ANTIBODY TARGETING INTERLEUKIN 36R, PREPARATION METHOD THEREFOR, AND APPLICATION THEREOF

20230399409 · 2023-12-14

    Inventors

    Cpc classification

    International classification

    Abstract

    The present application provides an antibody targeting interleukin 36R, a preparation method therefor, and an application thereof. Specifically, the present application provides an IL-36R antibody having high affinity and high bioactivity. The antibody can bind to IL-36R with high affinity, and can block the binding between an IL-36R ligand (α, β. γ) and the IL-36R and a signal path activated by the IL-36R ligand, thereby treating and/or preventing IL-36 related diseases.

    Claims

    1. An antibody, comprising: (1) a heavy-chain variable region comprising the following three complementary determining regions CDRs: CDR1 as set forth in SEQ ID NO: 3, CDR2 as set forth in SEQ ID NO: 4, and CDR3 as set forth in SEQ ID NO: 5; and (2) a light-chain variable region comprising the following three complementary determining regions CDRs: CDR1′ as set forth in SEQ ID NO: 6, CDR2′ as set forth in SEQ ID NO: 7, and CDR3′ as set forth in SEQ ID NO: 8.

    2. The antibody according to claim 1, wherein said antibody is selected from the group consisting of: animal-derived antibodies, chimeric antibodies, humanized antibodies, or combinations thereof.

    3. The antibody according to claim 1, wherein said heavy-chain variable region of said antibody has a sequence as set forth in SEQ ID NO: 1 or 9; and/or said light-chain variable region of said antibody has a sequence as set forth in SEQ ID NO: 2, 10, 11 or 12.

    4. A recombinant protein, comprising: (i) the antibody according to claim 1; and (ii) an optional tag sequence assisting expression and/or purification.

    5. A CAR construct, wherein an scFv segment of an antigen-binding region of a monoclonal antibody of said CAR construct specifically binds to a binding region of IL-36R, and, a heavy-chain variable region of said scFv comprises the following three complementary determining regions CDRs: CDR1 as set forth in SEQ ID NO: 3, CDR2 as set forth in SEQ ID NO: 4, and CDR3 as set forth in SEQ ID NO: 5; and a light-chain variable region of said scFv comprises the following three complementary determining regions CDRs: CDR1′ as set forth in SEQ ID NO: 6, CDR2′ as set forth in SEQ ID NO: 7, and CDR3′ as set forth in SEQ ID NO: 8.

    6. A recombinant immune cell, expressing the exogenous CAR construct according to claim 5.

    7. An antibody-drug conjugate, comprising: (a) an antibody moiety, wherein said antibody moiety is the antibody according to claim 1; and (b) a conjugated moiety conjugated to the antibody moiety, wherein said conjugated moiety is selected from the group consisting of: detectable markers, drugs, toxins, cytokines, radionuclides, enzymes, or combinations thereof.

    8. A method of preventing and/or treating IL-36-related diseases comprising administering an active ingredient the antibody according to claim 1, the recombinant protein according to claim 4, the CAR construct according to claim 5, the immune cell according to claim 6, the antibody-drug conjugate according to claim 7, or a combination thereof to a subject in need thereof.

    9. The use method according to claim 8, wherein said IL-36-related diseases comprise psoriasis.

    10. A pharmaceutical composition, comprising: (i) an active ingredient selected from the group consisting of: the antibody according to claim 1, the recombinant protein according to claim 4, the CAR construct according to claim 5, the immune cell according to claim 6, the antibody-drug conjugate according to claim 7, or a combination thereof; and (ii) a pharmaceutically acceptable carrier.

    11. (canceled)

    12. (canceled)

    13. (canceled)

    14. A non-diagnostic method for in vitro detection of an IL-36R protein in a sample, wherein said method comprises the steps of: contacting, in vitro, the sample with said antibody according to claim 1 and detecting whether an antigen-antibody complex is formed, wherein the formation of the complex indicates the presence of the IL-36R protein in the sample.

    15. (canceled)

    16. (canceled)

    17. (canceled)

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0099] The specific features of the present invention involved in the present application are listed in the appended claims. The characteristics and advantages of the present invention involved in the present application may be better understood by referring to the exemplary embodiments and the accompanying drawings described in detail below. A brief description of the drawings is as follows:

    [0100] FIG. 1 shows the results of cytokine IL-6 release in a bioactivity detection for candidate humanized antibodies;

    [0101] FIG. 2 shows the results of cytokine IL-8 release in a bioactivity detection for candidate humanized antibodies;

    [0102] FIG. 3 shows the results of cytokine GM-CSF release in a bioactivity detection for candidate humanized antibodies;

    [0103] FIG. 4 shows the results of NF-κB phosphorylation in a bioactivity detection for candidate humanized antibodies;

    [0104] FIG. 5 shows the cell binding activity of candidate antibodies to human IL-36R;

    [0105] FIG. 6 shows the cell binding activity of candidate antibodies to monkey IL-36R;

    [0106] FIG. 7 shows the functional inhibition effect of candidate antibodies against huIL-36 stimulating factors in NCI/ADR-RES cells;

    [0107] FIG. 8 shows the functional inhibition effect of candidate antibodies against huIL-36 stimulating factors in HIF cells;

    [0108] FIG. 9 shows the functional inhibition effect of candidate antibodies against huIL-36 stimulating factors in HIF cells;

    [0109] FIG. 10 shows the functional inhibition effect of candidate antibodies against huIL-36 stimulating factors in HIF cells;

    [0110] FIG. 11 shows the effect of candidate antibodies on the clinical scoring (PASI) of cynomolgus monkeys with imiquimod-induced psoriasis; and

    [0111] FIG. 12 shows the effect of candidate antibodies on the HE-staining pathological scoring of skin tissues of cynomolgus monkey with imiquimod-induced psoriasis.

    DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS

    [0112] The embodiments of the invention of the present application will be illustrated by specific examples below. Those familiar with this technology may easily understand other advantages and effects of the invention of the present application from the content disclosed in the specification.

    Terms and Definitions

    [0113] Based on extensive and in-depth researches, the applicants have unexpectedly obtained an IL-36R antibody with high affinity and high bioactivity. Experiments have shown that the IL-36R antibody of the present application may bind to IL-36R at high affinity, and block the binding of IL-36R ligands (α, β, γ) to IL-36R to block the signaling pathway activated by the IL-36R ligands, thereby treating and/or preventing IL-36-related diseases. The present invention is implemented on this basis.

    Terms

    [0114] As used herein, the terms “administration” and “treatment” refer to the application of exogenous medicaments, therapeutic agents, diagnostic agents, or compositions to animals, humans, subjects, cells, tissues, organs, or biological fluids. “Administration” and “treatment” may refer to treatment, pharmacokinetics, diagnosis, studies, and experimental methods. The treatment of cells comprises contact between reagents and cells, contact between reagents and fluids, and contact between fluids and cells. “Administration” and “treatment” also mean in vitro and ex vivo treatment by means of reagents, diagnostics, and binding compositions, or by another cell. When applied to humans, animals, or research subjects, “treatment” refers to therapeutic treatment, prevention or preventive measures, study, and diagnosis. It encompasses the contact between IL-36R antibodies and humans or animals, subjects, cells, tissues, physiological compartments, or physiological fluids.

    [0115] As used herein, the term “therapy” refers to the administration of an internally or externally applied therapeutic agent, which comprises any of the IL-36R antibodies and compositions thereof in the present application, to a patient who has one or more disease symptoms, and furthermore, the therapeutic agent is known to show a therapeutic effect against these symptoms. The therapeutic agent is usually administered to the patient at an amount (therapeutically effective amount) for effectively alleviating one or more disease symptoms.

    [0116] As used herein, the term “optional” or “optionally” means that the event or situation described subsequently may occur but does not have to occur. For example, “optionally comprising 1 to 3 antibody heavy-chain variable regions” refers to that a particular sequence may have but not necessarily have 1, 2 or 3 antibody heavy-chain variable regions.

    Antibody

    [0117] As used herein, the term “antibody” refers to immunoglobulin, which is a tetrapeptide chain structure connected by interchain disulfide bonds between two identical heavy chains and two identical light chains. Different immunoglobulin heavy chain constant regions exhibit different amino acid compositions and rank orders, thereby presenting different antigenicity. Accordingly, immunoglobulins may be divided into five categories, or called immunoglobulin isotypes, namely IgM, IgD, IgG; IgA and IgE, which correspond to heavy-chain constant regions, called α, δ, ε, γ and μ, of different types of immunoglobulins. IgG represents one of the most important classes of immunoglobulins, and due to differences in its chemical structure and biological function, it can be divided into four sub-categories: IgG1, IgG2, IgG3, and IgG4. Light chains are divided into κ or λ chains considering of different constant regions. The subunit structures and three-dimensional configurations of immunoglobulins in different categories are well known to those in the art.

    [0118] Near the N-terminal of the antibody heavy chains and light chains, the sequence of about 110 amino acids varies largely, known as the variable region (V region); and the rest of the amino acid sequence near the C-terminal is relative stable, known as the constant region (C region). The variable region comprises three hypervariable regions (HVR) and four FRs with a relatively conserved sequence. The amino acid sequence of the four FRs are relatively conserved and are not directly involved in a binding reaction. The three hypervariable regions determine the specificity of the antibody, also known as complementary determining regions (CDRs). Each light-chain variable region (LCVR) and each heavy-chain variable region (HCVR) are composed of three CDRs and four FRs, with a sequential rank order from the amino terminal to the carboxyl terminal being: FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4. The three CDRs of the light chain, namely the light-chain hypervariable regions (LCDRs), refer to LCDR1, LCDR2 and LCDR3; and the three CDRs of the heavy chain, namely the heavy-chain highly variable regions (HCDRs), refer to HCDR1, HCDR2 and HCDR3. The numbers and locations of CDR amino acid residues in the LCVRs and HCVRs of the antibody or antigen-binding fragment of the present invention correspond with known Kabat numbering scheme (LCDR1-3, HCDE2-3), or correspond with kabat and chothia numbering schemes (HCDR1). The four FRs in the natural heavy-chain and light-chain variable regions are roughly in a β-folded configuration linked by three CDRs that form a linking ring, and in some cases, the four FRs may form a partially β-folded structure. The CDRs in each chain are closely brought together by the FRs, and form, together with the CDRs from another chain, an antigen-binding site of the antibody. It is possible to determine which amino acids make up the FRs or CDRs by comparing the amino acid sequences of antibodies of the same type. The constant regions are not directly involved in the binding between an antibody and an antigen, but they exhibit different effector functions, for example, participating in the antibody-dependent cytotoxicity of the antibody.

    [0119] As used herein, the term “antigen-binding fragment” refers to a Fab fragment, a Fab′ fragment, a F(ab′)2 fragment, or a single Fv fragment, having an antigen-binding activity. The Fv antibody contains a heavy chain variable region and a light chain variable region, but does not have a constant region, and has a minimum antibody fragment with all antigen binding sites. Generally, the Fv antibody further contains a polypeptide linker between the VH and VL domains, and can form a structure required for antigen binding.

    [0120] As used herein, the term “antigenic determinant” refers to three-dimensional spatial sites distributed discontinuously on an antigen and identified by the antibody or antigen-binding fragment of the present application.

    [0121] The present application includes not only intact antibodies, but also fragments of immunocompetent antibodies or fusion proteins formed by antibodies with other sequences. Therefore, the present application further comprises fragments, derivatives, and analogues of the antibody.

    [0122] In the present application, the antibody comprises murine, chimeric, humanized or fully human antibodies prepared with techniques familiar to those skilled in the art. Recombinant antibodies, for example, chimeric and humanized monoclonal antibodies (including human and non-human moieties), can be prepared using the recombinant DNA techniques well known in the art.

    [0123] As used herein, the term “monoclonal antibody” refers to an antibody secreted by a clone derived from a single cell source. The monoclonal antibody is highly specific for a single epitope. The cells may be eukaryotic, prokaryotic, or phage clonal cell lines.

    [0124] As used herein, the term “chimeric antibody” is an antibody molecule expressed by splicing the V region gene of a murine antibody and the C region gene of a human antibody into a chimeric gene, and then inserting the chimeric gene into a vector to transfect a host cell. It not only retains the high specificity and affinity of parental mouse antibody, but also enables its human-derived Fc segment to effectively mediate the biological effector functions.

    [0125] As used herein, the term “humanized antibody” is a variable region modification form of the murine antibody of the present application. It has CDRs derived from (or substantially derived from) a non-human antibody (e.g., which may be a mouse monoclonal antibody), and FRs and constant regions substantially derived from the human antibody sequence. That is, the CDR sequences of the murine antibody are grafted onto different types of human germline antibody framework sequences. Since the CDR sequences are responsible for most of the antibody-antigen interactions, recombinant antibodies that mimic the properties of specific naturally-occurring antibodies can be expressed by constructing expression vectors.

    [0126] In the present application, the antibody may be monospecific, bispecific, trispecific, or more multispecific.

    [0127] In the present application, the antibody of the present application further comprises conserved variants thereof, which refer to polypeptides formed by substituting up to 10, possibly up to 8, possibly up to 5, and possibly up to 3 amino acids with amino acids having similar or resembling properties, as compared with the amino acid sequence of the antibody of the present application. These conserved variant peptides are best produced by amino acid substitution according to Table A.

    TABLE-US-00001 TABLE A Initial Representative Substituted with, residue substituent for example Ala (A) Vai; Leu; He Vai Arg (R) Lys; Gin; Asn Lys Asn (N) Gin; His; Lys; Arg Gin Asp (D) Glu Glu Cys (C) Ser Ser Gin (Q) Asn Asn Glu (E) Asp Asp Gly (G) Pro; Ala Ala His (H) Asn; Gin; Lys; Arg Arg He (I) Leu; Vai; Met; Ala; Phe Leu Leu (L) He; Vai; Met; Ala; Phe Ile Lys (K) Arg; Gin; Asn Arg Met (M) Leu; Phe; He Leu Phe (F) Leu; Vai; lie; Ala; Tyr Leu Pro (P) Ala Ala Ser (S) Thr Thr Thr (T) Ser Ser Trp (W) Tyr; Phe Tyr Tyr (Y) Trp; Phe; Thr; Ser Phe Vai (V) He; Leu; Met; Phe; Ala Leu

    Anti-IL-36R Antibody

    [0128] As used herein, the term “IL-36R” generally refers to natural or recombinant human IL-36R, as well as non-human homologues of human IL-36R. Unless otherwise indicated, the molar concentration of IL-36R is calculated using the molecular weight of the homodimer of IL-36R.

    [0129] The present application provides a high-specificity and high-affinity antibody targeting IL-36R. The antibody comprises a heavy chain and a light chain; the heavy chain comprises a heavy-chain variable region (VH) amino acid sequence, and the light chain comprising a light-chain variable region (VL) amino acid sequence.

    [0130] For example, the CDR of the heavy-chain variable region (VH) is selected from the group consisting of: [0131] CDR1 as set forth in SEQ ID NO: 3, [0132] CDR2 as set forth in SEQ ID NO: 4, and [0133] CDR3 as set forth in SEQ ID NO: 5; and/or [0134] the CDR of the light-chain variable region (VL) is selected from the group consisting of: [0135] CDR1′ as set forth in SEQ ID NO: 6, [0136] CDR2′ as set forth in SEQ ID NO: 7, and [0137] CDR3′ as set forth in SEQ ID NO: 8.

    [0138] Here, any of the above amino acid sequences further comprises a derivative sequence which has been added, deleted, modified and/or substituted with at least one (such as 1-5, 1-3, possibly 1-2, or possibly 1) amino acid and has IL-36R binding affinity.

    [0139] In some embodiments, the sequence homology achieved by the addition, deletion, modification, and/or substitution of at least one amino acid sequence may be at least 80%, may be at least 85%, may be at least 90%, or may be at least 95% of the amino acid sequence.

    [0140] The antibody of the present application may be a double-chain or single-chain antibody, and may be selected from animal-derived antibodies, chimeric antibodies, and humanized antibodies. It may be a humanized antibody or a human-animal chimeric antibody, or may be a fully humanized antibody.

    [0141] The antibody derivatives described in the present application may be single-chain antibodies, and/or antibody fragments (such as: Fab, Fab′, (Fab′).sub.2 or other antibody derivatives known in the art), and IgA, IgD, IgE, IgG and IgM antibodies or any one or more of other subtypes of antibodies.

    [0142] Here, the animal may be a mammal, such as a mouse.

    [0143] The antibody of the present application may be a murine antibody, chimeric antibody, humanized antibody, or CDR-grafted and/or -modified antibody targeting human IL-36R.

    [0144] In some cases, any one or more sequences of the above SEQ ID NO: 3, 4 and 5, or their sequences that have been added, deleted, modified and/or substituted with at least one amino acid and have IL-36R binding affinity, are located in the CDR of the heavy-chain variable region (VH).

    [0145] In some cases, any one or more sequences of the above SEQ ID NO: 6, 7 and 8, or their sequences that have been added, deleted, modified and/or substituted with at least one amino acid and have IL-36R binding affinity, are located in the CDR of the light-chain variable region (VL).

    [0146] In some cases, VH CDR1, CDR2, and CDR3 are each independently selected from any one or more sequences of SEQ ID NO: 3, 4, and 5, or their sequences that have been added, deleted, modified and/or substituted with at least one amino acid and have IL-36R binding affinity; and VL CDR1, CDR2, and CDR3 are each independently selected from any one or more sequences of SEQ ID NO: 6, 7, and 8, or their sequences that have been added, deleted, modified and/or substituted with at least one amino acid and have IL-36R binding affinity.

    [0147] In the above description of the present application, the number of the amino acids added, deleted, modified and/or substituted, for example, may not exceed 40%, may not exceed 35%, may be 1-33%, may be 5-30%, may be 10-25%, or may be 15-20%, of the total number of amino acids in an initial amino acid sequence.

    [0148] In the present application, the number of the amino acids added, deleted, modified and/or substituted is usually 1, 2, 3, 4 or 5, which may be 1-3, may be 1-2, or may be 1.

    Preparation of Antibodies

    [0149] Any method suitable for producing a monoclonal antibody can be used to produce the IL-36R antibody of the present application. For example, animals can be immunized with linked or naturally occurring IL-36R homodimers or fragments thereof. Suitable immunization methods may be used, including adjuvants, immunostimulants, and repeated booster immunizations, and one or more routes may be used.

    [0150] Any suitable form of IL-36R may be used as an immunogen (antigen) to produce a non-human antibody specific to IL-36R and to screen the biological activities of the antibody. An eliciting immunogen may be a full-length mature human IL-36R, comprising natural homodimers, or peptides containing single/multiple epitopes. The immunogen may be used alone, or in combination with one or more immunogenicity enhancers known in the art. The immunogen may be purified from a natural source, or produced in a genetically modified cell. An DNA encoding the immunogen may be genomic or non-genomic (for example, cDNA) in origin. A suitable genetic vector may be used to express the DNA encoding the immunogen, and the vector comprises, but is not limited to, an adenovirus vector, an adeno-associated virus vector, a baculovirus vector, a material, and a non-viral vector.

    [0151] An exemplary method for producing the anti-human IL-36R antibody of the present application is described in Example 1.

    [0152] A humanized antibody may be selected from any class of immunoglobulin, including IgM, IgD, IgG, IgA, and IgE. In the present application, the antibody is an IgG antibody, and an IgG1 subtype is used. With the biological assays described in the examples below, it is easy to optimize an essential constant domain sequence by screening antibodies, so as to produce the desired bioactivity.

    [0153] Similarly, any type of light chain can be used in the compounds and methods herein. Specifically, κ and λ chains or their variants may be used in the compounds and methods of the present application.

    [0154] An exemplary method for humanizing the anti-human IL-36R antibody of the present application is described in Example 2.

    [0155] The sequence of the DNA molecule of the antibody or the fragment thereof in the present application can be obtained by conventional techniques, such as methods using PCR amplification or genomic library screening and the like. In addition, the coding sequences of the light and heavy chains may also be fused together to form a single-chain antibody.

    [0156] Once relevant sequences are obtained, they may be obtained on a large scale by recombination. This is usually achieved by cloning them into vectors, then transferring them into cells, and then isolating the relevant sequences from the proliferated host cell by means of a conventional method.

    [0157] In addition, the relevant sequences may also be synthesized by using an artificial synthesis method, in particular when a fragment is short. A fragment with a very long sequence may be usually obtained by first synthesizing multiple small fragments, and then linking these small fragments. Then, this DNA sequence may be introduced into various existing DNA molecules (or such as vectors) and cells known in the art.

    [0158] The present application further relates to vectors comprising the aforementioned appropriate DNA sequences and appropriate promoters or control sequences. These vectors may be used to transform appropriate host cells to enable them to express proteins.

    [0159] The host cells may be prokaryotic cells, such as bacterial cells; or lower eukaryotic cells, such as yeast cells; or higher eukaryotic cells, such as mammalian cells. The animal cells may comprise (but are not limited to): CHO-S, CHO-K1, and HEK-293 cells.

    [0160] The step of transforming the host cells with recombinant DNAs in the present application may be performed using techniques well known in the art. A resulting transformant may be cultured by a conventional method, and it expresses the polypeptide encoded by the gene of the present application. According to the host cells used, they are cultured in a conventional medium under suitable conditions.

    [0161] Usually, the host cells are cultured and transformed under conditions suitable for the expression of the antibody of the present application. Then, the antibody of the present application is purified and obtained using conventional immunoglobulin purification steps, such as protein A-Sepharose, hydroxyapatite chromatography, gel electrophoresis, dialysis, ion exchange chromatography, hydrophobic chromatography, molecular sieve chromatography, or affinity chromatography, and other conventional separation and purification means well known to those skilled in the art.

    [0162] The resulting monoclonal antibody may be identified by a conventional means. For instance, the binding specificity of the monoclonal antibody may be determined by immunoprecipitation or in vitro binding assays, such as radioimmunoassay (RIA) or enzyme-linked immunosorbent assay (ELISA).

    Antibody-Drug Conjugate (ADC)

    [0163] The present application further provides an antibody-drug conjugate (ADC) based on the antibody of the present application.

    [0164] Typically, the antibody-drug conjugate comprises the antibody, and an effector molecule. The antibody is conjugated or may be chemically conjugated to the effector molecule. Here, the effector molecule may be a drug having a therapeutic activity. Furthermore, the effector molecule may be one or more of a toxic protein, a chemotherapy drug, a small molecule drug, or a radionuclide.

    [0165] The antibody of the present application and the effector molecule may be conjugated with each other by a conjugating agent. Examples of the conjugating agent may be any one or more of a non-selective conjugating agent, a conjugating agent using a carboxyl group, a peptide chain, a conjugating agent using a disulfide bond. The non-selective conjugating agent refers to a compound such as glutaraldehyde, which allows the effector molecule and the antibody to be linked via a covalent bond. The conjugating agent using the carboxyl group may be any or more of a cis-aconitic anhydride-based conjugating agent (e.g., cis-aconitic anhydride), an acylhydrazone-based conjugating agent (with acylhydrazone as a conjugating site).

    [0166] Some residues (such as Cys or Lys) on the antibody are used to link a variety of functional groups, involving an imaging reagent (e.g., a chromophore and a fluorophore), a diagnostic reagent (e.g., an MRI contrast agent and a radioisotope), a stabilizer (e.g., a glycol polymer), and a therapeutic agent. The antibody may be conjugated to a functional agent to form an antibody-functional agent conjugate. The functional agent (e.g., a drug, a detection reagent, or a stabilizer) is conjugated (covalently linked) to the antibody. The functional agent may be attached to the antibody directly or indirectly via a linker.

    [0167] The antibody may conjugate a drug to form an antibody-drug conjugate (ADC). Typically, the ADC comprises a linker between the drug and the antibody. The linker may be degradable or non-degradable. The degradable linker typically degrades easily in an intracellular environment, for example, at a site of interest, to release the drug from the antibody. Suitable degradable linkers include, for example, enzymatically degradable linkers, including peptidyl-containing linkers degradable by intracellular proteases (e.g., lysosomal proteases or endosomal proteases); or saccharide linkers, for example, glucuronide-containing linkers degradable by glucuronidases. The peptidyl-containing linkers may include, for example, dipeptides, such as valine-citrulline, phenylalanine-lysine, or valine-alanine. Other suitable degradable linkers include, for example, pH-sensitive linkers (e.g., linkers hydrolyzed at pH less than 5.5, for example, hydrazone linkers) and linkers (e.g., disulfide bond linkers) degrading under reducing conditions. Nondegradable linkers typically release drugs under conditions where antibodies are hydrolyzed by proteases.

    [0168] Before linking the antibody, the linker has an active reactive group capable of reacting with some amino acid residues, and the linkage is achieved by the active reactive group. Sulfhydryl-specific active reactive groups may include: for example, maleimide-based compounds, halogenated amides (e.g., iodo-, bromo- or chlorinated amides); halogenated esters (e.g. iodo-, bromo- or chlorinated esters); halogenated methylketones (e.g. iodo-, bromo- or chlorinated methylketones), benzyl halides (e.g. iodides, bromides or chlorides); vinyl sulfone, pyridyl disulfide; mercury derivatives, for example, 3,6-bis-(mercury methyl)dioxane, with acetates, chloride ions or nitrates as p-ions; and polymethylene dimethyl sulfide thiosulfonates. The linkers may include, for example, maleimide attached to the antibody by thiosuccinimide.

    [0169] The drug may be any cytotoxic, cell-growth inhibitory, or immunosuppressive drug. In an embodiment, the linker links the antibody and the drug, and the drug has a functional group that can be bonded with the linker. For example, the drug may have an amino, carboxyl, sulfhydryl, hydroxyl, or ketone group that can be bonded to the linker. In the case where the drug is directly linked to the linker, the drug has a reactive active group before linking the antibody.

    [0170] Useful drug categories include, for example, antitubulin drugs, DNA minor groove binding reagents, DNA replication inhibitors, alkylation reagents, antibiotics, folate antagonists, antimetabolites, chemosensitizers, topoisomerase inhibitors, vinca alkaloids, etc. In the present application, a drug-linker may be used to form an ADC in a simple step. In other embodiments, a bifunctional linker compound may be used to form an ADC in a two-step or multi-step method. For example, a cysteine residue reacts with the reactive portion of the linker in a first step, and in subsequent steps, the functional group on the linker reacts with the drug, thereby forming an ADC.

    [0171] Usually, the functional group on the linker is selected to facilitate specific reaction with an appropriate reactive group on the drug moiety. As a non-limiting example, an azide-based moiety may be used to react specifically with a reactive alkyne group on the drug moiety. The drug is covalently bonded to the linker by addition of a 1,3-dipole ring between azide and alkyne. Other useful functional groups include, for example, ketones and aldehydes (suitable for reacting with hydrazides and alkoxyamines), and phosphines (suitable for reacting with azides); isocyanates and isothiocyanates (suitable for reacting with amines and alcohols); and activated esters, for example N-hydroxysuccinimidyl esters (suitable for reacting with amines and alcohols). These and other linkage strategies (for example, those described in Bioconjugation Techniques, Second Edition (Elsevier)) are well known to those skilled in the art. Those skilled in the art can understand that, for the selective reaction between the drug moiety and the linker, when a complementary pair of reactive functional groups is selected, each member in the complementary pair may be used both for the linker and for the drug.

    [0172] The present application further provides a preparation method for an ADC, further comprising: binding an antibody with a drug-linker compound under conditions sufficient to form an antibody conjugate (ADC).

    [0173] In some embodiments, the method of the present application comprises: binding the antibody to a bifunctional linker compound under conditions sufficient to form an antibody-linker conjugate. In these embodiments, the method of the present application further comprises: binding the antibody-linker conjugate to the drug moiety under conditions sufficient to covalently link the drug moiety to the antibody via the linker.

    [0174] In some embodiments, the antibody-drug conjugate (ADC) is as shown in the following molecular formula:


    Abprivate use character ParenopenstLU-DP).sub.p

    wherein: [0175] AB indicates an antibody, [0176] LU indicates a linker; [0177] D indicates a drug; [0178] and the subscript p is a value selected from 1 to 8.

    Application

    [0179] The present application provides a use of the antibody of the present application, for example, for the preparation of diagnostic preparations, or the preparation of drugs for the prevention and/or treatment of IL-36-related diseases. The IL-36 related diseases comprise inflammatory diseases, autoimmune diseases, etc., including but not limited to psoriasis, psoriatic arthritis, ankylosing spondylitis, multiple sclerosis, inflammatory bowel disease (such as Crohn's disease and ulcerative colitis), osteoarthritis, rheumatoid arthritis (RA), rheumatic arthritis or osteoporosis, inflammatory fibrosis (e.g., scleroderma, and pulmonary fibrosis and sclerosis), asthma (including allergic asthma), allergic reactions, and cancers.

    Pharmaceutical Composition

    [0180] The present application further provides a composition. In some cases, the composition is a pharmaceutical composition, which comprises the antigen-binding protein described above, or an active fragment thereof, or a fusion protein thereof, or an ADC thereof, or corresponding CAR-T cells, and a pharmaceutically acceptable carrier. Usually, these substances may be formulated in a non-toxic, inert, and pharmaceutically acceptable aqueous carrier medium, of which the pH is usually about 5-8, for example, or may be about 6-8, although the pH value may vary with the properties of the formulated substances and the disorders to be treated. The formulated pharmaceutical composition may be administered by conventional routes, comprising (but not limited to): intratumoral, intraperitoneal, intravenous, or topical administration.

    [0181] The antibody of the present application may also be expressed in a cell by means of a nucleotide sequence for cell therapy. For example, the antibody is used for the chimeric antigen receptor T cell immunotherapy (CAR-T), etc.

    [0182] The pharmaceutical composition of the present application may be directly used to bind an IL-36R protein molecule, and thus may be used to prevent and treat IL-36R-related diseases. In addition, other therapeutic agents may also be used at the same time.

    [0183] The pharmaceutical composition of the present application comprises the aforementioned monoclonal antibody (or a conjugate thereof) of the present application at a safe and effective amount (such as 0.001-99 wt %, possibly 0.01-90 wt %, or possibly 0.1-80 wt %) and pharmaceutically acceptable carriers or excipients. Such carriers comprise (but are not limited to): saline water, buffer, glucose, water, glycerol, ethanol, and combinations thereof. A pharmaceutical preparation should match the mode of administration. The pharmaceutical composition of the present application may be prepared into an injection form, for example, by means of a conventional method using normal saline or an aqueous solution containing glucose and other adjuvants. The pharmaceutical composition such as an injection and a solution should be manufactured under an aseptic condition. The dosage of an active ingredient is a therapeutically effective amount, for example, about 1 mg/kg body weight to about 5 mg/kg body weight per day. Furthermore, the polypeptide of the present application may also be used together with other therapeutic agents.

    [0184] When in use, the pharmaceutical composition is administered to mammals at a safe and effective amount, which is usually at least about 10 μg/kg body weight and in most cases, does not exceed about 50 mg/kg body weight. Its dosage may be about 10 μg/kg body weight to about 20 mg/kg body weight. Without doubt, the specific dosage should also consider factors such as the route of administration and the health condition of a patient, which are within the scope of skills of a proficient physician.

    Detection Uses and Kit

    [0185] The antibody of the present application can be used in detection applications (for example, for sample detection), so as to provide diagnostic information.

    [0186] In the present application, the samples (specimens) used comprise cells, tissue samples, and biopsy samples. The term “biopsy” used in the present application shall comprise all types of biopsy known to those skilled in the art. Therefore, the biopsy used in the present application may comprise, for example, tissue samples prepared by an endoscopic method or by organ puncture or needle biopsy.

    [0187] The samples used in the present application comprise fixed or preserved cell or tissue samples.

    [0188] The present application further provides a kit comprising the antibody (or a fragment thereof) of the present application. For example, the kit may further comprise a container, an instruction manual, a buffer, etc. For example, the antibody of the present application may be fixed on a detection plate.

    [0189] The antibody or fragment thereof involved in the present application may have the following excellent technical effects: [0190] (a) the antibody of the present application has excellent bioactivity and specificity. [0191] (b) Compared with a murine antibody and a chimeric antibody, the humanized antibody of the present application has lower immunogenicity while retaining a comparable affinity with IL-36R. [0192] (c) The blocking of IL-36R by the antibody of the present application can significantly inhibit the inflammatory factor expression pathway in a patient. [0193] (d) The antibody of the present application has a comparable affinity with some non-human mammals (such as monkeys) as with human IL-36R, which facilitates testing and quality control detection in animal models. [0194] (e) The antibody of the present application binds to IL-36R to block the activation signaling pathway for binding IL-36α, IL-36β, or IL-36γ to IL-36R, thereby reducing inflammatory cytokines (such as IL-6, IL-8, or GM-CSF).

    [0195] The present application is further set forth below in conjunction with specific examples. It should be understood that these embodiments are intended only to illustrating the present application, instead of limiting the scope of the present application. Experimental methods without specific conditions indicated in the following examples usually follow conventional conditions, for example the conditions described in Sambrook et al., Molecular Cloning: A Laboratory Manual (New York: Cold Spring Harbor Laboratory Press, 1989), or according to conditions recommended by the manufacturers. Unless otherwise specified, percentages and parts are weight percentages and parts by weight.

    EXAMPLES

    Example 1

    [0196] The preparation method for murine monoclonal antibodies was based on the hybridoma preparation technology invented by Kohler and Milstein in 1975 (Nature, 1975, 256: 495-497). First, the Fc-tagged protein (ACRO, #IL2-H5254) of human IL-36R was emulsified with the Freund's adjuvant, and then used to immunize multiple strains of mice. After four rounds of immunizations, the serum was collected to detect the titer by ELISA, and spleen cells were harvested from the selected optimal mice for fusion with SP2/0 myeloma cells. After HAT screening of hybridoma polyclonal cells, a polyclonal culture supernatant was tested in the binding activities of human IL-36R, monkey IL-36R and human IL1R1, and the functional inhibition effects of polyclonal antibodies on IL-36 stimulating factors was detected. The best polyclones were picked for monoclonalization, the resulting monoclones were also screened in binding activity and functional activity, and the affinity was detected by the Biacore method to finally select the best hybridoma monoclonal cell strains for sequence analysis.

    TABLE-US-00002 TABLE 1 Partial data of hybridoma screening IL-6 ratio in IL-8 ratio in IL-8 ratio in MFI ratio in MFI ratio in MFI ratio in blockage of blockage of blockage of IL-8 ratio in binding binding binding human human human blockage of activity to activity to activity to IL36β IL36α IL36β human IL36 human IL- monkey IL- human functional functional functional γ functional 36R 36R IL1R1 activity activity activity activity Binding (hybridoma (hybridoma (hybridoma (hybridoma (hybridoma (hybridoma (hybridoma activity supernatant/ supernatant/ supernatant/ supernatant/ supernatant/ supernatant/ supernatant/ OD450 positive positive negative positive positive positive positive Clone name value control) control) control) control) control) control) control) 6(1)-B8 1.293 75.66% 94.41% 120.18% 10.50% 4.78% 5.08% 5.77% 6(2)-G8 1.74 94.54% 81.50% 114.91% 13.18% 5.61% 6.45% 5.58% 21(1)-E4 0.943 67.89% 90.03% 122.81% 5.70% −3.19% −1.97% −2.50% 21(2)-F3 1.681 80.91% 91.36% 114.91% 1.18% −2.61% −1.88% −2.31% 65(1)-B5 1.355 56.84% 85.44% 111.40% 23.05% 15.66% 18.02% 12.87% 65(2)-F11 1.319 71.60% 88.52% 116.67% 21.66% 15.90% 17.72% 13.17% 74(1)-E2 1.917 109.76% 85.93% 114.04% 1.00% −3.11% −3.15% −2.89% 74(2)-G5 1.827 103.89% 97.44% 114.91% 2.84% −2.86% −2.66% −2.60% 79(1)-C7 2.133 112.13% 100.76% 110.53% 13.08% 3.12% 3.51% 3.34% 79(2)-G7 1.085 75.48% 102.59% 121.93% 8.75% 4.70% 1.46% 3.24% 84(1)-C11 2.277 84.52% 86.85% 115.79% 0.90% −3.27% −3.35% −2.99% 84(2)-C3 2.324 64.61% 104.35% 114.91% 0.81% −4.02% −3.05% −3.47% 111(1)-E5 2.161 81.64% 105.10% 118.42% 0.07% −4.02% −4.62% −3.86% 111(2)-B3 2.36 102.30% 103.62% 116.67% 0.07% −4.68% −4.62% −4.06% 130(1)-H7 1.316 113.29% 110.61% 119.30% 30.89% 44.55% 26.64% 25.52% 130(2)-A2 1.507 83.19% 130.12% 123.68% 31.35% 43.22% 27.13% 22.31% 140(1)-C1 1.768 84.57% 102.87% 117.54% 1.92% −4.35% −3.74% −3.09% 172(1)-H4 1.442 95.40% 96.88% 114.91% 44.92% 58.91% 46.82% 68.93% 172(2)-C4 1.814 82.50% 89.66% 116.67% 45.10% 55.75% 46.73% 67.56% 179(1)-G7 1.667 74.17% 113.09% 114.04% 30.06% 27.19% 24.48% 18.32% 180(1)-H5 2.082 81.42% 79.75% 116.67% 9.48% 0.21% 1.46% −1.63% 180(2)-D3 2.477 65.03% 86.87% 114.91% 13.54% 3.54% 4.89% 1.78% 181(2)-F10 2.959 49.74% 109.08% 126.32% 20.65% 15.07% 12.53% 10.15% 182(1)-C8 1.843 93.33% 86.26% 120.18% 50.27% 74.76% 57.11% 55.89% 183(1)-H7 2.016 84.65% 84.83% 115.79% 30.89% 26.86% 23.99% 22.31% 183(2)-F12 1.857 59.34% 84.47% 127.19% 24.71% 18.23% 18.90% 14.53% 184(1)-F8 2.27 96.60% 86.57% 118.42% 0.26% −3.60% −5.11% −4.06% 184(2)-B9 2.408 98.36% 89.91% 120.18% −1.80% −4.45% −7.19% −3.44%

    [0197] As shown in Table 1, after extensive hybridoma screening, the antibody expression supernatants of hybridomas 6(1)-B8 and 111(1)-E5 showed very high binding activity to human IL-36R and monkey IL-36R proteins at a cell binding level, but no specific binding to human IL1R1 proteins, and showed an obvious functional blocking effect on cytokines produced by the stimulation of IL-36 stimulating factors (IL-36α, IL-36β, and IL-36γ).

    Example 2 Cloning and Humanization of Variable Region Gene Sequences of Anti-IL-36R Antibodies

    2.1 Cloning of Antibody Variable Region Genes in Hybridoma Cells

    [0198] Based on the principle of TAKARA's 5′ RACE technology, the cDNA sequences of the variable regions of the mouse antibody expressed by the hybridoma cell strains were cloned. Briefly, the variable region gene-specific cDNAs of the heavy and light chains were synthesized by using the SMARTer 5′RACE synthesis kit (TAKARA, Cat. #:634859) following the instructions. The 5′- and 3′-terminals of the cDNA sequences were modified with PCR primers, which were designed to add appropriate leader sequences to the variable region cDNAs of the heavy and light chains, respectively, such that the resulting PCR products could be cloned, by a seamless cloning method, onto a heavy-chain vector pHB-Fc and a light-chain vector pHB-Cx which are expressed in the existing recombinant antibody. The expression vector pHB-Fc contained the human IgG1 heavy-chain constant region gene sequence, with L234A and L235A (Eu numbering) mutations having weakened antibody ADCC effects on CH2; and the vector pHB-Cκ contained the human κ light-chain constant region gene sequence. The PCR amplification products of the heavy- and light-chain variable regions were cloned into the expression vectors by means of an In-fusion cloning reagent (TAKARA, Cat. #: 639650) to obtain human-mouse chimeric antibody expression vectors, which were then transformed into E. coli DH5a competent cells (Yeastern Biotech, Cat. #: FYE607-80VL). Monoclonal colonies were picked for Sanger sequencing, and antibody variable region sequences were obtained by analysis.

    [0199] As a result, anti-IL-36R chimeric antibodies (HUABO No.: 900497) was obtained, with the light chain derived from the hybridoma 6(1)-B8 in Example 1, and the heavy chain derived from the hybridoma 111(1)-E5 in Example 1. The sequences of its variable regions were as follows:

    TABLE-US-00003 900497 HCVR SEQ ID NO: 1 QVQLQQTGSVLVRPGTSVKLSCKASGYTFTSSWMHWAKQRPGQGLEWIGE IHPNSAKTNYNEKFKGKATLTVDTFSSTAYVDLSSLASEDSAVYYCARVD YGKPWFAYWGQGTLVTVSA 900497 LCVR SEQ ID NO: 2 QIVLTQSPTIMSASPGERVTMTCSASSSVSSSYLHWYQQKPGSSPKLWIY STSNLASGVPARFSGSGSGTSYSLTINSMEAEDAATYYCQQFQSSPLTFG AGTKLGLK

    [0200] Here, the underlined sections were CDRs (as defined by IMGT, the single sequences were as follows):

    TABLE-US-00004 TABLE 2 CDR sequences of murine anti-IL-36R antibody Domain Sequence SEQ ID NO: VH CDR1 GYTFTSSW 3 CDR2 IHPNSAKT 4 CDR3 ARVDYGKPWFAY 5 VL CDR1 SSVSSSY 6 CDR2 STS 7 CDR3 QQFQSSPLT 8

    2.2 Expression of Chimeric Antibodies

    [0201] The expression vectors obtained in 2.1 were amplified by means of Escherichia coli, and a sufficient amount of plasmids were prepared using an endotoxin-free plasmid extraction kit (Tiangen Biotech (Beijing) Co., Ltd., Cat. #: DP117) for transient transfection to express the chimeric antibody. CHO-S cells (ThermoFisher, Cat. #: R80007) were used as host cells for expression. The two prepared heavy-chain vectors, respectively with the light-chain vectors, were mixed with polyetherimide (PEI, Polysciences, Cat. #: 24765-1) to form liposome complexes for transfecting the CHO-S cells, which were then cultured for 5-7 days in a carbon dioxide shaker. The cell culture supernatant was collected through centrifugation, and purified by a Protein A affinity chromatographic column to obtain a human-mouse chimeric antibody.

    2.3 Humanization of Murine Anti-Human IL-36R Antibody: Preparation Method for Humanized Antibodies

    [0202] The antibodies were humanized by aligning the variable region sequence of the chimeric antibody (HUABO Number: 900497) with available sequences in the NCBI IgBlast database, and carrying out identification and analysis to finally determine a human framework region (FR) suitable for constructing CDR-grafted heavy and light chains thereon.

    [0203] During transformation, transformation sites were designed according to the conserved amino acid residues in the FR of the human antibody and the important amino acid residues in the FR of the antibody; the variable regions of the heavy and light chains of the chimeric antibodies were respectively designed for humanized mutations; and humanized point-mutation antibody expression plasmids were amplified and constructed using PCR. The humanized point-mutation antibody expression plasmids were expressed in the CHO-S cells and then purified respectively to obtain humanized antibody proteins. With Biacore and methods for detecting cell bioactivity and the like, the affinity of humanized antibodies, activated cytokine release and other indicators were screened to obtain three humanized anti-IL-36R antibodies with excellent performance. The resulting humanized anti-IL-36R antibodies were numbered as 900513, 900527, and 900534, and their VH and VL sequences were shown as follows:

    TABLE-US-00005 900513, 900527 and 900534 HCVR SEQ ID NO: 9 QVQLVQSGAEVKKPGASVKVSCKASGYTFTSSWMHWAKQAPGQGLEWIGE IHPNSAKTNYNQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARVD YGKPWFAYWGQGTLVTVSS 900513 LCVR SEQ ID NO: 10 EIVLTQSPGTLSLSPGERATLSCSASSSVSSSYLHWYQQKPGQAPRLWIY STSNRATGIPDRFSGSGSGTDFTLTISRLEPEDFATYYCQQFQSSPLTFG QGTKLEIK 900527 LCVR SEQ ID NO: 11 QIVLTQSPGTLSLSPGERATLSCRASSSVSSSYLHWYQQKPGQAPRLWIY STSSRATGIPDRFSGSGSGTDFTLTISRLEPEDFATYYCQQFQSSPLTFG QGTKLEIK 900534 LCVR SEQ ID NO: 12 QIVLTQSPGTLSLSPGERATLSCRASSSVSSSYLHWYQQKPGQAPRLLIY STSSRATGIPDRFSGSGSGTDFTLTISRLEPEDFATYYCQQFQSSPLTFG QGTKLEIK

    [0204] Here, the underlined sections were CDRs (defined according to IMGT), and 900513, 900527, and 900534 were the numbers for the three humanized antibody proteins respectively. The CDRs of humanized antibodies 900513, 900527 and 900534 were the same as those of the chimeric antibody 900497, and the FRs of humanized antibodies were mutated on the basis of chimeric 900497.

    Example 3 Detection of Bioactivity of Anti-Human IL-36R Humanized Antibodies

    3.1 Biacore (SPR) for Detecting Antibody Affinity

    [0205] Test materials and instruments were as follows: [0206] His-tagged human IL-1 Rrp2/IL-1 R6 protein (Human IL-1 Rrp2/IL-1 R6 Protein, His Tag), ACRO Biosystems, IL2-H52H6 [0207] HBS-EP+ (10×), GE, BR-1006-69 [0208] Series S Sensor Chip CM5, GE, 29-1275-56 [0209] His Capture Kit, GE, 28995056 [0210] BIACORE, GE, Biacore 8K [0211] Glycine solution at pH 1.5, GE, BR100354

    [0212] The test method was as follows.

    [0213] Series S Sensor Chip CM5 was equilibrated for 20-30 min at room temperature, and then fitted in the instrument. Following the instruction manual for His Capture Kit, an anti-His antibody was immobilized onto the Series S Sensor Chip CM5. An HBS-EP+(10×) solution was diluted 10-fold in ultrapure water as the running buffer. An antigen (His-tagged human IL-1 Rrp2/IL-1 R6 protein) was diluted to 1 μg/ml and 10 μL/min using the running buffer, and loaded during 15 sec to capture around 50 RU of antigen. An antibody sample were diluted to 30 nM, 15 nM, 7.5 nM, 3.75 nM, 1.875 nM, 0.9375 nM, and 0.46875 nM using an equilibration buffer; the running buffer was taken as zero concentration; at 30 μL/min, binding and dissociation were allowed to occur for 120 s and 900 s, respectively; and the chip was regenerated with the glycine solution at pH 1.5. The sample was analyzed by a capture-based single-cycle kinetics program; the corresponding analysis program was selected to analyze the data, and it was confirmed that there was no obvious reference binding; and the Kinetics 1:1 binding model was selected for fitting analysis to acquire the kinetic parameters of the sample.

    TABLE-US-00006 TABLE 3 Affinity assay of candidate anti- human IL-36R humanized antibodies Protein number ka (l/Ms) kd (l/s) KD (M) 900513 9.04E+05 1.34E−05 1.48E−11 900527 9.67E+05 4.37E−05 4.52E−11 900534 8.81E+05 5.10E−05 5.79E−11 900497 6.60E+05 1.68E−05 2.54E−11 900389 7.39E+05 1.17E−05 1.58E−11

    [0214] Note: 900389, as an anti-human IL-36R antibody developed by BI, was obtained through independent expression by HUABO who synthesized a variable region gene from sequences recorded according to the patent WO2013/074569A1. Specifically, the heavy-chain variable region of 900389 was 81B4vH33_90vH as set forth in SEQ ID NO: 89 in WO2013/074569A1, the light-chain variable region of 900389 was 81B4vK32_105vK as set forth in SEQ ID NO: 77 in WO2013/074569A1, and both 81B4vH33_90vH and 81B4vK32_105vK were obtained by carrying out humanization on the basis of a murine antibody 81B4; and the constant region of 900389 was the same as those of the candidate antibodies of the present application.

    [0215] The affinity constant (KD(M)) for the binding of each humanized antibody to human IL-1 Rrp2 was shown in Table 3. The results showed that the affinity of the humanized monoclonal antibodies of the present application were close to the order of magnitude of 10.sup.−11, showing a very strong affinity. 3.2 Detection of functional inhibition effect of anti-human IL-36R antibody on huIL-36 stimulating factor

    [0216] A human ovarian cancer cell line NCI/ADR-RES was added to a 96-well cell culture plate at 100 μL per well (4.5×10.sup.4 cells per well), and incubated overnight at 37° C. with 5% CO.sub.2; a series of samples to be detected was diluted and added at 50 μL/well; the plate was incubated for 15 min at 37° C. with 5% CO.sub.2; ligands huIL-36α (1 μg/mL), huIL-36β (80 μg/mL), and huIL-36γ (120 μg/mL) were added at 50 μL/well, respectively, and mixed well; and the plate was incubated for 18-24 h at 37° C. with 5% CO.sub.2. Cell culture supernatants were obtained through centrifuging and detected with the Biolegend ELISA kit as follows: huIL-6 (diluted at 1:100, Cat. #: 430503), huIL-8 (diluted at 1:5, Cat. #: 431503), and huGM-CSF (diluted at 1:2, Cat. #: 432003). The activation of NF-κB in NCI/ADR-RES cells was tested under huIL-36β stimulation as follows: the ligand huIL-36β was diluted to 240 ng/mL, added to cells pre-incubated with the antibody to be detected, and incubated for 30 min at 37° C. with 5% CO.sub.2. Supernatants were obtained through centrifugation, and after cell lysis, lysate was taken and subjected to NF-κB phosphorylation assay with a kit (Cisbio, Cat. #: 64NFBPEG).

    TABLE-US-00007 TABLE 4 Results of bioactivity detection of candidate humanized antibodies Detection index/ Stimulating IC50 factor (ng/ml) 900389 900513 900527 900534 900497 IL-36 α IL-6 21.85 12.40 15.03 21.58 33.22 IL-8 57.45 39.78 31.53 30.39 43.91 GM-CSF 33.17 20.65 22.00 20.17 32.83 IL-36 β IL-6 24.59 22.34 13.92 16.80 20.39 IL-8 34.44 22.09 22.27 21.97 29.21 GM-CSF 26.91 18.40 17.36 18.65 22.36 IL-36 γ IL-6 26.44 12.05 16.18 17.61 19.78 IL-8 33.71 18.00 19.81 17.95 28.37 GM-CSF 32.67 17.87 19.81 20.97 28.75 IL-36 β pNF-κB 179.00 105.30 71.44 64.92 115.10

    [0217] The results were shown as in FIG. 1 to FIG. 4 and Table 4. The humanized antibodies 900513, 900527, and 900534 showed a significant blocking effect on the function of human stimulating factors IL-36α, IL-36β and IL-36γ, such that the secretion of cytokines IL-6, IL-8 and GM-CSF and the phosphorylation of NF-κB could be significantly blocked.

    Example 4 Non-Specific Binding Experiment (SPR) of Chimeric Antibodies and Humanized Antibodies

    [0218] In this test, the SPR method was used to determine the non-specific adsorption effect between antibodies and non-target molecules, and the instrument and equipment as well as reagent materials used in the test were shown as in Table 5 and Table 6.

    TABLE-US-00008 TABLE 5 Instrument and equipment Designation Factory Model No. Biacore GE Biacore 8K 1305

    TABLE-US-00009 TABLE 6 Reagent materials: Manufac- turer/ Catalog Designation Source No. Batch No. Series S Sensor Chip CM5 GE BR-1005-30 10253038 Egg-derived lysozyme Sigma L3790 SLBM3565V solution Soybean-derived trypsin Sigma T-2327 SLBJ6832V inhibitor type 1-S Polyclonal rabbit anti- ABcam Ab391 GR215714-19 lysozyme Anti-trypsin inhibitor LifeSpan LS-C76609 26978 antibodies Biosciences

    [0219] The Series S Sensor Chip CM5 (GE, #BR-1005-30) was equilibrated for 20-30 min at room temperature and fitted into the Biacore 8K (GE) instrument. The egg-derived lysozyme solution (Sigma, #L3790) and the soybean-derived trypsin inhibitor type 1-S(Sigma, #T-2327) were immobilized to the CM5 chip using an amino conjugation kit (GE, #BR-1000-50). HBS-EP(1×) (GE, #BR-1006-69) was used as the loading buffer and 4 equilibrium cycles were set. The polyclonal rabbit anti-lysozyme (ABcam, Ab391), the anti-trypsin inhibitor antibody (LifeSpan Biosciences, #LS-C76609), the chimeric antibody, and the humanized antibody were diluted to 1000 nM with the equilibration buffer, respectively; and the flow rate was set to 5 μL/min, loading channels to 1, 2 and 3, and Flow Cells to 1 and 2. The binding time was 10 min and the dissociation time was 15 min. At the regeneration flow rate of 50 μL/min, the regeneration was carried out first with 0.85% phosphoric acid solution (ProteOn, 176-2260) for 60 s, and then with 50 mM sodium hydroxide solution for 30 s.

    [0220] Here, the sample 900389, as an anti-human IL-36R humanized antibody developed by BI, was obtained through independent expression by HUABO who synthesized variable region genes according to the patent. The sample 900497 was an anti-IL-36R chimeric antibody constructed through hybridoma screening by HUABO.

    [0221] The results showed that the binding signal of 900389 to the egg-derived lysozyme solution was greater than 20 RU, as shown in Table 7. It was thus believed that the non-specific electrostatic and hydrophobic binding action existed The binding signal of 900497 to the egg-derived lysozyme solution and the binding signal of 900497 to the soybean-derived trypsin inhibitor type 1-S were both less than 20. It was thus believed that the non-specific electrostatic and hydrophobic binding action did not exist.

    TABLE-US-00010 TABLE 7 Comparison of non-specific binding of samples Trypsin Deactivated Lysozyme inhibitor carboxymethyl Carboxymethyl Designation (RU) (RU) glucan (RU) glucan (RU) Buffer 24.0 12.9 16.2 14.0 Polyclonal 9316.9 32.2 34.3 27.7 rabbit anti-lysozyme Anti-trypsin 65.1 6259.1 36.8 22.5 inhibitor antibodies 900389 55.0 27.5 16.3 14.2 900497 24.3 16.7 16.4 14.4

    [0222] Note: It was generally believed that after the influence of buffer was deducted, the response value below 20 RU indicated a weak interaction which was ignorable, the response value greater than 20 RU indicated a significant interaction; and the response value above 100 RU indicated a strong interaction.

    Example 5 Cell Binding and Function Experiment of Stable Cell Line Antibodies

    [0223] The BI control sequence 900389, the humanized sequence 900527 screened by HUABO, and TNP IgG1 (Fc silence) 900543 were inserted into HUABO GS vectors to construct recombinant expression plasmids for transfecting CHO-K1 cells, respectively, thereby constructing stable cell lines. The stable cell line constructed from HUABO 900527 has a protein number of HB0034, and the screened monoclonal cell lines were optimized by the upstream process to achieve the expression level of greater than 4 g/L. The antibodies expressed by stable cell lines were purified and then tested by flow cytometry binding experiments and functional experiments. The sample 900543 was a TNP IgG1 (Fc silence) negative control antibody. 5.1 Flow cytometry binding experiment for stable cell line antibodies

    [0224] The binding activity of the stable cell line antibodies to human IL-36R and monkey IL-36R was detected, and the cell lines for flow cytometry detection were CHO-K1 cell lines that were constructed internally by HUABO and expressed human IL-36R and monkey IL-36R.

    [0225] The detection results were shown as in Table 8 and FIG. 5 and FIG. 6.

    TABLE-US-00011 TABLE 8 Detection of binding activity of antibodies to human IL-36R and monkey IL-36R Binding activity to Binding activity Binding activity Binding activity Name of human IL-36R to human IL-36R to monkey IL-36R to monkey IL-36R antibody EC50 (ug/mL) EC90 (ug/mL) EC50 (ug/mL) EC90 (ug/mL) 900389 0.1245 0.4428 0.1307 0.5305 HB0034 0.062 0.2786 0.05954 0.2915 900543 No binding No binding No binding No binding

    [0226] The results showed that HUABO monoclonal antibody HB0034 had high binding activity to both human IL-36R and monkey IL-36R. Compared with the positive control antibody 900389, the antibody of the present application had lower EC50 value and showed stronger binding activity to human IL-36R.

    5.2 Experiments on Detection of Functional Inhibition Effect of Stable Cell Line Antibodies on huIL-36 Stimulating Factor
    5.2.1 Functional Inhibition Effect of Antibodies on huIL-36 Stimulating Factor in NCI/ADR-RES Cells

    [0227] The human ovarian cancer cell line NCI/ADR-RES was added to a 96-well cell culture plate at 100 μL per well (4.5×10.sup.4 cells per well), and incubated overnight at 37° C. with 5% CO.sub.2; a series of samples to be tested was diluted and then added at 50 μL/well, incubated for 15 min at 37° C. with 5% CO.sub.2; the ligand huIL-36β (40 ng/mL) was added at 50 μL/well, mixed thoroughly, and cultured for 18-24 h at 37° C. with 5% CO.sub.2. The cell culture supernatant was obtained through centrifuging, and tested in huIL-6 with the HTRF kit (Cat. #: 62HIL06PEG, CISBIO).

    [0228] The results were shown as in Table 9 and FIG. 7.

    TABLE-US-00012 TABLE 9 Functional inhibition effect of antibodies on huIL-36 stimulating factor in NCI/ADR-RES cells HuIL-6 detected HuIL-6 detected in in NCI/ADR-RES under NCI/ADR-RES under Name of IL-36β stimulation IL-36β stimulation antibody IC50 (ug/mL) IC90 (ug/mL) 900389 0.02541 0.1485 HB0034 0.008874 0.1134 900543 No effect No effect

    [0229] The results showed that the humanized antibody HB0034 of the stable cell line had a significant blocking effect on the function of the human stimulating factor IL-36β, and could significantly block the secretion of cytokine IL-6. Compared with the positive control antibody 900389, the antibody of the present application had a lower IC50 value and a stronger blocking effect.

    5.2.2 Functional Inhibition Effect of Antibodies on huIL-36 Stimulating Factor in HIF Cells

    [0230] Human intestinal fibroblasts (HIF) cells were prepared into a 4.5E5/ml cell suspension with a Serum Starvd medium, added to a 96-well plate at 100 ul (45,000 cells) per well, and incubated overnight. The series of antibodies was diluted, added at 50 l/well, and incubated for 15 min at 37° C. IL-36α was diluted to 1000 ng/ml, added at 50 μl per well, and mixed thoroughly. The mixture was incubated for 4 h at 37° C. with 5% CO.sub.2, and centrifuged to collect a supernatant, in which the content of human IL-6 was detected. IL-36β was diluted to 80 ng/m, added at 50 μl per well, and mixed thoroughly. The mixture was incubated for 4 h at 37° C. with 5% CO.sub.2, and centrifuged to collect a supernatant, in which the content of human IL-6 was detected. IL-36β was diluted to 40 ng/m, added at 50 μl per well, and mixed thoroughly. The mixture was incubated for 20 min at 37° C. with 5% CO.sub.2, and the content of pNFκB was detected using the kit.

    [0231] The results were shown as in Table 10 and FIG. 8, Table 11 and FIG. 9, Table 12 and FIG. 10.

    TABLE-US-00013 TABLE 10 Functional inhibition effect of antibodies on huIL-36 stimulating factor in HIF cells HuIL-6 detected in HIF HuIL-6 detected in HIF Name of under IL-36α stimulation under IL-36α stimulation antibody IC50 (ug/mL) IC90 (ug/mL)nL) 900389 0.08537 2.059 900497 0.1458 3.425 HB0034 0.04794 2.246

    TABLE-US-00014 TABLE 11 Functional inhibition effect of antibodies on huIL-36 stimulating factor in HIF cells HuIL-6 detected in HIF under HuIL-6 detected in HIF under Name of IL-36β stimulation IL-36β stimulation antibody IC50 (ug/mL) IC90 (ug/mL) 900389 0.07276 1.386 900497 0.08373 3.644 HB0034 0.05458 2.138

    TABLE-US-00015 TABLE 12 Functional inhibition effect of antibodies on huIL-36 stimulating factor in HIF cells pNFκB detected in HIF pNFκB detected in HIF Name of under IL-36β stimulation under IL-36β stimulation antibody IC50 (ug/mL) IC90 (ug/mL) 900389 0.1670 0.4188 900497 0.1002 0.7757 HB0034 0.1049 0.6863

    [0232] The results showed that the humanized antibody HB0034 of the stable cell line had a significant blocking effect on the function of human stimulating factors IL-36α and IL-36β, and could significantly block the secretion of cytokine IL-6 and the phosphorylation of NF-κB. Compared with the positive control antibody 900389, the antibody of the present application had a lower IC50 value and a stronger blocking effect.

    Example 6 Non-Specific Binding Experiment (SPR) of Humanized Antibodies

    [0233] In this test, the SPR method was used to determine the non-specific adsorption effect between antibody samples (900389 and HB0034) and non-target molecules, and the reagent materials used in the test were shown as in Table 13.

    TABLE-US-00016 TABLE 13 Reagent materials Manufacturer/ Designation Source Catalog No. Batch No. Series S Sensor Chip CM5 GE BR-1005-30 10253038 Lysozyme solution from chicken egg Sigma L3790 SLBM3565V Trypsin inhibitor type 1-S from Sigma T-2327 SLBJ6832V Glycine max Polyclonal rabbit anti-lysozyme Abcam Ab391 GR215714-19 Anti-trypsin inhibitor antibody LifeSpan LS-C76609 26978 Biosciences

    [0234] The Series S Sensor Chip CM5 (GE, #BR-1005-30) was equilibrated for 20-30 min at room temperature and fitted into the Biacore 8K (GE) instrument. The egg-derived lysozyme solution (Sigma, #L3790) and the soybean-derived trypsin inhibitor type 1-S(Sigma, #T-2327) were immobilized to channels 1 and 2 of the CM5 chip using an amino conjugation kit (GE, #BR-1000-50). HBS-EP+(1×) (GE, #BR-1006-69) was used as the running buffer and 5 equilibrium cycles were set. The polyclonal rabbit anti-lysozyme (ABcam, #Ab391), the anti-trypsin inhibitor antibody (LifeSpan Biosciences, #LS-C76609), the chimeric antibody, and the humanized antibody were diluted to 1000 nM with the running buffer, respectively; and the flow rate was set to 5 μL/min, loading channels to 1, 2 and 3, and Flow Cells to 1 and 2. The binding time was 10 min and the dissociation time was 15 min. At the regeneration flow rate of 50 μL/min, the regeneration was carried out first with 0.85% phosphoric acid solution (BIO-RAD, #176-2260) for 60 s, and then with 50 mM sodium hydroxide solution (GE, #BR-1003-58) for 30 s.

    [0235] The results showed that, as shown in Table 14, the binding response value of the BI control antibody 900389 to lysozyme was greater than 20 RU and its binding response value to trypsin was less than 20 RU, indicating that the samples had negative charges. In this experiment, the binding response value of 900389 to carboxymethyl glucan was 53.9 RU, indicating that the samples were capable of binding to the carboxymethyl glucan. The binding response value of HB0034 to lysozyme and the binding response value of HB0034 to trypsin were both less than 20 RU, and the sample could be considered showing no obvious non-specific electrostatic binding effect.

    TABLE-US-00017 TABLE 14 Comparison of non-specific binding of samples Trypsin Deactivated Lysozyme inhibitor carboxymethyl Carboxymethyl Designation (RU) (RU) glucan (RU) glucan (RU) Buffer 0 0 0 0 Polyclonal 5554.4 15.1 −8.5 18.0 rabbit anti-lysozyme Anti-trypsin 17.5 9920.5 −7.3 14.6 inhibitor antibodies 900389 (BI 21.6 14.6 0.3 53.9 control antibody) HB0034 12.1 12.0 −1.3 −2.4

    [0236] Note: It was generally believed that after the influence of buffer was deducted, the response value below 20 RU indicated a weak interaction which was ignorable, the response value greater than 20 RU indicated a significant interaction; and the response value above 100 RU indicated a strong interaction.

    Example 7 Therapeutic Effect of Humanized Antibodies on Psoriasis

    [0237] Cynomolgus monkeys were assigned into five groups (with six monkeys in each group), namely a model control group, a positive control group, a low-dose HB0034 group, a mid-dose HB0034 group, and a high-dose HB0034 group. A model of psoriasis was established by applying imiquimod (IMQ) cream. From the day of first modeling (Day 0) and on the 4th day (Day 4), the low-, mid- and high-dose HB0034 groups of were administered with intravenous injections of 5, 15, and 50 mg/kg HB0034 respectively; the model control group was administered with normal saline; and the positive control group was administered with dexamethasone (5 mg/cm.sup.2, applied once a day).

    [0238] The experimental results showed that at the end of the test, the weight of each group decreased slightly, and the weight loss in the HB0034 treatment groups decreased with the increase of dose. Compared with normal saline (model group), HB0034 at a dose of 5 mg/kg significantly reduced the levels of IL-17 and IL-36 (p<0.05) in molded skin tissues, showing a trend towards improvement in dermatopathological scoring, but the difference was not significant (p>0.05) (see Table 15); HB0034 at a dose of 15 mg/kg significantly improved the PASI scoring of the model (Day 10 as experimental endpoint, p<0.05), showing a trend towards improvement in dermatopathological scoring, but the difference was not significant (p>0.05) (see Table 15, FIG. 12), and the levels of IL-17 and IL-36 in the molded skin tissues were significantly reduced (p<0.05); and HB0034 at a dose of 50 mg/kg significantly improved the PASI scoring of the model (Days 4 to 10, p<0.05), and significantly reduced the dermatopathological scoring and the levels of skin IL-17 and IL-36 (p<0.05) (see Table 15, FIG. 11 to FIG. 12). Here, in FIG. 11, n=6, * p<0.05, ** p<0.01 v.s. normal saline; and in FIG. 12, n=6, ** p<0.01 v.s. normal saline.

    [0239] In this mode, the efficacy of the positive control drug dexamethasone (5 mg/cm.sup.2) was slightly better than that of 15 mg/kg HB0034 and slightly weaker than that of 50 mg/kg HB0034.

    [0240] It can be seen that HB0034 at a dose of 15-50 mg/kg (i.v., Q4D×2) alleviates the IMQ-induced psoriasis-like symptoms such as skin erythema, dander, and skin thickening, reduces the PASI scoring, improves the dermatopathological scoring at the modeled sites, and reduces the levels of IL-17 and IL-36 in skin tissues, in a dose-dependent manner. HB0034 has a minimum effective dose of 15 mg/kg in the cynomolgus monkey model of IMQ-induced psoriasis.

    TABLE-US-00018 TABLE 15 Effects of HB0034 on IL-17 and IL-36 levels in skin tissues of cynomolgus monkey model of IMQ-induced psoriasis IL-17 concentration IL-36 concentration Group (pg/mL) (pg/mL) Group A: normal saline 17.4 ± 0.84  12.49 ± 1.81   Group B: dexamethasone 8.62 ± 0.59** 5.27 ± 0.52** Group C: HB0034, 5 mg/kg 10.25 ± 1.73**  5.97 ± 1.12*  Group D: HB0034, 15 mg/kg 8.59 ± 0.85** 2.97 ± 0.95** Group E: HB0034, 50 mg/kg 7.34 ± 0.07** 0.96 ± 0.69** Note: mean ± SEM, n = 6; *p < 0.05, **p < 0.01 v.s. normal saline.

    [0241] All documents mentioned in the present application are hereby incorporated by reference in their entirety, just as each document is cited separately as a reference. In addition, it should be understood that various modifications and changes may be made by those skilled in the art after reading the above teachings of the present application and these equivalent forms also fall within the scope defined by the claims appended hereto.