identity in the ORF encoding the spike protein. SARS-CoV-2 and SARS-CoV spike proteins have very similar structures, both entering human cells through spike protein interaction with ACE2 as shown in
[0133] Both SARS-CoV and SARS-CoV-2 enter host cells through binding with ACE2 by its S protein. This mechanism is also applying to other coronavirus in order to successfully establish the infection. Thus, molecules blocking S protein interaction with ACE2 could prevent virus infection. It has been shown ACE2 extracellular domain could block virus infection. However, monomeric ACE2 only has limited binding affinity to S protein and is not expected to have a high virus blocking activity. High-affinity oligomeric ACE2 on the other hand possess a high virus binding affinity and could effectively compete with cell surface ACE2 for virus neutralization.
[0134] Cell assays have demonstrated coronavirus infection or even S protein binding with ACE2 will cause shedding of ACE2 from cell surface, resulting in decreased cell surface ACE2 expression level [10] [11]. Down regulation of ACE2 results in angiotensin II accumulation which is closely related with acute lung injury [10] [12] [13]. This perhaps could explain the fact that coronavirus infected patients show respiratory syndromes especially in the lung. The fact that coronavirus infected patients show respiratory syndromes and some even develop ARDS suggests supplementing ACE2 could also alleviate respiratory syndromes for virus infection treatment.
[0135] In some embodiments, the present disclosure contemplates using red blood cells as oligomeric ACE2 carrier for effective virus neutralization (
[0136] In some embodiments, the agent may comprise an antibody, including an antibody, an antibody chain, an antibody fragment e.g., scFv, an antigen-binding antibody domain, a VHH domain, a single-domain antibody, a camelid antibody, a nanobody, an adnectin, or an anticalin. The red blood cells having antibodies attached thereto may be used as a delivery vehicle for the antibodies and/or the antibodies may serve as a targeting moiety. Exemplary antibodies include anti-tumor antibodies such as PD-1 antibodies, e.g., Nivolumab and Pembrolizumab, which both are monoclonal antibodies for human PD-1 protein and are now the forefront treatment to melanoma, non-small cell lung carcinoma and renal-cell cancer. The heavy chains of the antibodies modified with a sortase recognition motif such as LPETG can be expressed and purified. In the same way, PD-L1 antibodies such as Atezolizum, Avelumab and Durvalumab targeting PD-L1 for treating urothelial carcinoma and metastatic merkel cell carcinoma can be modified. Also, Adalimumab, Infliximab, Sarilumab and Golimumab which are FDA approved therapeutic monoclonal antibodies for curing rheumatoid arthritis can be modified by using the method as described herein.
[0137] In some embodiments, the agent may comprise an antigen or epitopes or a binding moiety that binds to an antigen or epitope. In some embodiments an antigen is any molecule or complex comprising at least one epitope recognized by a B cell and/or by a T cell. An antigen may comprise a polypeptide, a polysaccharide, a carbohydrate, a lipid, a nucleic acid, or combination thereof. An antigen may be naturally occurring or synthetic, e.g., an antigen naturally produced by and/or is genetically encoded by a pathogen, an infected cell, a neoplastic cell (e.g., a tumor or cancer cell), a virus, bacteria, fungus, or parasite. In some embodiments, an antigen is an autoantigen or a graft-associated antigen. In some embodiments, an antigen is an envelope protein, capsid protein, secreted protein, structural protein, cell wall protein or polysaccharide, capsule protein or polysaccharide, or enzyme. In some embodiments an antigen is a toxin, e.g., a bacterial toxin. An antigen or epitope may be modified, e.g., by conjugation to another molecule or entity (e.g., an adjuvant).
[0138] In some embodiments, red blood cells having an epitope, antigen or portion thereof conjugated thereto by sortase as described herein may be used as vaccine components. In some embodiments an antigen conjugated to red blood cells using sortase as described herein may be any antigen used in a conventional vaccine known in the art.
[0139] In some embodiments an antigen is a surface protein or polysaccharide of, e.g., a viral capsid, envelope, or coat, or bacterial, fungal, protozoal, or parasite cell. Exemplary viruses may include, e.g., coronaviruses (e.g., SARS-CoV and SARS-CoV-2), HIV, dengue viruses, encephalitis viruses, yellow fever viruses, hepatitis virus, Ebola viruses, influenza viruses, and herpes simplex virus (HSV) 1 and 2.
[0140] In some embodiments an antigen is a tumor antigen (TA), which can be any antigenic substance produced by cells in a tumor, e.g., tumor cells or in some embodiments tumor stromal cells (e.g., tumor-associated cells such as cancer-associated fibroblasts or tumor-associated vasculature).
[0141] In some embodiments, an antigen is a peptide. Peptides may bind directly to MHC molecules expressed on cell surfaces, may be ingested and processed by APC and displayed on APC cell surfaces in association with MHC molecules, and/or may bind to purified MHC proteins (e.g., MHC oligomers). In some embodiments a peptide contains at least one epitope capable of binding to an appropriate MHC class I protein and/or at least one epitope capable of binding to an appropriate MHC class II protein. In some embodiments a peptide comprises a CTL epitope (e.g., the peptide can be recognized by CTLs when bound to an appropriate MHC class I protein).
[0142] In some embodiments, the agent may comprise a MHC-peptide complex, which may comprise a MHC and a peptide such as an antigenic peptide or an antigen as described herein for activating immune cells. In some embodiments, the antigenic peptide is associated with a disorder and is able to activate CD8.sup.+ T cells when presented by a MHC class I molecule. Class-I major histocompatibility complex (MHC-I) is presenting antigen peptides to and activating immune cells particularly CD8.sup.+ T cells, which are important for fighting against cancers, infectious diseases, etc. MHC-peptide complexes with sortase recognition motifs such as LPETG can be expressed and purified exogenously through eukaryotic or prokaryotic systems. The purified MHC-peptide complexes will be covalently bound to RBCs by sortase-mediated reactions as described herein. In the present disclosure, we used MHC-I-OT1 complex as an example. Mouse MHC-I-OT1 protein is expressed by E. coli and purified by histidine-tagged affinity chromatography. The purified MHC-I-OT1 complexes are successfully ligated on membrane proteins of RBCs. Similarly, MHC-II is presenting antigen peptides to and activating immune cells particularly CD4.sup.+ T cells and thus a MHC complex comprising MHC-II and an antigen or an antigenic peptide can be covalently bound to RBCs by sortase-mediated reactions as described herein.
[0143] This strategy of MHC complex can be used to treat or prevent diseases caused by viruses, such as HPV (targeting E6/E7), coronavirus (e.g., targeting SARS-CoV or SARS-CoV-2 Spike protein), and influenza virus (e.g., targeting H antigen/N antigen). In an example, we used MCH-peptide complex comprising a HPV16 antigenic peptide (YMLDLQPET), and successfully conjugated the complex on RBCs. The HPV-MHC1 conjugated RBCs can be used in treatment of diseases caused by HPV such as cervical carcinoma. This strategy of MHC complex can also be used to target tumor mutations, for example Kras with mutations such as V8M and/or G12D, Alk with a mutation such as E1171D, Braf with a mutation such as W487C, Jak2 with a mutation such as E92K, Stat3 with a mutation such as M28I, Trp53 with mutations such as G242V and/or S258I, Pdgfra with a mutation such as V88I, and Brca2 with a mutation such as R2066K, for tumor treatment.
[0144] In some embodiments, the agent may comprise a growth factor. In some embodiments, the agent may comprise a growth factor for one or more cell types. Growth factors include, e.g., members of the vascular endothelial growth factor (VEGF, e.g., VEGF-A, VEGF-B, VEGF-C, VEGF-D), epidermal growth factor (EGF), insulin-like growth factor (IGF; IGF-1, IGF-2), fibroblast growth factor (FGF, e.g., FGF1-FGF22), platelet derived growth factor (PDGF), or nerve growth factor (NGF) families.
[0145] In some embodiments, the agent may comprise a cytokine or the biologically active portion thereof. In some embodiments a cytokine is an interleukin (IL) e.g., any of IL-1 to IL-38 (e.g., IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-12), interferons (e.g., a type I interferon, e.g., IFN-α), and colony stimulating factors (e.g., G-CSF, GM-CSF, M-CSF). Cytokine (such as recombinant IL-2, recombinant IL-7, recombinant IL-12) loaded RBCs is a therapeutic delivery system for increasing tumor cytotoxicity and IFN-7 production.
[0146] In some embodiments, the agent may comprise a small molecule, e.g., those used as targeting moieties, immunomodulators, detection agents, therapeutic agents, or ligands (such as CD19, CD47, TRAIL, TGF, CD44) to activate or inhibit a corresponding receptor.
[0147] In some embodiments, the agent may comprise a receptor or receptor fragment. In some embodiments, the receptor is a cytokine receptor, growth factor receptor, interleukin receptor, or chemokine receptor. In some embodiments a growth factor receptor is a TNFα receptor (e.g., Type I TNF-α receptor), VEGF receptor, EGF receptor, PDGF receptor, IGF receptor, NGF receptor, or FGF receptor. In some embodiments a receptor is TNF receptor, LDL receptor, TGF receptor, or ACE2.
[0148] In some embodiments, an agent to be conjugated to red blood cells may comprise an anti-cancer or anti-tumor agent, for example, a chemotherapy drug. In certain embodiments, red blood cells are conjugated both with an anti-tumor agent and a targeting moiety, wherein the targeting moiety targets the red blood cell to a cancer. Anti-cancer agents are conventionally classified in one of the following group: radioisotopes (e.g., Iodine-131, Lutetium-177, Rhenium-188, Yttrium-90), toxins (e.g., diphtheria, Pseudomonas, ricin, gelonin), enzymes, enzymes to activate prodrugs, radio-sensitizing drugs, interfering RNAs, superantigens, anti-angiogenic agents, alkylating agents, purine antagonists, pyrimidine antagonists, plant alkaloids, intercalating antibiotics, aromatase inhibitors, anti-metabolites, mitotic inhibitors, growth factor inhibitors, cell cycle inhibitors, enzymes, topoisomerase inhibitors, biological response modifiers, anti-hormones and anti-androgens. In some embodiments an anti-tumor agent is a protein such as a monoclonal antibody or a bispecific antibody such as anti-receptor tyrosine kinases (e.g., cetuximab, panitumumab, trastuzumab), anti-CD20 (e.g., rituximab and tositumomab) and others for example alemtuzumab, aevacizumab, and gemtuzumab; an enzyme such as asparaginase; a chemotherapy drug including, e.g., alkylating and alkylating-like agents such as nitrogen mustards; platinum agents (e.g., alkylating-like agents such as carboplatin, cisplatin), busulfan, dacarbazine, procarbazine, temozolomide, thioTEPA, treosulfan, and uramustine; purines such as cladribine, clofarabine, fludarabine, mercaptopurine, pentostatin, thioguanine; pyrimidines such as capecitabine, cytarabine, fluorouracil, floxuridine, gemcitabine; cytotoxic/anti-tumor antibiotics such anthracyclines (e.g., daunorubicin, doxorubicin, epirubicin, idarubicin, mitoxantrone, pixantrone, and valrubicin); and others for example taxol, nocodazole, or β-Ionone. Antitumor agent loaded RBCs via membrane proteins is promising for decreasing antibiotic toxicity and increasing circulation times and can perform as a slow drug delivery.
[0149] In some embodiments, a tumor is a malignant tumor or a “cancer”. The term “tumor” includes malignant solid tumors (e.g., carcinomas, sarcomas) and malignant growths with no detectable solid tumor mass (e.g., certain hematologic malignancies). The term “cancer” is generally used interchangeably with “tumor” herein and/or to refer to a disease characterized by one or more tumors, e.g., one or more malignant or potentially malignant tumors. Cancer includes, but is not limited to: breast cancer; biliary tract cancer; bladder cancer; brain cancer; cervical cancer; choriocarcinoma; colon cancer; endometrial cancer; esophageal cancer; gastric cancer; hematological neoplasms; T-cell acute lymphoblastic leukemia/lymphoma; hairy cell leukemia; chronic lymphocytic leukemia, chronic myelogenous leukemia, multiple myeloma; adult T-cell leukemia/lymphoma; intraepithelial neoplasms; liver cancer; lung cancer; lymphomas including Hodgkin's disease and lymphocytic lymphomas; neuroblastoma; melanoma, oral cancer including squamous cell carcinoma; ovarian cancer including ovarian cancer arising from epithelial cells, stromal cells, germ cells and mesenchymal cells; neuroblastoma, pancreatic cancer; prostate cancer; rectal cancer; sarcomas including angiosarcoma, gastrointestinal stromal tumors, leiomyosarcoma, rhabdomyosarcoma, liposarcoma, fibrosarcoma, and osteosarcoma; renal cancer including renal cell carcinoma and Wilms tumor; skin cancer; testicular cancer; thyroid cancer.
[0150] In some embodiments, an agent to be conjugated to red blood cells may comprise an anti-microbial agent. An anti-microbial agent may include compounds that inhibit proliferation or activity of, destroy or kill bacteria, viruses, fungi, parasites. In some embodiments the red blood cells are conjugated with an anti-microbial agent against a bacteria, virus, fungi, or parasite and with a targeting moiety, wherein the targeting moiety targets the cell to the bacteria, virus, fungi, or parasite. In some embodiments, the anti-microbial agent may include β-lactamase inhibitory proteins or metallo-beta-lactamase for treating bacterial infections.
[0151] In some embodiments, an agent to be conjugated to red blood cells may comprise probes, which can be used as for example diagnostic tools. Molecular imaging has been demonstrated as an efficient way for tracking disease progression such as in cancer. Small molecular probes such as fluorescein can be labeled on RBCs through an enzymatic reaction by sortase A as described herein, instead of conventional chemical reaction which may cause damage to cells.
[0152] In some embodiments, an agent to be conjugated to red blood cells may comprise a prodrug. The term “prodrug” refers to a compound that, after in vivo administration, is metabolized or otherwise converted to the biologically, pharmaceutically or therapeutically active form of the compound. A prodrug may be designed to alter the metabolic stability or the transport characteristics of a compound, to mask side effects or toxicity, to improve the flavor of a compound and/or to alter other characteristics or properties of a compound. By virtue of knowledge of pharmacodynamic processes and drug metabolisms in vivo, once a pharmaceutically active compound is identified, those of skills in the pharmaceutical art generally can design prodrugs of the compound (Nogrady, “Medicinal Chemistry A Biochemical Approach”, 1985, Oxford University Press: N.Y., pages 388-392). Procedures for the selection and preparation of suitable prodrugs are also known in the art. In the context of the present invention, a prodrug is preferably a compound that, after in vivo administration, whose conversion to its active form involves enzymatic catalysis.
Methods for Covalently Modifying Endogenous, Non-Engineered Membrane Proteins of RBCs
[0153] In an aspect, the present disclosure provides a method for covalently modifying at least one endogenous, non-engineered membrane protein of a red blood cell, comprising contacting the RBC with a sortase substrate that comprises a sortase recognition motif and an agent as described herein, in the presence of a sortase under conditions suitable for the sortase to conjugate the sortase substrate to the at least one endogenous, non-engineered membrane protein of the RBC by a sortase-mediated reaction, preferably by a sortase-mediated glycine conjugation and/or a sortase-mediated lysine side chain conjugation. In some embodiments, the sortase-mediated glycine conjugation and/or the sortase-mediated lysine side chain ε-amino group conjugation occur at least on glycine.sub.(n) and/or lysine ε-amino group in the extracellular domain (for example at internal sites of the extracellular domain) of the at least one endogenous, non-engineered membrane protein, preferably n being 1 or 2. In some embodiments, without being limited to the theory, the sortase-mediated glycine conjugation may also occur at exposed glycine.sub.(n=1 or 2) of previously unreported membrane proteins due to tissue-specific mRNA splicing and protein translation during erythropoiesis. In some embodiments, the sortase-mediated lysine side chain ε-amino group conjugation occur at ε-amino group of terminal lysine or internal lysine of the extracellular domain.
[0154] It would be understood that those of ordinary skills are able to select conditions (e.g., optimal temperature, pH) suitable for the sortase to conjugate the sortase substrate to the at least one endogenous, non-engineered membrane protein according to the nature of sortase substrate, the type of sortase and the like.
Uses
[0155] Sortagged red blood cells described herein have a number of uses. In some embodiments, the sortagged red blood cells may be used as a vaccine component, a delivery system or a diagnostic tool. In some embodiments, the sortagged red blood cells may be used to treat or prevent various disorders, conditions or diseases as described herein such as tumors or cancers, metabolic diseases such as lysosomal storage disorders (LSDs), bacterial infections, virus infections such as coronavirus for example SARS-COV or SARS-COV-2 infection, autoimmune diseases or inflammatory diseases, In some embodiments, sortagged red blood cells may be used in cell therapy. In some embodiments, therapy is administered for treatment of cancer, infections such as bacterial or virus infections, autoimmune diseases, or enzyme deficiencies. In some embodiments, red blood cells sortagged with peptides for inducing immunotolerances may be used to modulate immune response such as inducing immunotolerance. In some embodiments administered red blood cells may originate from the individual to whom they are administered (autologous), may originate from different genetically identical individual(s) of the same species (isogeneic), may originate from different non-genetically identical individual(s) of the same species (allogeneic), or may originate from individual(s) of a different species. In certain embodiments, allogeneic red blood cells may originate from an individual who is immunocompatible with the subject to whom the cells are administered.
[0156] In some embodiments, the sortagged red blood cells are used as a delivery vehicle or system for the agent. For example, the sortagged red blood cells that have a protein conjugated to their surface may serve as delivery vehicles for the protein. Such cells may be administered to a subject suffering from a deficiency of the protein or who may benefit from increased levels of the protein. In some embodiments the cells are administered to the circulatory system, e.g., by infusion. Examples of various diseases associated with deficiency of various proteins, e.g., enzymes, are provided above. In some embodiments, using sortagged RBCs as a delivery system can achieve a retention release, for example for delivering hormones like glucocorticoids, insulin and/or growth hormones in a retention release profile.
[0157] In some embodiments, the present disclosure provides a method for diagnosing, treating or preventing a disorder, condition or disease in a subject in need thereof, comprising administering the red blood cell or composition as described herein to the subject. In some embodiments, the disorder, condition or disease is selected from a group consisting of tumors or cancers, metabolic diseases such as lysosomal storage disorders (LSDs), bacterial infections, virus infections such as coronavirus for example SARS-COV or SARS-COV-2 infection, autoimmune diseases and inflammatory diseases.
[0158] As used herein, “treating”, “treat” or “treatment” refers to a therapeutic intervention that at least partly ameliorates, eliminates or reduces a symptom or pathological sign of a pathogen-associated disease, disorder or condition after it has begun to develop. Treatment need not be absolute to be beneficial to the subject. The beneficial effect can be determined using any methods or standards known to the ordinarily skilled artisan.
[0159] As used herein, “preventing”, “prevent” or “prevention” refers to a course of action initiated prior to infection by, or exposure to, a pathogen or molecular components thereof and/or before the onset of a symptom or pathological sign of the disease, disorder or condition, so as to prevent infection and/or reduce the symptom or pathological sign. It is to be understood that such preventing need not be absolute to be beneficial to a subject. A “prophylactic” treatment is a treatment administered to a subject who does not exhibit signs of the disease, disorder or condition, or exhibits only early signs for the purpose of decreasing the risk of developing a symptom or pathological sign of the disease, disorder or condition.
[0160] In some embodiments, the method as described herein further comprises administering the conjugated red blood cells to a subject, e.g., directly into the circulatory system, e.g., intravenously, by injection or infusion.
[0161] In another aspect, provided is a method of delivering an agent to a subject in need thereof, comprising administering the red blood cell or the composition as described herein to the subject. The term “delivery” or “delivering” refers to transportation of a molecule or agent to a desired cell or tissue site. Delivery can be to the cell surface, cell membrane, cell endosome, within the cell membrane, nucleus or within the nucleus, or any other desired area of the cell.
[0162] In another aspect, provided is a method of increasing the circulation time or plasma half-life of an agent in a subject, comprising providing a sortase substrate that comprises a sortase recognition motif and an agent, and conjugating the sortase substrate in the presence of a sortase under conditions suitable for the sortase to conjugate the sortase substrate to the at least one endogenous, non-engineered membrane protein of a red blood cell by a sortase-mediated reaction, preferably by a sortase-mediated glycine conjugation and/or a sortase-mediated lysine side chain ε-amino group conjugation. In some embodiments the method further comprises administering the red blood cell to the subject, e.g., directly into the circulatory system, e.g., intravenously or by injection or infusion.
[0163] In some embodiments, a subject receives a single dose of cells, or receives multiple doses of cells, e.g., between 2 and 5, 10, 20, or more doses, over a course of treatment. In some embodiments a dose or total cell number may be expressed as cells/kg. For example, a dose may be about 10.sup.3, 10.sup.4, 10.sup.5, 10.sup.6, 10.sup.7, 10.sup.8 cells/kg. In some embodiments a course of treatment lasts for about 1 week to 12 months or more e.g., 1, 2, 3 or 4 weeks or 2, 3, 4, 5 or 6 months. In some embodiments a subject may be treated about every 2-4 weeks. One of ordinary skills in the art will appreciate that the number of cells, doses, and/or dosing interval may be selected based on various factors such as the weight, and/or blood volume of the subject, the condition being treated, response of the subject, etc. The exact number of cells required may vary from subject to subject, depending on factors such as the species, age, weight, sex, and general condition of the subject, the severity of the disease or disorder, the particular cell(s), the identity and activity of agent(s) conjugated to the cells, mode of administration, concurrent therapies, and the like.
Composition
[0164] In another aspect, the present disclosure provides a composition comprising the red blood cell as described herein and optionally a physiologically acceptable carrier, such as in the form of a pharmaceutical composition, a delivery composition or a diagnostic composition or a kit.
[0165] In some embodiments, the composition may comprise a plurality of red blood cells. In some embodiments, at least a selected percentage of the cells in the composition are modified, i.e., having an agent conjugated thereto by sortase. For example, in some embodiments at least 5%, 10%, 15%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99%, or more of the cells have an agent conjugated thereto. In some embodiments, two or more red blood cells or red blood cell populations conjugated with different agents are included.
[0166] In some embodiments, a composition comprises sortagged blood red cells, wherein the cells are sortagged with any agent of interest. In some embodiments, a composition comprises an effective amount of cells, e.g., up to about 10.sup.14 cells, e.g., about 10, 10.sup.2, 10.sup.3, 10.sup.4, 10.sup.5, 5×10.sup.5, 10.sup.6, 5×10.sup.6, 10.sup.7, 5×10.sup.7, 10.sup.8, 5×10.sup.8, 10.sup.9, 5×10.sup.9, 10.sup.10, 5×10.sup.10, 10.sup.11, 5×10.sup.11, 10.sup.12, 5×10.sup.12, 10.sup.13, 5×10.sup.13, or 10.sup.14 cells. In some embodiments the number of cells may range between any two of the afore-mentioned numbers.
[0167] As used herein, the term “an effective amount” refers to an amount sufficient to achieve a biological response or effect of interest, e.g., reducing one or more symptoms or manifestations of a disease or condition or modulating an immune response. In some embodiments a composition administered to a subject comprises up to about 10.sup.14 cells, e.g., about 10.sup.3, 10.sup.4, 10.sup.5, 10.sup.6, 10.sup.7, 10.sup.8, 10.sup.9, 10.sup.10, 10.sup.11, 10.sup.12, 10.sup.13 or 10.sup.14 cells, or any intervening number or range.
[0168] In another aspect, the composition of the present aspect may comprise a sortase and a sortase substrate but without red blood cells. The composition will be administered to the circulatory system in a subject and upon contacting red blood cells in vivo, the sortase conjugates the sortase substrate to at least one endogenous, non-engineered membrane protein of the red blood cells by a sortase-mediated reaction as described herein. In this form of composition, there will be no risk of incompatibility of red blood cells as well as other risks, such as bacterial or viruses contamination from donor cells. In some embodiments, the sortase has been further modified to enhance its stabilization in circulation by e.g., PEGylation or Fusion to Fc fragment and/or reduce its immunogenicity.
[0169] As used herein, the term “a physiologically acceptable carrier” is meant a solid or liquid filler, diluent or encapsulating substance that may be safely used in systemic administration. Depending upon the particular route of administration, a variety of carriers, diluent and excipients well known in the art may be used. These may be selected from a group including sugars, starches, cellulose and its derivatives, malt, gelatine, talc, calcium sulfate, vegetable oils, synthetic oils, polyols, alginic acid, phosphate buffered solutions, emulsifiers, isotonic saline and salts such as mineral acid salts including hydrochlorides, bromides and sulfates, organic acids such as acetates, propionates and malonates, water and pyrogen-free water.
[0170] It will be appreciated by those skilled in the art that other variations of the embodiments described herein may also be practiced without departing from the scope of the invention. Other modifications are therefore possible.
[0171] Although the disclosure has been described and illustrated in exemplary forms with a certain degree of particularity, it is noted that the description and illustrations have been made by way of example only. Numerous changes in the details of construction and combination and arrangement of parts and steps may be made. Accordingly, such changes are intended to be included in the invention, the scope of which is defined by the claims.
EXAMPLES
Example 1. Mg SrtA-Mediated Protein-Cell Conjugation
Methods
[0172] Recombinant Protein Expression and Purification in E. coli
[0173] Mg SrtA (SEQ ID NO: 3), wt SrtA (SEQ ID NO: 1 with 25 amino acids removed from N-terminus) and eGFP-LPETG cDNA were cloned in pET vectors and transformed in E. coli BL21(DE3) cells for protein expression. Transformed cells were cultured at 37° C. until the OD.sub.600 reaching 0.6-0.8 and then 500 μM IPTG were added for 4 hrs at 37° C. After that, cells were harvested by centrifugation and subjected to lysis by precooled lysis buffer (20 mM Tris-HCl, pH 7.8, 100 mM NaCl). The lysates were proceeded for sonication on ice (5 s on, 5 s off, 60 cycles, 25% power, Branson Sonifier 550 Ultrasonic Cell Disrupter). All supernatants were filtered by 0.22 μM filter after centrifugation at 14,000 g for 40 min at 4° C. Filtered supernatants were loaded onto HisTrap FF 1 mL column (GE Healthcare) connected to the AKTA design chromatography systems. The proteins were eluted with the elution buffer containing 20 mM Tris-HCl, pH 7.8, 100 mM NaCl and 300 mM imidazole. All eluted fractions were analyzed on a 12% SDS-PAGE gel.
Wt SrtA or Mg SrtA-Mediated Enzymatic Labeling of Membrane Proteins
[0174] Reactions were performed in a total volume of 200 μL at 37° C. for 2 hrs in PBS buffer while being rotated at a speed of 10 rpm. The concentration of wt SrtA or mg SrtA was 20-40 μM and the biotin-LPETG or GFP-LPETG substrates were at the range of 200-1000 M. Human or mouse RBCs were washed twice with PBS before enzymatic reactions. The concentration of RBCs in the reaction was from 1×10.sup.6/mL to 1×10.sup.10/mL. After the reaction, RBCs were washed three times and incubated with Streptavidin-phycoerythrin (PE) at room temperature for 10 min before analyzed by Beckman Coulter CytoFLEX LX or Merck Amnis Image Stream MarkII.
Enrichment of RBC Membrane Proteins
[0175] The biotin-labeled RBCs were resuspended in PBS and sonicated (10 s on, 10 s off, 3 cycles, 25% power, SONICS VCX150) on ice. Intact cells were removed by centrifugation at 4° C., 300× g for 15 min. Dried powder was obtained by freezing and lyophilizing then incubation with 50 mL of ice-cold 0.1 M sodium carbonate (pH=11) at 4° C. for 1 h with gentle rotation at a speed of 10 rpm. Membranous fractions were pelleted down by ultracentrifugation at 125,000×g at 4° C. for 1 h and then washed twice with Milli-Q water at the same speed for 30 mins. Then the samples were incubated with 2 mL of ice-cold 80% acetone for protein precipitation at −20° C. for 2 hrs. Membrane proteins were collected by centrifugation at 130,000×g at 4° C. for 15 mins. Membrane proteins samples were redissolved in 1% SDS and analyzed by gel electrophoresis using 12% SDS-PAGE.
In-Gel Digestion
[0176] The whole gel was stained by Coomassie blue (H.sub.2O, 0.1% w/v Coomassie brilliant blue R250, 40% v/v methanol and 10% v/v acetic acid) at room temperature with gently shaking overnight then destained with the destaining solution (40% v/v methanol and 10% v/v acetic acid in water). The gel was rehydrated three times in distilled water at room temperature for 10 min with gentle agitation. The protein bands were cut out and further cut off into ca 1×1 mm.sup.2 pieces, followed by reduction with 10 mM TCEP in 25 mM NH.sub.4HCO.sub.3 at 25° C. for 30 min, alkylation with 55 mM IAA in 25 mM NH.sub.4HCO.sub.3 solution at 25° C. in the dark for 30 min, and sequential digestion with rPNGase F at a concentration of 100 unit/ml at 37° C. for 4 hrs, and then digestion with trypsin at a concentration of 12.5 ng/mL at 37° C. overnight (1st digestion for 4 hrs and 2nd digestion for 12 hrs). Tryptic peptides were then extracted out from gel pieces by using 50% ACN/2.5% FA for three times and the peptide solution was dried under vacuum. Dry peptides were purified by Pierce C18 Spin Tips (Thermo Fisher, USA).
Mass Spectrometry Analysis
[0177] Biognosys-11 iRT peptides (Biognosys, Schlieren, CH) were spiked into peptide samples at the final concentration of 10% prior to MS injection for RT calibration. Peptides were separated by Ultimate 3000 nanoLC-MS/MS system (Dionex LC-Packings, Thermo Fisher Scientific™, San Jose, USA) equipped with a 15 cm×75 μm ID fused silica column packed with 1.9 μm 120 Å C18. After injection, 500 ng peptides were trapped at 6 μL/min on a 20 mm×75 μm ID trap column packed with 3 μm 100 Å C18 aqua in 0.1% formic acid, 2% ACN. Peptides were separated along a 60 min 3-28% linear LC gradient (buffer A: 2% ACN, 0.1% formic acid (Fisher Scientific); buffer B: 98% ACN, 0.1% formic acid) at the flowrate of 300 nL/min (108 min inject-to-inject in total). Eluting peptides were ionized at a potential of +1.8 kV into a Q-Exactive HF mass spectrometer (Thermo Fisher Scientific™ San Jose, USA). Intact masses were measured at resolution 60,000 (at m/z 200) in the Orbitrap using an AGC target value of 3E6 charges and a maximum ion injection time of 80 ms. The top 20 peptide signals (charge-states higher than 2+ and lower than +6) were submitted to MS/MS in the HCD cell (1.6 amu isolation width, 27% normalized collision energy). MS/MS spectra were acquired at resolution 30,000 (at m/z 200) in the Orbitrap using an AGC target value of 1E5 charges, a maximum ion injection time of 100 ms. Dynamic exclusion was applied with a repeat count of 1 and an exclusion time of 30 s. The Maxquant (version 1.6.2.6) was used as a search engine with the fixed modification was cysteine (Cys) carbamidomethyl. and methionine (Met) oxidation as a variable modification. Variable modifications contained oxidation (M), deamidation (NQ), GX808-G-N, GX808-G-anywhere, GX808-K-sidechain. (for details, see Table 1). Other parameters were performed as default. Data was searched against the Swissprot Mouse database September 2018) and further filtered the data with FDR ≤1%.
Results:
[0178] We first characterized the efficacy of mg SrtA-mediated labeling on RBC membranes. Wt SrtA was employed as the control for its recognition of three glycines at the N-terminus of proteins or peptides. Our results showed that >99% of natural mouse or human RBCs were biotin-labeled by mg SrtA in vitro. In contrast, no significant biotin signal was detected on the surface of mouse or human RBCs by wt SrtA nor the mock control group without enzyme (
[0179] Previous studies have shown that specific-antigen bound RBCs are capable of inducing immunotolerance in several animal disease models [8]. In vitro generated mouse RBCs labeled with OT-1 peptide, which is an ovalbumin (OVA) epitope with SIINFEKL sequence, induce immunotolerances in CD8+ T cells with transgenic TCR recognizing H-2K.sup.b-SIINFEKL in an autoimmune disease mouse model [8]. We adoptively transferred CD8.sup.+ CD45.1 T cells purified from OT1 TCR mice into CD45.2 recipient mice (
[0180] We next aim to identify the RBC membrane proteins serving as substrates for mg sortase mediated reaction. Biotin labeled RBCs by mg SrtA were analyzed by mass spectrometry (MS); a list of 122 candidate proteins potentially modified with biotin molecules on glycine (G) or the side chain of lysine (K) was detected (Table 1). 68 and 54 of these proteins were modified at glycine and the side chain of lysine, respectively (Tables 2 and 3). 18 of the identified proteins were detected with both modifications (Table 4). Among the total identified proteins, 22 proteins as shown in Table 5 were annotated as membrane proteins. For instance, the calcium-sensing receptor (CaSR), is a G-protein coupled receptor sensing calcium concentration in the circulation. Previous study has identified the presence of CaSR as a membrane protein on the RBC surface, which regulates the erythrocyte homeostasis [10]. Interestingly, biotin signals were detected at the G526 and K527 positions, neither of which is close to the N-terminus of CaSR. In addition, none of the rest 21 membrane proteins have biotin-modified glycine at the N-terminus, either. Therefore, we have identified membrane proteins including CaSR on RBC surface which might be covalently linked to biotin molecules.
[0181] Identification of biotin-labeled membrane proteins on RBCs was shown in Table 1. Biotin-labeled or natural RBC membrane proteins enriched from
TABLE-US-00004 TABLE 1 New Speci- Name Composition Position Type teminus ficities GX808-G-N C.sub.36H.sub.56O.sub.11N.sub.8S Any Standard None G N-term GX808-G- C.sub.36H.sub.56O.sub.11N.sub.8S Anywhere Standard None G anywhere GX808-K- C.sub.36H.sub.56O.sub.11N.sub.8S Anywhere Standard None K side chain
[0182] A list of 68 protein candidates from RBCs modified with biotin-peptide on glycine(s) are shown in Table 2.
TABLE-US-00005 TABLE 2 UniProt Isoform No. Protein names ID ID Sequence Length Modifications 1 Extracellular calcium- CASR Q9QY96 LFINEG 1079 G-anywhere sensing receptor K (CaSR) (Parathyroid cell calcium-sensing receptor) (PCaR1) 2 Ryanodine receptor 3 RYR3 A2AGL3 NYMMS 4863 G-anywhere (RYR-3) (RyR3) NGYK (Brain ryanodine receptor-calcium release channel) (Brain-type ryanodine receptor) (Type 3 ryanodine receptor) 3 Rap1 GTPase- RPGP1 A2ALS5 SSAIGIE 663 G-anywhere activating protein 1 NIQEVQ (Rap1GAP) EK (Rap1GAP1) (ARPP- 90) 4 Titin (EC 2.7.11.1) TITIN A2ASS6 DGQVIS 35213 G-anywhere (Connectin) TSTLPG VQISFS DGRAR 5 Inter alpha-trypsin ITIH4 A6X935 GSRSQI 942 G-anywhere inhibitor, heavy chain PR 4 (ITI heavy chain H4) (ITI-HC4) (Inter- alpha-inhibitor heavy chain 4) 6 Trafficking protein TPC11 B2RXC1 VSLAGS 1133 G-anywhere particle complex NVFQIG subunit 11 VQDFVP FVQCK 7 Desmoplakin (DP) DESP E9Q557 NSQGSE 2883 G-anywhere MFGDD DKRR 8 Tumor protein D53 TPD53 O54818 LGMNL 204 G-anywhere (mD53) (Tumor MNELK protein D52-like 1) 9 Inactive serine protease PRS39 070169 IYGGQI 367 G-anywhere 39 (Inactive testicular AK serine protease 1) 10 Lysine-specific KDM6A O70546 QTLAN 1401 G-anywhere demethylase 6A (EC GPFSAG 1.14.11.-) (Histone HVPCST demethylase UTX) SR (Ubiquitously transcribed TPR protein on the X chromosome) (Ubiquitously transcribed X chromosome tetratricopeptide repeat protein) 11 Histone-lysine N- SETB1 O88974 QGGQL 1307 G-anywhere methyltransferase RTRPN SETDB1 (EC 2.1.1.-) MGAVR (ERG-associated protein with SET domain) (ESET) (SET domain bifurcated 1) 12 NF-kappa-B inhibitor- IKBL1 088995 CPSAM 381 G-anywhere like protein 1 (Inhibitor GIK of kappa B-like protein) (I-kappa-B- like protein) (IkappaBL) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-like 1) 13 Vesicle transport VTI1A 089116 ILTGML 217 G-anywhere through interaction RR with t-SNAREs homolog 1A (Vesicle transport V-SNARE protein Vti 1-like 2) (Vti 1-rp2) 14 Fructose-bisphosphate ALDOA P05064 LQSIGT 364 G-anywhere aldolase A (EC ENTEEN 4.1.2.13) (Aldolase 1) R (Muscle-type aldolase) 15 T-cell surface CD3G P11942 NTWNL 182 G-anywhere glycoprotein CD3 GNNAK gamma chain (T-cell receptor T3 gamma chain) (CD antigen CD3g) 16 Medium-chain specific ACAD P45952 ELNMG 421 G-anywhere acyl-CoA M QR dehydrogenase, mitochondrial (MCAD) (EC 1.3.8.7) 17 Sulfotransferase 1E1 ST1E1 P49891 EGDVE 295 G-anywhere (STIE1) (EC 2.8.2.4) KCKED (Estrogen AIFNR sulfotransferase, testis isoform) (Sulfotransferase, estrogen-preferring) 18 P2X purinoceptor 1 P2RX1 P51576 NLSPGF 399 G-anywhere (P2X1) (ATP receptor) NFR (Purinergic receptor) 19 Scavenger receptor C163A Q2VLH6 FQGKW 1121 G-anywhere cysteine-rich type 1 GTVCD protein M130 (CD DNFSK antigen CD163) [Cleaved into: Soluble CD163 (sCD163)] 20 RUN and FYVE RUFY4 Q3TYX8 VEGKGS 563 G-anywhere domain-containing LSGTED protein 4 QRTTEG IQK 21 Coiled-coil domain- CC177 Q3UHB QEGQL 706 G-anywhere containing protein 177 8 QREK 22 Lysine-specific KDM5A Q3UXZ9 TDIGVY 1690 G-anywhere demethylase 5A (EC GSGKN 1.14.11.-) (Histone R demethylase JARIDIA) (Jumonji/ ARID domain- containing protein 1A) (Retinoblastoma- binding protein 2) (RBBP-2) 23 Down syndrome cell DSCL1 Q4VA61 DGQVII 2053 G-anywhere adhesion molecule-like SGSGVT protein 1 homolog IESK 24 C2 domain-containing C2CD3 Q52KB6 GLPQDL 2323 G-anywhere protein 3 (Protein DLMQK hearty) 25 Vacuolar protein VP13A Q5H8C4 GVAAM 3166 G-anywhere sorting-associated TMDED protein 13A (Chorea- YQQK acanthocytosis protein homolog) (Chorein) 26 Protein KIBRA KIBRA Q5SXA9 TQKAE 1104 G-anywhere (Kidney and brain GGSRLQ protein) (KIBRA) ALR (WW domain- containing protein 1) 27 DNA polymerase zeta REV3L Q61493 GNASH 3122 G-anywhere catalytic subunit (EC ATGLFK 2.7.7.7) (Protein reversionless 3-like) (REV3-like) (Seizure- related protein 4) 28 Interferon-induced IFIT3 Q64345 MGEEA 403 G-anywhere protein with EGER tetratricopeptide repeats 3 (IFIT-3) (Glucocorticoid- attenuated response gene 49 protein) (GARG-49) (P49) (IRG2) 29 Potassium-transporting ATP4A Q64436 ILSAQG 1033 G-anywhere ATPase alpha chain 1 CK (EC 7.2.2.19) (Gastric H(+)/K(+) ATPase subunit alpha) (Proton pump) 30 E3 ubiquitin-protein SH3R1 Q69ZI1 LLSGAS 892 G-anywhere ligase SH3RF1 (EC TKR 2.3.2.27) (Plenty of SH3s) (Protein POSH) (RING-type E3 ubiquitin transferase SH3RF1) (SH3 domain-containing RING finger protein 1) (SH3 multiple domains protein 2) 31 Tubulin epsilon and TEDC2 Q6GQV VLGTRS 436 G-anywhere delta complex protein 0 TK 2 32 FERM domain- FRMD5 Q6P5H6 GPQLQQ 517 G-anywhere containing protein 5 QQWK 33 Vacuolar ATPase VMA21 Q78T54 QWREG 101 G-anywhere assembly integral KQD membrane protein Vma21 34 APC membrane AMER1 Q7TS75 LFGGKK 1132 G-anywhere recruitment protein 1 (Amer1) (Protein FAM123B) 35 Serine/threonine- MRCK Q7TT50 DIKPDN 1713 G-anywhere protein kinase MRCK B VLLDV beta (EC 2.7.11.1) NGHIR (CDC42-binding protein kinase beta) (DMPK-like beta) (Myotonic dystrophy kinase-related CDC42- binding kinase beta) (MRCK beta) (Myotonic dystrophy protein kinase-like beta) 36 Uncharacterized CJ062 Q80Y39 EMQRES 304 G-anywhere protein C10orf62 GK homolog 37 Dual specificity DYRK4 Q8BI55 NINNNR 632 G-anywhere tyrosine- GGKR phosphorylation- regulated kinase 4 (EC 2.7.12.1) 38 Engulfment and cell ELMO1 Q8BPU7 GALKQ 727 G-anywhere motility protein 1 NK (Protein ced-12 homolog) 39 Anaphase-promoting APC5 Q8BTZ4 GRAMF 740 G-anywhere complex subunit 5 LVSK (APC5) (Cyclosome subunit 5) 40 RNA-binding protein RBM34 Q8C5L7 LNNSEL 442 G-anywhere 34 (RNA-binding MGR motif protein 34) 41 E3 ubiquitin-protein ITCH Q8C863 ILNKPV 864 G-anywhere ligase Itchy (EC GLK 2.3.2.26) (HECT-type E3 ubiquitin transferase Itchy homolog) 42 Coiled-coil domain- CC159 Q8C963 WSTEQE 411 G-anywhere containing protein 159 LYGAL AQGLQ GLQK 43 Death-inducer DIDO1 Q8C9B9 SPAFEG 2256 G-anywhere obliterator 1 (DIO-1) RQR (Death-associated transcription factor 1) (DATF-1) 44 Coiled-coil domain- CD158 Q8CDI6 ILRELD 1109 G-anywhere containing protein 158 TEISFLK GR 45 Structural maintenance SMC4 Q8CG47 IFNLSG 1286 G-anywhere of chromosomes GEK protein 4 (SMC protein 4) (SMC-4) (Chromosome- associated polypeptide C) (XCAP-C homolog) 46 CD209 antigen-like C209B Q8CJ91 IPISQGK 325 G-anywhere protein B (DC-SIGN- related protein 1) (DC- SIGNR1) (OtB7) (CD antigen CD209) 47 F-box DNA helicase 1 FBH1 Q8K219 GINISNR 1042 G-anywhere (EC 3.6.4.12) (F-box only protein 18) 48 Serine dehydratase-like SDSL Q8R238 IQLGCS 329 G-anywhere (EC 4.3.1.17) (L-serine deaminase) (L-serine dehydratase/L- threonine deaminase) (L-threonine dehydratase) (TDH) (EC 4.3.1.19) (SDH) 49 Ribosome-releasing RRF2M Q8R2Q4 ILYYSG 779 G-anywhere factor 2, mitochondrial YTR (RRF2mt) (Elongation factor G 2, mitochondrial) (EF- G2mt) (mEF-G 2) 50 OTU domain- OTU7A Q8R554 AAMQG 926 G-anywhere containing protein 7A ER (EC 3.4.19.12) (Zinc finger protein Cezanne 2) 51 Leucine-rich repeat- LRC14 Q8VC16 ELSMGS 493 G-anywhere containing protein 14 SLLSGR 52 Neurotrophin receptor- NRIF2 Q921B4 NQQLGS 824 G-anywhere interacting factor 2 EQGKT (Zinc finger protein QTSR 369) 53 Electron transfer ETFD Q921G7 GIATND 616 G-anywhere flavoprotein- VGIQK ubiquinone oxidoreductase, mitochondrial (ETF- QO) (ETF-ubiquinone oxidoreductase) (EC 1.5.5.1) (Electron- transferring- flavoprotein dehydrogenase) (ETF dehydrogenase) 54 Polypeptide N- GLT11 Q921L8 LMKCH 608 G-anywhere acetylgalactosaminyl GSGGSQ transferase 11 (EC QWTFG 2.4.1.41) (Polypeptide K GalNAc transferase 11) (GalNAc-T11) (pp- GaNTase 11) (Protein- UDP acetylgalactosaminyl transferase 11) (UDP- GalNAc:polypeptide N- acetylgalactosaminyl transferase 11) 55 TOM1-like protein 1 TM1L1 Q923U0 LYKTGR 474 G-anywhere (Src-activating and EMQER signaling molecule protein) (Target of Myb-like protein 1) 56 Aconitate hydratase, ACON Q99KI0 YLSKTG 780 G-anywhere mitochondrial R (Aconitase) (EC 4.2.1.3) (Citrate hydro- lyase) 57 Leucine-rich repeat- LRC57 Q9D1G5 ELEGYD 239 G-anywhere containing protein 57 K 58 Gamma- GGCT Q9D7X8 LDFGNF 188 G-anywhere glutamylcyclotransferase QGKMS (EC 4.3.2.9) ER 59 Cyclin-L2 (Cyclin CCNL2 Q9JJA7 ERTDNS 518 G-anywhere Ania-6b) (Paneth cell- GKYK enhanced expression protein) (PCEE) 60 E3 SUMO-protein PIAS4 Q9JM05 YLNGL 507 G-anywhere ligase PIAS4 (EC GR 2.3.2.27) (PIASy) (Protein inhibitor of activated STAT protein 4) (Protein inhibitor of activated STAT protein gamma) (PIAS- gamma) (RING-type E3 ubiquitin transferase PIAS4) 61 Calmodulin-4 CALM4 Q9JM83 VADVD 148 G-anywhere (Calcium-binding QDGK protein Dd112) 62 PDZ domain- PDZD4 Q9QY39 GCNMC 772 G-anywhere containing protein 4 VVQK (PDZ domain- containing RING finger protein 4-like protein) 63 Short transient receptor TRPC2 Q9R244 EGLTLP 1172 G-anywhere potential channel 2 VPFNILP (TrpC2) (Transient SPK receptor protein 2 (TRP-2) (mTrp2) 64 A-kinase anchor AKA12 Q9WTQ ELEVPV 1684 G-anywhere protein 12 (AKAP-12) 5 HTGPNS (Germ cell lineage QKTAD protein gercelin) (Src- LTR suppressed C kinase substrate) (SSeCKS) 65 ATP-dependent 6- PFKAP Q9WUA GNQAV 784 G-anywhere phosphofructokinase, 3 R platelet type (ATP- PFK) (PFK-P) (EC 2.7.1.11) (6- phosphofructokinase type C) (Phosphofructo-1- kinase isozyme C) (PFK-C) (Phosphohexokinase) 66 Katanin p60 ATPase- KTNA1 Q9WV8 GREEKN 491 G-anywhere containing subunit A1 6 K (Katanin p60 subunit A1) (EC 5.6.1.1) (Lipotransin) (p60 katanin) 67 R-spondin-1 (Cysteine- RSPO1 Q9Z132 KGGQG 265 G-anywhere rich and single R thrombospondin domain-containing protein 3) (Cristin-3) (mCristin-3) (Roof plate-specific spondin- 1) 68 V-type proton ATPase VATC1 Q9Z1G3 ASAYN 382 G-anywhere subunit C 1 (V-ATPase NLKGN subunit C 1) (Vacuolar LONLER proton pump subunit C 1)
[0183] A list of 54 protein candidates from RBCs modified with biotin-peptide on the side chain of lysine(s) are shown in Table 3.
TABLE-US-00006 TABLE 3 UniProt Isoform No. Protein names ID ID Sequence Length Modifications 1 Extracellular calcium- CASR Q9QY96 LFINEGK 1079 K-side chain sensing receptor (CaSR) (Parathyroid cell calcium-sensing receptor) (PCaR1) 2 Transcription factor ZEP3 A2A884 GLPPMS 2348 K-side chain HIVEP3 (Human VK immunodeficiency virus type I enhancer- binding protein 3 homolog) (KB- binding and recognition component) (Kappa-B and V(D)J recombination signal sequences-binding protein) (Kappa- binding protein 1) (KBP-1) (Recombinant component) (Schnurri-3) (Zinc finger protein ZAS3) 3 Focadhesin FOCAD A2AKG8 TYETNK 1798 K-side chain QPGLK 4 Arginine/serine-rich RSRC2 A2RTL5 SQSAEI 376 K-side chain coiled-coil protein 2 WEK 5 E3 ubiquitin-protein RN213 E9Q555 EIDVQY 5152 K-side chain ligase RNF213 (EC K 2.3.2.27) (EC 3.6.4.-) (Mysterin) (RING finger protein 213) (RING-type E3 ubiquitin transferase RNF213) 6 Brefeldin A-inhibited BIG1 G3X9K3 FLTSQQL 1846 K-side chain guanine nucleotide- FK exchange protein 1 (BIG1) (Brefeldin A- inhibited GEP 1) (ADP-ribosylation factor guanine nucleotide-exchange factor 1) 7 Histone-lysine N- NSD1 O88491 ETISAQ 2588 K-side chain methyltransferase, H3 MVK lysine-36 and H4 lysine-20 specific (EC 2.1.1.-) (H3-K36- HMTase) (H4-K20- HMTase) (Nuclear receptor-binding SET domain-containing protein 1) (NR- binding SET domain- containing protein) 7 Histone-lysine N- NSD1 O88491 LLNNMH 2588 K-side chain methyltransferase, H3 EKTR lysine-36 and H4 lysine-20 specific (EC 2.1.1.-) (H3-K36- HMTase) (H4-K20- HMTase) (Nuclear receptor-binding SET domain-containing protein 1) (NR- binding SET domain- containing protein) 8 T-cell surface CD3G P11942 NTWNLG 182 K-side chain glycoprotein CD3 NNAK gamma chain (T-cell receptor T3 gamma chain) (CD antigen CD3g) 9 CD40 ligand (CD40- CD40L P27548 KENSFE 260 K-side chain L) (T-cell antigen MQR Gp39) (TNF-related activation protein) (TRAP) (Tumor necrosis factor ligand superfamily member 5) (CD antigen CD154) [Cleaved into: CD40 ligand, membrane form; CD40 ligand, soluble form (sCD40L)] 10 Sulfotransferase 1E1 ST1E1 P49891 EGDVEK 295 K-side chain (STIE1) (EC 2.8.2.4) CKEDAIF (Estrogen NR sulfotransferase, testis isoform) (Sulfotransferase, estrogen-preferring) 11 Solute carrier family S12A2 P55012 RQAMKE 1205 K-side chain 12 member 2 MSIDQA (Basolateral Na-K-Cl R symporter) (Bumetanide-sensitive sodium-(potassium)- chloride cotransporter 2) 12 26S proteasome PRS10 P62334 ALQDYR 389 K-side chain regulatory subunit KK 10B (26S proteasome AAA-ATPase subunit RPT4) (Proteasome 26S subunit ATPase 6) (Proteasome subunit p42) 13 Adenylate cyclase ADCY6 Q01341 LLLSVLP 1165 K-side chain type 6 (EC 4.6.1.1) QHVAME (ATP pyrophosphate- MK lyase 6) (Adenylate cyclase type VI) (Adenylyl cyclase 6) (AC6) (Ca(2+)- inhibitable adenylyl cyclase) 14 Transcription factor SOX13 Q04891 ILGSRW 613 K-side chain SOX-13 (SRY (Sex KSMTNQ determining region EK Y)-box 13) (mSox13) 15 Leucine-rich repeat LRIQ1 Q0P5X1 NQEKLM 1673 K-side chain and IQ domain- AHKSEQ containing protein 1 SR 16 von Willebrand factor VWA3A Q3UVV9 EFQNDL 1148 K-side chain A domain-containing TGLIDEQ protein 3A LSLKEK 17 Nesprin-3 (KASH SYNE3 Q4FZC9 NQQLQR 975 K-side chain domain-containing TEVDTG protein 3) (KASH3) KK (Nuclear envelope spectrin repeat protein 3) 18 Down syndrome cell DSCL1 Q4VA61 DGQVIIS 2053 K-side chain adhesion molecule- GSGVTIE like protein 1 SK homolog 19 Centrosome- CP250 Q60952 QNEDYE 2414 K-side chain associated protein KMVKAL CEP250 (250 kDa R centrosomal protein) (Cep250) (Centrosomal Nek2- associated protein 1) (C-Nap1) (Centrosomal protein 2) (Intranuclear matrix protein) 20 Cytochrome b-245 CY24B Q61093 TIELQM 570 K-side chain heavy chain (EC 1.-.-.-) KK (CGD91-phox) (Cytochrome b(558) subunit beta) (Cytochrome b558 subunit beta) (Heme- binding membrane glycoprotein gp91phox) (Neutrophil cytochrome b 91 kDa polypeptide) (gp91-1) (gp91-phox) (p22 phagocyte B- cytochrome) 21 Heat shock protein HS105 Q61699 NQQITH 858 K-side chain 105 kDa (42 degrees ANNTVS C-HSP) (Heat shock SFK 110 kDa protein) (Heat shock-related 100 kDa protein E7I) (HSP-E7I) 22 Tolloid-like protein 1 TLL1 Q62381 LSEQSEK 1013 K-side chain (mTl1) (EC 3.4.24.-) NR 23 E3 ubiquitin-protein SH3R1 Q69ZI1 LLSGAST 892 K-side chain ligase SH3RF1 (EC KR 2.3.2.27) (Plenty of SH3s) (Protein POSH) (RING-type E3 ubiquitin transferase SH3RF1) (SH3 domain- containing RING finger protein 1) (SH3 multiple domains protein 2) 24 Tubulin epsilon and TEDC2 Q6GQV0 VLGTRS 436 K-side chain delta complex protein TK 2 25 Vacuolar ATPase VMA21 Q78T54 QWREGK 101 K-side chain assembly integral QD membrane protein Vma21 26 Centrosomal protein CE120 Q7TSG1 DQQNNK 988 K-side chain of 120 kDa (Cep120) PEIR (Coiled-coil domain- containing protein 100) 27 Transcription TAF1 Q80UV9 LKRNQE 1891 K-side chain initiation factor TFIID K subunit 1 (EC 2.3.1.48) (EC 2.7.11.1) (Cell cycle gene 1 protein) (TBP- associated factor 250 kDa) (p250) (Transcription initiation factor TFIID 250 kDa subunit) (TAF(II)250) (TAFII- 250) (TAFII250) 28 Carbohydrate CHSTE Q80V53 LLSAYR 376 K-side chain sulfotransferase 14 NK (EC 2.8.2.35) (Dermatan 4- sulfotransferase 1) (D4ST-1) 29 Multidrug resistance- MRP9 Q80WJ6 LMNRFS 1366 K-side chain associated protein 9 K (ATP-binding cassette sub-family C member 12) 30 Uncharacterized CJ062 Q80Y39 EMQRES 304 K-side chain protein C10orf62 GK homolog 31 Tenascin-N (TN-N) TENN Q80Z71 LEEEMA 1560 K-side chain (Tenascin-W) (TN- ELKEQC W) NTNR 32 BRCA2-interacting EMSY Q8BMB0 ITTIPMT 1264 K-side chain transcriptional SK repressor EMSY 33 Zinc finger protein DZIP1 Q8BMD2 LNKKTS 852 K-side chain DZIP1 (DAZ- LR interacting protein 1 homolog) 34 Phosphatidylinositol PK3CB Q8BTI9 KMYEQE 1064 K-side chain 4,5-bisphosphate 3- MIAIEAA kinase catalytic INR subunit beta isoform (PI3-kinase subunit beta) (PI3K-beta) (PI3Kbeta) (PtdIns-3- kinase subunit beta) (EC 2.7.1.153) (Phosphatidylinositol 4,5-bisphosphate 3- kinase 110 kDa catalytic subunit beta) (PtdIns-3-kinase subunit p110-beta) (p110beta) 35 Dynein heavy chain 3, DYH3 Q8BW94 KMKFNL 4083 K-side chain axonemal (Axonemal K beta dynein heavy chain 3) (Ciliary dynein heavy chain 3) 36 E3 ubiquitin-protein ITCH Q8C863 ILNKPVG 864 K-side chain ligase Itchy (EC LK 2.3.2.26) (HECT-type E3 ubiquitin transferase Itchy homolog) 37 MICOS complex MIC60 Q8CAQ8 LEEKRTF 757 K-side chain subunit Mic60 DSAVAK (Mitochondrial inner membrane protein) (Mitofilin) 38 Ras-related protein RAB44 Q8CB87 VKNLLV 973 K-side chain Rab-44 DNK 39 Leucine-rich repeat- LRRC9 Q8CDN9 IEFLQQK 1456 K-side chain containing protein 9 40 Structural SMC4 Q8CG47 IFNLSGG 1286 K-side chain maintenance of EK chromosomes protein 4 (SMC protein 4) (SMC-4) (Chromosome- associated polypeptide C) (XCAP-C homolog) 41 CD209 antigen-like C209B Q8CJ91 IPISQGK 325 K-side chain protein B (DC-SIGN- related protein 1) (DC-SIGNR1) (OtB7) (CD antigen CD209) 42 F-box DNA helicase FBH1 Q8K219 YVTAAE 1042 K-side chain 1 (EC 3.6.4.12) (F- DKELEA box only protein 18) KIAVVE K 43 Major intrinsically MNAR1 Q8K3V7 CSVNNQ 917 K-side chain disordered Notch2- QSK binding receptor 1 (Membrane integral NOTCH2-associated receptor 1) (Protein DD1) (Ubiquitination and mTOR signaling protein) 44 Actin-related protein ARP8 Q8R2S9 QNGLKM 624 K-side chain 8 VDQAIW SK 45 Leucine-rich repeat- LRC14 Q8VC16 VAFMDK 493 K-side chain containing protein 14 KTLVLR 46 Electron transfer ETFD Q921G7 GIATND 616 K-side chain flavoprotein- VGIQK ubiquinone oxidoreductase, mitochondrial (ETF- QO) (ETF-ubiquinone oxidoreductase) (EC 1.5.5.1) (Electron- transferring- flavoprotein dehydrogenase) (ETF dehydrogenase) 47 Tetratricopeptide TTC14 Q9CSP9 NEAPEE 761 K-side chain repeat protein 14 MLNSK (TPR repeat protein 14) 48 Gamma- GGCT Q9D7X8 LDFGNF 188 K-side chain glutamylcyclotransfer QGKMSE ase (EC 4.3.2.9) R 49 LanC-like protein 2 LANC2 Q9JJK2 SLSREER 450 K-side chain (Testis-specific K adriamycin sensitivity protein) 50 Calmodulin-4 CALM4 Q9JM83 VADVDQ 148 K-side chain (Calcium-binding DGK protein Dd112) 51 Plexin-C1 (Virus- PLXC1 Q9QZC2 NQELCQ 1574 K-side chain encoded semaphorin VAVEKS protein receptor) (CD PK antigen CD232) 52 Protein BEX1 (Brain- BEX1 Q9R224 NLNMEN 128 K-side chain expressed X-linked DHQKKE protein 1 homolog) EK (Reduced expression protein 3) (REX-3) 53 Short transient TRPC2 Q9R244 EGLTLP 1172 K-side chain receptor potential VPFNILP channel 2 (TrpC2) SPK (Transient receptor protein 2) (TRP-2) (mTrp2) 54 A-kinase anchor AKA12 Q9WTQ5 ELEVPV 1684 K-side chain protein 12 (AKAP- HTGPNS 12) (Germ cell QKTADL lineage protein TR gercelin) (Src- suppressed C kinase substrate) (SSeCKS)
[0184] A list of 18 protein candidates from RBCs modified with biotin-peptide on glycine and the side chain of lysine were shown in Table 4.
TABLE-US-00007 TABLE 4 UniProt Isoform No. Protein names ID ID Sequence Length Modifications 1 Extracellular calcium- CASR Q9QY96 LFINEGK 1079 G-anywhere sensing receptor and K side (CaSR) (Parathyroid chain cell calcium-sensing receptor) (PCaR1) 2 T-cell surface CD3G P11942 NTWNLG 182 G-anywhere glycoprotein CD3 NNAK and K side gamma chain (T-cell chain receptor T3 gamma chain) (CD antigen CD3g) 3 Sulfotransferase 1E1 ST1E1 P49891 EGDVEK 295 G-anywhere (STIE1) (EC 2.8.2.4) CKEDAIF and K side (Estrogen NR chain sulfotransferase, testis isoform) (Sulfotransferase, estrogen-preferring) 4 Down syndrome cell DSCL1 Q4VA61 DGQVIIS 2053 G-anywhere adhesion molecule- GSGVTIE and K side like protein 1 SK chain homolog 5 E3 ubiquitin-protein SH3R1 Q69ZI1 LLSGAST 892 G-anywhere ligase SH3RF1 (EC KR and K side 2.3.2.27) (Plenty of chain SH3s) (Protein POSH) (RING-type E3 ubiquitin transferase SH3RF1) (SH3 domain- containing RING finger protein 1) (SH3 multiple domains protein 2) 6 Tubulin epsilon and TEDC2 Q6GQV0 VLGTRS 436 G-anywhere delta complex protein TK and K side 2 chain 7 Vacuolar ATPase VMA21 Q78T54 QWREGK 101 G-anywhere assembly integral QD and K side membrane protein chain Vma21 8 Uncharacterized CJ062 Q80Y39 EMQRES 304 G-anywhere protein C10orf62 GK and K side homolog chain 9 E3 ubiquitin-protein ITCH Q8C863 ILNKPVG 864 G-anywhere ligase Itchy (EC LK and K side 2.3.2.26) (HECT-type chain E3 ubiquitin transferase Itchy homolog) 10 Structural SMC4 Q8CG47 IFNLSGG 1286 G-anywhere maintenance of EK and K side chromosomes protein chain 4 (SMC protein 4) (SMC-4) (Chromosome- associated polypeptide C) (XCAP-C homolog) 11 CD209 antigen-like C209B Q8CJ91 IPISQGK 325 G-anywhere protein B (DC-SIGN- and K side related protein 1) chain (DC-SIGNR1) (OtB7) (CD antigen CD209) 12 F-box DNA helicase FBH1 Q8K219 GINISNR; 1042 G-anywhere 1 (EC 3.6.4.12) (F- and and K side box only protein 18) YVTAAE chain DKELEA KIAVVE K 13 Leucine-rich repeat- LRC14 Q8VC16 ELSMGS 493 G-anywhere containing protein 14 SLLSGR; and K side and chain VAFMDK KTLVLR 14 Electron transfer ETFD Q921G7 GIATND 616 G-anywhere flavoprotein- VGIQK and K side ubiquinone chain oxidoreductase, mitochondrial (ETF- QO) (ETF-ubiquinone oxidoreductase) (EC 1.5.5.1) (Electron- transferring- flavoprotein dehydrogenase) (ETF dehydrogenase) 15 Gamma- GGCT Q9D7X8 LDFGNF 188 G-anywhere glutamylcyclotransfer QGKMSE and K side ase (EC 4.3.2.9) R chain 16 Calmodulin-4 CALM4 Q9JM83 VADVDQ 148 G-anywhere (Calcium-binding DGK and K side protein Dd112) chain 17 Short transient TRPC2 Q9R244 EGLTLP 1172 G-anywhere receptor potential VPFNILP and K side channel 2 (TrpC2) SPK chain (Transient receptor protein 2) (TRP-2) (mTrp2) 18 A-kinase anchor AKA12 Q9WTQ5 ELEVPV 1684 G-anywhere protein 12 (AKAP- HTGPNS and K side 12) (Germ cell QKTADL chain lineage protein TR gercelin) (Src- suppressed C kinase substrate) (SSeCKS)
[0185] A list of 22 membrane protein candidates from RBCs modified with biotin-peptide on glycine and the side chain of lysine were shown in Table 5.
TABLE-US-00008 TABLE 5 Modification UniProt Isoform type and No. Protein names ID ID Sequence Length position 1 Extracellular calcium- CASR Q9QY96 LFINEGK 1079 G-anywhere sensing receptor (SEQ ID and K side (CaSR) (Parathyroid NO: 5) chain; G526/ cell calcium-sensing K527 receptor) (PCaR1) 2 T-cell surface CD3G P11942 NTWNLG 182 G-anywhere glycoprotein CD3 NNAK and K side gamma chain (T-cell (SEQ ID chain; G158/ receptor T3 gamma NO: 6) K162 chain) (CD antigen CD3g) 3 Down syndrome cell DSCL1 Q4VA61 DGQVIIS 2053 G-anywhere adhesion molecule- GSGVTIE and K side like protein 1 SK chain; G698/ homolog (SEQ ID K706 NO: 7) 4 Short transient TRPC2 Q9R244 EGLTLP 1172 G-anywhere receptor potential VPFNILP and K side channel 2 (TrpC2) SPK chain; G950/ (Transient receptor (SEQ ID K964 protein 2) (TRP-2) NO: 8) (mTrp2) 5 CD209 antigen-like C209B Q8CJ91 IPISQGK 325 G-anywhere protein B (DC-SIGN- (SEQ ID and K side related protein 1) NO: 9) chain; G110/ (DC-SIGNR1) (OtB7) K111 (CD antigen CD209) 6 E3 ubiquitin-protein ITCH Q8C863 ILNKPVG 864 G-anywhere ligase Itchy (EC LK and K side 2.3.2.26) (HECT-type (SEQ ID chain; K631/ E3 ubiquitin NO: 10) G634 transferase Itchy homolog) 7 A-kinase anchor AKA12 Q9WTQ5 ELEVPV 1684 G-anywhere protein 12 (AKAP-12) HTGPNS and K side (Germ cell lineage QKTADL chain; G1259/ protein gercelin) (Src- TR K1264 suppressed C kinase (SEQ ID substrate) (SSeCKS) NO: 11) 8 Inter alpha-trypsin ITIH4 A6X935 GSRSQIP 942 G-anywhere; inhibitor, heavy chain R G642 4 (ITI heavy chain (SEQ ID H4) (ITI-HC4) (Inter- NO: 12) alpha-inhibitor heavy chain 4) 9 Potassium- ATP4A Q64436 ILSAQGC 1033 G-anywhere; transporting ATPase K G219 alpha chain 1 (EC (SEQ ID 7.2.2.19) (Gastric NO: 13) H(+)/K(+) ATPase subunit alpha) (Proton pump) 10 P2X purinoceptor 1 P2RX1 P51576 NLSPGF 399 G-anywhere; (P2X1) (ATP NFR G288 receptor) (Purinergic (SEQ ID receptor) NO: 14) 11 Ryanodine receptor 3 RYR3 A2AGL3 NYMMS 4863 G-anywhere; (RYR-3) (RyR3) NGYK G962 (Brain ryanodine (SEQ ID receptor-calcium NO: 15) release channel) (Brain-type ryanodine receptor) (Type 3 ryanodine receptor) 12 Scavenger receptor C163A Q2VLH6 FQGKWG 1121 G-anywhere; cysteine-rich type 1 TVCDDN G180 protein M130 (CD FSK antigen CD163) (SEQ ID [Cleaved into: Soluble NO: 16) CD163 (sCD163)] 13 APC membrane AMER1 Q7TS75 LFGGKK 1132 G-anywhere; recruitment protein 1 (SEQ ID G61 (Amer1) (Protein NO: 17) FAM123B) 14 Serine/threonine- MRCKB Q7TT50 DIKPDN 1713 G-anywhere; protein kinase MRCK VLLDVN G212 beta (EC 2.7.11.1) GHIR (CDC42-binding (SEQ ID protein kinase beta) NO: 18) (DMPK-like beta) (Myotonic dystrophy kinase-related CDC42-binding kinase beta) (MRCK beta) (Myotonic dystrophy protein kinase-like beta) 15 Engulfment and cell ELMO1 Q8BPU7 GALKQN 727 G-anywhere; motility protein 1 K G629 (Protein ced-12 (SEQ ID homolog) NO: 19) 16 Desmoplakin (DP) DESP E9Q557 NSQGSE 2883 G-anywhere; MFGDDD G608 KRR (SEQ ID NO: 20) 17 CD40 ligand (CD40- CD40L P27548 KENSFE 260 K-side chain; L) (T-cell antigen MQR K106 Gp39) (TNF-related (SEQ ID activation protein) NO: 21) (TRAP) (Tumor necrosis factor ligand superfamily member 5) (CD antigen CD154) [Cleaved into: CD40 ligand, membrane form; CD40 ligand, soluble form (sCD40L)] 18 Solute carrier family S12A2 P55012 RQAMKE 1205 K-side chain; 12 member 2 MSIDQA K826 (Basolateral Na-K-Cl R symporter) (SEQ ID (Bumetanide-sensitive NO: 22) sodium-(potassium)- chloride cotransporter 2) 19 Adenylate cyclase ADCY6 Q01341 LLLSVLP 1165 K-side chain; type 6 (EC 4.6.1.1) QHVAME K353 (ATP pyrophosphate- MK 20 lyase 6) (Adenylate (SEQ ID cyclase type VI) NO: 23) (Adenylyl cyclase 6) (AC6) (Ca(2+)- inhibitable adenylyl cyclase) Cytochrome b-245 CY24B Q61093 TIELQM 570 K-side chain; heavy chain (EC 1.-.-.-) KK K313/ K314 (CGD91-phox) (SEQ ID (Cytochrome b(558) NO: 24) subunit beta) (Cytochrome b558 subunit beta) (Heme- binding membrane glycoprotein gp91phox) (Neutrophil cytochrome b 91 kDa polypeptide) (gp91-1) (gp91-phox) (p22 phagocyte B- cytochrome) 21 Major intrinsically MNAR1 Q8K3V7 CSVNNQ 917 K-side chain; disordered Notch2- QSK K79 binding receptor 1 (SEQ ID (Membrane integral NO: 25) NOTCH2-associated receptor 1) (Protein DD1) (Ubiquitination and mTOR signaling protein) 22 Plexin-C1 (Virus- PLXC1 Q9QZC2 NQELCQ 1574 K-side chain; encoded semaphorin VAVEKS K642 protein receptor) (CD PK antigen CD232) (SEQ ID NO: 26)
Example 2. Mg SrtA-Mediated Protein-Cell Conjugation Via Irreversible Linker
Methods
[0186] Recombinant Protein Expression and Purification in E. coli
[0187] Mg SrtA and eGFP-cys cDNA were cloned in pET vectors and transformed in E. coli BL21(DE3) cells for protein expression. Transformed cells were cultured at 37° C. until the OD.sub.600 reached 0.6-0.8, and then 500 μM IPTG was added. The cells were cultured with IPTG for 4 hrs at 37° C. until harvested by centrifugation and subjected to lysis by precooled lysis buffer (20 mM Tris-HCl, pH 7.8, 500 mM NaCl. The lysates were sonicated on ice (5 s on, 5 s off, 60 cycles, 25% power, Branson Sonifier 550 Ultrasonic Cell Disrupter). All supernatants were filtered by 0.45 μM filter after centrifugation at 14,000 g for 40 min at 4° C. Filtered supernatants were loaded onto HisTrap FF 1 mL column (GE Healthcare) connected to the AKTA design chromatography systems. The proteins were eluted with the elution buffer containing 20 mM Tris-HCl, pH 7.8, 500 mM NaCl and 300 mM imidazole. All eluted fractions were analyzed on an SDS-PAGE gel.
Irreversible Linker Conjugation to Protein by Cysteine Coupling
[0188] Irreversible linker, 6-Maleimidohexanoic Acid-Leu-Pro-Glu-Thr-2-hydroxyacetic acid-Gly (6-Maleimidohexanoic Acid-LPET-(2-hydroxyacetic acid)-G, 6-Mal-LPET*G), was synthesized with more than 99% purity. Reactions were performed in a total volume of 1 mL at room temperature for 1 hr in PBS buffer while being rotated at a speed of 10 rpm. The concentrations of 6-Mal-LPET*G and eGFP-cys protein were 2 mM and 500 μM, respectively. This method uses a four-fold molar excess of irreversible linker to eGFP-cys protein. After the reaction, the eGFP-cys-6-Mal-LPET*G products were collected by removal of excess irreversible linker via dialysis and ultrafiltration.
Mg SrtA-Mediated Enzymatic Labeling of Membrane Proteins
[0189] Reactions were performed in a total volume of 200 μL at 37° C. for 2 hrs in PBS buffer while being rotated at a speed of 10 rpm. The concentration of mg SrtA was 10 μM and the eGFP-cys-6-Mal-LPET*G substrates were in the range of 25-75 μM. Human or mouse RBCs were washed twice with PBS before the enzymatic reaction. The concentration of RBCs in the reaction was 1×10.sup.9/mL. After the reaction, the labeling efficiency of RBCs was analyzed by Beckman Coulter CytoFLEX LX or Merck Amnis Image Stream MarkII.
Product Identified by Mass Spectrometry.
[0190] Chromatographic desalting and separation of proteins were performed on the 1260 Infinity II system (Agilent Technologies) equipped with a ZORBAX 300SB-C3 column (2.1×150 mm) (Agilent Technologies). 1 μg protein was loaded onto the column and separated from the interference species with a gradient of mobile phase A (water, 0.1% formic acid) and mobile phase B (acetonitrile, 0.08% formic acid) at a flow rate of 0.4 ml/min. The gradient was 5%-95% phase B in 12 min. Following chromatographic separation, the protein samples were analyzed on a 6230 TOF LC/MS spectrometer (Agilent Technologies) equipped with a Dual ESI ion source. TOF-MS spectra were extracted from the total ion chromatograms (TICs) and deconvoluted using the Maximum Entropy incorporated in BioConfirm 10.0 software (Agilent Technologies).
In-Gel Digestion
[0191] The whole gel was stained by Coomassie blue (H.sub.2O, 0.1% w/v Coomassie brilliant blue R250, 40% v/v methanol and 10% v/v acetic acid) at room temperature with gentle shaking overnight, and then destained with the destaining solution (40% v/v methanol and 10% v/v acetic acid in water). The gel was rehydrated three times in distilled water at room temperature for 10 min with gentle agitation. The protein bands were cut out and further cut off into ca 1×1 mm.sup.2 pieces, followed by reduction with 10 mM TCEP in 25 mM NH4HCO3 at 25° C. for 30 min, alkylation with 55 mM IAA in 25 mM NH.sub.4HCO.sub.3 solution at 25° C. in the dark for 30 min, sequential digestion with rPNGase F at a concentration of 100 unit/ml at 37° C. for 4 hrs, and digestions with trypsin at a concentration of 12.5 ng/mL at 37° C. overnight (1st digestion for 4 hrs and 2nd digestion for 12 hrs). Tryptic peptides were then extracted out from gel pieces by using 50% ACN/2.5% FA for three times and the peptide solution was dried under vacuum. Dry peptides were purified by Pierce C18 Spin Tips (Thermo Fisher, USA).
Results
[0192] We first characterized the irreversible linker for protein conjugation. eGFP was used to test the conjugation efficiency of the reaction. We expressed and purified the eGFP with cysteine at the C terminus (eGFP-cys). We also synthesized the irreversible linker, 6-Mal-LPET*G. These two reaction substrates were mixed at a ratio of 1:4=eGFP-cys:6-Mal-LPET*G for reaction (
[0193] Then we characterized the labeling efficacy of different kinds of eGFP on the RBC membrane. eGFP-LPETG was employed as the control of the reversible substrate. Our results showed that >75% of natural RBCs were eGFP-cys-6-Mal-LPET*G-labeled by mg SrtA in vitro. In contrast, only about 30% of the signal was detected on the surface of RBCs by using reversible substrate eGFP-LPETG (
[0194] To assess the life-span of these surface modified RBCs in vivo, we next transfused eGFP-cys-6-Mal-LPET*G tagged mouse RBCs, which were simultaneously labeled by a fluorescent dye DiR (1,1′-dioctadecyl-3,3,3′,3′-tetramethylindotricarbocyanine iodide), into wildtype recipient mice. The percentage of DiR and eGFP-cys-6-Mal-LPET*G positive RBCs in vivo was analyzed periodically. We found that eGFP-cys-6-Mal-LPET*G labeled RBCs by mg SrtA not only showed the same lifespan as that of the control groups but also exhibited sustained eGFP-cys-6-Mal-LPET*G signals in circulation for 35 days (
[0195] While embodiments of the invention have been illustrated and described, it is not intended that these embodiments illustrate and describe all possible forms of the invention. Rather, the words used in the specification are words of description rather than limitation and it is understood that various changes may be made without departing from the spirit and scope of the invention.
Example 3. Mg SrtA-Mediated HPV16-hMHC1 Protein-Cell Conjugation Via Irreversible Linker
Methods
Recombination Expression and Purification of HPV16-MHC1 Protein
[0196] After being separated from cells by centrifugation and microfiltration, the superHPV16-MHC cDNA was cloned in pcDNA3.1 vectors. cDNA and Electroporation Buffer were mixed and then placed into the electroporation cuvette. The vectors were electroporated into CHO cells using Flow Electroporator EBXP-F1 (X-Porator F1, Etta, SuZhou, China) and following manufacturer protocols that were optimized for CHO cells. After 7 days, all supernatants were collected by centrifuging at 14000 g for 40 min at 4° C. and filtered by 0.22 bt M filter. Being separated from cells by centrifugation and microfiltration, the supernatant comprising the expressed HPV16-MHC1 proteinwas loaded onto the IMAC Bestarose FF column (Bestchrom, Shanghai, China) with Ni2+ ion equilibrated with binding buffer (20 mM Tris-HCl, 500 mM NaCl, pH7.6). The column was washed by the binding buffer and then eluted by elution buffer 1 (20 mM Tris-HCl, 500 mM NaCl, 30 mM imidazole, pH7.6) until UV absorbance at 280 nm became stable. The protein was collected with elution buffer 2 (20 mM Tris-HCl, 500 mM NaCl, 100 mM imidazole, pH7.6). The nucleic acid sequence and the amino acid sequence of the HPV16-hMHC1 protein is as follows:
TABLE-US-00009 DNA sequence (SEQ ID NO: 27) atgtctcgctccgtggccttagctgtgctcgcgctactctctctttctggcctggaggctTACATGCTGGACCTGCAGC CCGAGACCggctgcggcgcctccggtggcggtggctccggcggtggtgggtccatccagcgtactccaaagattcaggttta ctcacgtcatccagcagagaatggaaagtcaaatttcctgaattgctatgtgtctgggtttcatccatccgacattgaagttgacttactga agaatggagagagaattgaaaaagtggagcattcagacttgtctttcagcaaggactggtctttctatctcttgtactacactgaattcacc cccactgaaaaagatgagtatgcctgccgtgtgaaccatgtgactttgtcacagcccaagatagttaagtgggatcgagacatgggtg gcggtggctccggcggtggtgggtccggtggcggtggctccggcggtggtgggtccGGCAGCCACAGCATGAGG TACTTCTTCACCAGCGTGAGCAGGCCCGGCAGGGGCGAGCCCAGGTTCATCGCC GTGGGCTACGTGGACGACACCCAGTTCGTGAGGTTCGACAGCGACGCCGCCAGC CAGAGGATGGAGCCCAGGGCCCCCTGGATCGAGCAGGAGGGCCCCGAGTACTGG GACGGCGAGACCAGGAAGGTGAAGGCCCACAGCCAGACCCACAGGGTGGACCT GGGCACCCTGAGGGGCTGTTACAACCAGAGCGAGGCCGGCAGCCACACCGTGCA GAGGATGTACGGCTGCGACGTGGGCAGCGACTGGAGGTTCCTGAGGGGCTACCA CCAGTACGCCTACGACGGCAAGGACTACATCGCCCTGAAGGAGGACCTGAGGAG CTGGACCGCCGCCGACATGGCCGCCCAGACCACCAAGCACAAGTGGGAGGCCGC CCACGTGGCCGAGCAGCTGAGGGCCTACCTGGAGGGCACCTGCGTGGAGTGGCT GAGGAGGTACCTGGAGAACGGCAAGGAGACCCTGCAGAGGACCGACGCCCCCA AGACCCACATGACCCACCACGCCGTGAGCGACCACGAGGCCACCCTGAGGTGCT GGGCCCTGAGCTTCTACCCCGCCGAGATCACCCTGACCTGGCAGAGGGACGGCG AGGACCAGACCACCGAGCTGGTGGAGACCAGGCCCGCCGGCGACGGCACCTTCC AGAAGTGGGCCGCCGTGGTGGTGCCCAGCGGCCAGGAGCAGAGGTACACCTGCC ACGTGCAGCACGAGGGCCTGCCCAAGCCCCTGACCCTGAGGTGGGAGATGggcgga ggtggctctACTCACACATGCCCACCGTGCCCAGCACCTGAACTCCTGGGGGGACCGT CAGTCTTCCTCTTCCCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACCCC TGAGGTCACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTGAGGTCAAGTT CAACTGGTACGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGA GGAGCAGTACAACAGCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCA GGACTGGCTGAATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCC AGCCCCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACA GGTGTACACCCTGCCCCCATCCCGGGATGAGCTGACCAAGAACCAGGTCAGCCT GACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAG CAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGA CGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCA GGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACG CAGAAGAGCCTCTCCCTGTCTCCGGGTAAAtgtTGA Amino acid sequence (SEQ ID NO: 28) MSRSVALAVLALLSLSGLEAYMLDLQPETGCGASGGGGSGGGGSIQRTPKIQVYSRH PAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFT PTEKDEYACRVNHVTLSQPKIVKWDRDMGGGGSGGGGSGGGGSGGGGSGSHSMR YFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGE TRKVKAHSQTHRVDLGTLRGCYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYA YDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRY LENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTTE LVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWEMGGGGSTHT CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKC*
[0197] The protein fraction was then diluted with ddH2O (1:1), and the loaded onto Diamond Mix-A column (Bestchrom, Shanghai, China) equilibrated with binding buffer (10 mM Tris-HCl, 250 mM NaCl, pH7.6). After being washed by the binding buffer and eluted by elution buffer 1 (13.3 mM Tris-HCl, 337.5 mM NaCl, pH7.6), the target protein was eluted with elution buffer 2 (20 mM Tris-HCl, 2000 mM NaCl, pH7.6), and then concentrated with Amicon Ultra-15 Centrifugal Filter Unit (Millipore, Darmstadt, Germany).
[0198] Concentrated protein was loaded to Chromdex 200 μg (Bestchrom, Shanghai, China) equilibrated with PBS, and the target protein fractions were collected. The protein was concentrated and stored at −80° C.
Irreversible Linker Conjugation to HPV16-MHC1 by Cysteine Coupling
[0199] Irreversible linker, 6-Maleimidohexanoic Acid-Leu-Pro-Glu-Thr-2-hydroxyacetic acid-Gly (6-Maleimidohexanoic Acid-LPET-(2-hydroxyacetic acid)-G, 6-Mal-LPET*G), was synthesized with more than 99% purity. Reactions were performed in a total volume of 1 mL at room temperature for 1 hr in PBS buffer while being rotated at a speed of 10 rpm. The concentrations of 6-Mal-LPET*G and HPV16-MHC1 protein were 2 mM and 500 μM, respectively. This method uses a two-fold molar excess of irreversible linker to HPV16-MHC1 protein. After the reaction, the HPV16-MHC1-LPET*G products were collected by removal of excess irreversible linker via dialysis and ultrafiltration.
Mg SrtA-Mediated Labeling of HPV16-MHC1-LPET*G
[0200] Red blood cells were separated from peripheral blood by density gradient centrifugation. The separated red blood cells were washed with PBS for 3 times. Reactions were performed in PBS buffer while being rotated at a speed of 10 rpm. The concentration of RBCs in the reaction was 1×10.sup.9/mL. The concentration of mg SrtA was 10 μM and the HPV16-MHC1-LPET*G substrates were 25 μM. After the reaction, the labeling efficiency of RBCs was analyzed by Beckman Coulter CytoFLEX LX.
Results
[0201] We characterized the efficacy of mg SrtA-mediated labeling of HPV16 (YMLDLQPET)-hMHC1 on RBC membranes. The conjugation efficacy was detected by incubating the labeled RBCs with PE-conjugated anti Fc tag antibody and analyzed by flow cytometry. The results in
Example 4. Mg SrtA-Mediated UOX Protein-Cell Conjugation Via Irreversible Linker
Methods
[0202] Recombination Expression and Purification of UOX-Cys or UOX-His.sub.6-CVs or UOX-(GS).sub.3-Cys in E. coli
[0203] The coding sequence of UOX (Aspergillus flavus uricase) was codon optimized for expression in E. coli and synthesized by GenScript. Subclones were generated by standard PCR procedure and inserted into the pET-30a vector with C-terminal His.sub.6 or (GS).sub.3 linker followed by an additional cysteine residue. All constructs were verified by sequencing and then transformed in E. coli BL21 (DE3) for protein expression. The nucleic acid sequences and amino acid sequences of UOX-His6-Cys and UOX-(GS)3-Cys are as follows.
UOX-His6-Cys:
[0204]
TABLE-US-00010 DNA sequence (SEQ ID NO: 29) ATGtcagcagtaaaggcagcaagatacggtaaagataatgtcagagtctacaaggttcacaaggacgaaaaaactggtgttcaaac agtttacgaaatgactgtttgtgttttgttggaaggtgaaatcgaaacttcttacacaaaggctgataactcagttattgttgcaacagattct attaaaaatactatctatatcacagctaagcaaaacccagttactccaccagaattgttcggttcaatcttgggtacacatttcatcgaaaa gtacaaccatatccatgctgcacatgttaacatcgtttgtcatagatggactagaatggatattgatggtaaaccacatccacattcttttatt agagattcagaagaaaagagaaatgttcaagttgatgttgttgagggtaaaggtatcgatatcaagtcttcattgtcaggtttaactgttttg aagtctacaaattcacaattttggggtttcttgagagatgaatacactacattgaaggaaacatgggatagaattttatctactgatgttgat gctacatggcaatggaagaacttctcaggtttgcaagaagttagatctcatgttccaaaatttgatgctacttgggctacagcaagagaa gttactttgaagacattcgcagaagataactctgcttcagttcaagcaactatgtacaagatggctgaacaaatcttggcaagacaacaat tgatcgaaacagttgaatattcattaccaaataagcattacttcgaaatcgatttgtcttggcataagggtttgcaaaacactggtaaaaatg ctgaagttttcgcaccacaatctgatccaaatggtttgattaaatgcacagtcggtagatcctctttgaagtccaagttagcagcatgctga Amino acid sequence (SEQ ID NO: 30) MSAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKADNSVI VATDSIKNTIYITAKQNPVTPPELFGSILGTHFIEKYNHIHAAHVNIVCHRWTRMDIDG KPHPHSFIRDSEEKRNVQVDVVEGKGIDIKSSLSGLTVLKSTNSQFWGFLRDEYTTLK ETWDRILSTDVDATWQWKNFSGLQEVRSHVPKFDATWATAREVTLKTFAEDNSAS VQATMYKMAEQILARQQLIETVEYSLPNKHYFEIDLSWHKGLQNTGKNAEVFAPQS DPNGLIKCTVGRSSLKSKLAAHHHHHHC
UOX-(GS)3-Cys:
[0205]
TABLE-US-00011 DNA sequence (SEQ ID NO: 31) ATGtcagcagtaaaggcagcaagatacggtaaagataatgtcagagtctacaaggttcacaaggacgaaaaaactggtgttcaaac agtttacgaaatgactgtttgtgttttgttggaaggtgaaatcgaaacttcttacacaaaggctgataactcagttattgttgcaacagattct attaaaaatactatctatatcacagctaagcaaaacccagttactccaccagaattgttcggttcaatcttgggtacacatttcatcgaaaa gtacaaccatatccatgctgcacatgttaacatcgtttgtcatagatggactagaatggatattgatggtaaaccacatccacattcttttatt agagattcagaagaaaagagaaatgttcaagttgatgttgttgagggtaaaggtatcgatatcaagtcttcattgtcaggtttaactgttttg aagtctacaaattcacaattttggggtttcttgagagatgaatacactacattgaaggaaacatgggatagaattttatctactgatgttgat gctacatggcaatggaagaacttctcaggtttgcaagaagttagatctcatgttccaaaatttgatgctacttgggctacagcaagagaa gttactttgaagacattcgcagaagataactctgcttcagttcaagcaactatgtacaagatggctgaacaaatcttggcaagacaacaat tgatcgaaacagttgaatattcattaccaaataagcattacttcgaaatcgatttgtcttggcataagggtttgcaaaacactggtaaaaatg ctgaagttttcgcaccacaatctgatccaaatggtttgattaaatgcacagtcggtagatcctctttgaagtccaagttagcagcaGGT TCTGGTTCTGGTTCTtgctga Amino acid sequences (SEQ ID NO: 32) MSAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKADNSVI VATDSIKNTIYITAKQNPVTPPELFGSILGTHFIEKYNHIHAAHVNIVCHRWTRMDIDG KPHPHSFIRDSEEKRNVQVDVVEGKGIDIKSSLSGLTVLKSTNSQFWGFLRDEYTTLK ETWDRILSTDVDATWQWKNFSGLQEVRSHVPKFDATWATAREVTLKTFAEDNSAS VQATMYKMAEQILARQQLIETVEYSLPNKHYFEIDLSWHKGLQNTGKNAEVFAPQS DPNGLIKCTVGRSSLKSKLAAGSGSGSC
[0206] A single transformed colony was inoculated into 10 ml Luria-Bertani (LB) medium supplemented with ampicillin (100 μg/ml), and grown with 220 rpm shaking overnight at 37° C. This 10 ml culture was transferred to 1 L fresh LB medium and the culture was grown with 220 rpm shaking at 37° C. until OD.sub.600 reached 0.6. The temperature was then lowered to 20° C. and 1 mM IPTG was added for induction.
[0207] Cells were harvested at 20 h after induction by centrifugation at 8,000 rpm for 10 min at 4° C. For proteins without the His.sub.6 tag, cell pellet was resuspended in low salt lysis buffer (50 mM Tris 7.5, 50 mM NaCl) and lysed with sonication. The supernatant collected after centrifugation at 10,000 rpm for 1 h was loaded in SP Sepharose FF column (Cytiva, Marlborough, USA) pre-equilibrated with SPA buffer (20 mM Tris 7.5). The column was washed with SPA buffer until the absorbance at 280 nm and conductivity became stable and then eluted using a linear gradient of 0-1 M NaCl in 20 mM Tris 7.5. Fractions corresponding to the elution peak were analyzed by SDS-PAGE and the purest fractions were pooled. To avoid cysteine oxidation, 2 mM TCEP was added to the combined fractions and sample concentration was performed with the use of Amicon Ultra-15 Centrifugal Filter Unit (Millipore, Darmstadt, Germany). Concentrated protein was loaded to EzLoad 16/60 Chromdex 200 μg (Bestchrom, Shanghai, China) pre-equilibrated with PBS, and the target protein peak was collected. For proteins with His.sub.6 tag, cell pellet was resuspended in lysis buffer (50 mM Tris 7.5, 200 mM NaCl, 5 mM imidazole) and lysed with sonication. Tagged proteins were purified over Ni Sepharose 6 FF affinity column (Cytiva) and anion exchange column, followed by size exclusion chromatography. All proteins were stored at −80° C.
Irreversible Linker Conjugation to UOX-Cys or UOX-His.sub.6-CVs or UOX-(GS).sub.3-Cys by Cysteine Coupling
[0208] Irreversible linker, 6-Maleimidohexanoic Acid-Leu-Pro-Glu-Thr-2-hydroxyacetic acid-Gly (6-Maleimidohexanoic Acid-LPET-(2-hydroxyacetic acid)-G, 6-Mal-LPET*G), was synthesized with more than 99% purity. Reactions were performed in a total volume of 1 mL at room temperature for 1 hr in PBS buffer while being rotated at a speed of 10 rpm. The concentrations of 6-Mal-LPET*G and UOX-cys (UOX-His.sub.6 or UOX-(GS).sub.3-Cys) protein were 2 mM and 500 μM, respectively. This method uses a two-fold molar excess of irreversible linker to UOX-Cys, UOX-His.sub.6-Cys and UOX-(GS).sub.3-Cys protein. After the reaction, the UOX-Cys-LPET*G or UOX-His.sub.6-Cys-LPET*G or UOX-(GS).sub.3-Cys-LPET*G products were collected by removal of excess irreversible linker via dialysis and ultrafiltration.
Mg SrtA-Mediated Labeling of UOX-Cys-LPET*G or UOX-His.sub.6-Cys-LPET*G or UOX-(GS).sub.3-Cys-LPET*G
[0209] Reactions were performed in a total volume of 200 L˜15 mL at 37° C. for 2 hrs in PBS buffer while being rotated at a speed of 10 rpm. The concentration of mg SrtA was 10 μM and the UOX-Cys-LPET*G or UOX-His.sub.6-Cys-LPET*G or UOX-(GS).sub.3-Cys-LPET*G substrates were in the range of 10-100 μM. Human or mouse or rat or cynomolgus monkeys RBCs were washed twice with PBS before the enzymatic reaction. The concentration of RBCs in the reaction was 5×10.sup.9˜1×10.sup.10/mL. After the reaction, the labeling efficiency of RBCs was detected by incubating RBCs with FITC-His tag and analyzed by flow cytometry.
Results
[0210] We characterized the efficacy of mg SrtA-mediated labeling of UOX-His6-Cys-LPET*G on RBC membranes. 5×10.sup.9˜ 1×10.sup.10/mL mouse (
REFERENCES
[0211] [1] J. W. Yoo, D. J. Irvine, D. E. Discher, and S. Mitragotri, “Bio-inspired, bioengineered and biomimetic drug delivery carriers,” Nat. Rev. Drug Discov., vol. 10, no. 7, pp. 521-535, 2011. [0212] [2] J. M. Antos, J. Ingram, T. Fang, N. Pishesha, M. C. Truttmann, and H. L. Ploegh, “Site-Specific Protein Labeling via Sortase-Mediated transpeptidation,” 2017. [0213] [3] J. Shi, L. Kundrat, N. Pishesha, A. Bilate, C. Theile, and T. Maruyama, “Engineered red blood cells as carriers for systemic delivery of a wide array of functional probes,” pp. 1-6, 2014. [0214] [4] P. Daniel Harris, BA, Lynn McNicoll, MD, Gary Epstein-Lubow, MD, and Kali S. Thomas, “Recent Advances in Sortase-Catalyzed Ligation Methodology,” Physiol. Behav., vol. 176, no. 1, pp. 139-148, 2017. [0215] [5] Y. Ge, L. Chen, S. Liu, J. Zhao, H. Zhang, and P. R. Chen, “Enzyme-Mediated Intercellular Proximity Labeling for Detecting Cell-Cell Interactions,” J. Am. Chem. Soc., vol. 141, no. 5, pp. 1833-1837, 2019. [0216] [6] Y. Zhu, T. Guo, and S. K. Sze, “Chapter 22 Elucidating Structural Dynamics of Integral Membrane Proteins on Native Cell Surface by Hydroxyl Radical Footprinting and Nano LC-MS/MS,” vol. 790, pp. 287-303. [0217] [7] Swee, L. K.; Lourido, S.; Bell, G. W.; Ingram, J. R.; Ploegh, H. L. One-step Enzymatic Modification of the Cell Surface Redirects Cellular Cytotoxicity and Parasite Tropism. ACS Chem. Biol. 2015, 10, 460-465. [0218] [8] N. Pishesha et al., “Engineered erythrocytes covalently linked to antigenic peptides can protect against autoimmune disease,” vol. 114, no. 17, 2017. [0219] [9] A. J. Grimm, S. Kontos, G. Diaceri, and X. Quaglia-thermes, “Memory of tolerance and induction of regulatory T cells by erythrocyte-targeted antigens,” Nat. Publ. Gr., pp. 1-11. [0220] [10] A. Karaplis, L. Pong, L. Chien, and N. Chattopadhyay, “Parathyroid hormone ablation alters erythrocyte parameters that are rescued by calcium-sensing receptor gene deletion,” vol. 91, no. 1, pp. 37-45, 2014. [0221] [10] Kuba K, Imai Y, Rao S, Gao H, Guo F, et al. 2005. Nat Med 11: 875-9. [0222] [11] Glowacka I, Bertram S, Herzog P, et al. 2010. Journal of Virology 84: 1198-205. [0223] [12] Huang F, Guo J, Zou Z, Liu J, Cao B, et al. 2014. Nat Commun 5: 3595. [0224] [13] Imai Y, Kuba K, Rao S, Huan Y, Guo F, et al. 2005. Nature 436: 112-6.