NOVEL HUMAN INDUCED PLURIPOTENT STEM CELL LINES FOR MODELING ALZHEIMER'S DISEASE AND USAGE THEREOF

20210180029 · 2021-06-17

    Inventors

    Cpc classification

    International classification

    Abstract

    A method of generating a cellular model of Alzheimer's disease (AD) comprises integrating AD related gene to hiPSC to induce increased beta secretase and/or Abeta 42 peptides, and the cellular model of Alzheimer's disease (AD) is prepared by the method.

    Claims

    1. A method of generating a cellular model of Alzheimer's disease (AD), comprising integrating AD-related gene to hiPSC to induce increased beta-secretase and/or Abeta-42 peptides.

    2. The method of claim 1, wherein the AD-related gene is constitutively overexpressed in hiPSC, and wherein the AD-related gene is mutant APP or PS gene attributing to the onset of AD.

    3-5. (canceled)

    6. The method of claim 1, wherein the AD-related gene is selected from the group consisting of mutant APP attributing to the onset of AD, PS1dE9 gene and BACE1 gene.

    7. The method of claim 1, wherein the AD-related gene is integrated into hiPSC by a site-specific manner.

    8. The method of claim 7, wherein the AD-related gene is integrated into hiPSC at AAVS1 site.

    9. A cellular model of Alzheimer's disease (AD) generated by the method of claim 1.

    10-37. (canceled)

    38. A high throughput method for screening a therapeutic agent for treatment of AD, comprising i) Preparing a cellular model of Alzheimer's disease (AD) from a hiPSC by introducing an expression vector or a genetic construct to the hiPSC, wherein the expression vector comprises a nucleic acid sequence encoding an AD-related protein selected from the group consisting of mutant APP attributing to the onset of AD, PS1dE9 and BACE1 and a reporter, wherein the nucleic acid sequence is operably linked to a promoter for driving high level of gene expression in a mammalian expression vector, and wherein the genetic construct comprises a nucleic acid sequence coding for: a first promoter; a drug selection gene controlled by the first promoter; a second promoter; an AD-related gene linked to a reporter gene controlled by the second promoter; and sequence homologous to human AAVS1 site, wherein all said elements are in a cis order, wherein the AD-related gene is selected from the group consisting of mutant APP attributing to the onset of AD, PS1dE9 gene and BACE1 gene; ii) Culturing the candidate compounds with the cellular model for two days to two weeks, and iii) measuring beta-secretase level, Abeta-42 concentration, and Abeta42/Abeta-40 ratio before and after adding the candidate compounds; wherein reduction of one or more measurements selected from beta-secretase level, Abeta-42 concentration and Abeta42/Abeta-40 ratio indicates the candidate compound is a potential therapeutic agent for treatment of AD.

    39. The method of claim 38, the hiPSCs come from a human donor and are converted to hiPSC by a conventional reprogramming method in vitro.

    40. The method of claim 39, the hiPSCs come from a normal human donor without AD and are converted to hiPSC by a conventional reprogramming method in vitro.

    41. The method of claim 38, which is for screening of early AD drug.

    42. A drug screening process for screening beta-secretase or Abeta-42 inhibitor, comprising i) modifying hiPSC line by constitutively over-expressing BACE1 gene or PS1dE9 gene, ii) re-differentiating hiPSC line into functional neurons, iii) culturing the functional neurons in presence of candidate drug compounds, and iv) measuring beta-secretase level, Abeta42/Abeta-40 ratio, and/or Abeta-42 concentration and selecting compounds that can reduce beta-secretase level, Abeta42/Abeta-40 ratio, and/or Abeta-42 concentration.

    43. The process of claim 42, comprising culturing the functional neurons in presence of candidate drug compounds for two days to two weeks.

    44. The process of claim 42, the hiPSCs come from a human donor and are converted to hiPSC by a conventional reprogramming method in vitro.

    45. The process of claim 44, the hiPSCs come from a normal human donor without AD and are converted to hiPSC by a conventional reprogramming method in vitro.

    46. The process of claim 42, wherein the hiPSC line is produced by introducing an expression vector to the hiPSC, wherein the expression vector comprises a nucleic acid sequence encoding an AD-related protein selected from the group consisting of mutant APP attributing to the onset of AD, PS1dE9 and BACE1.

    47. The process of claim 46, wherein the expression vector further comprises a nucleic acid sequence encoding a drug selection gene controlled by a promoter for driving high level of gene expression in a mammalian expression vector.

    48. The process of claim 46, wherein the expression vector further comprises a nucleic acid sequence for site specific integration.

    49. The process of claim 48, wherein the nucleic acid sequence for site specific integration is a nucleic acid sequence homologous to human AAVS1 site.

    50. The process of claim 47, wherein the drug selection gene is antibiotic resistance gene

    51. The process of claim 46, wherein all the elements in the vector are in an order beneficial to expression of the AD-related gene.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0029] These and other aspects and advantages of embodiments of the present disclosure will become apparent and more readily appreciated from the following descriptions made with reference the accompanying drawings, in which:

    [0030] FIGS. 1A-1F Example for generation and characterization of the parental hiPSC lines (UCIS3007): Urine cells from a healthy non-diseased donor are isolated and converted into hiPSC cell by the standard reprogramming method using 4 transcription factors (Oct4, Sox2, Klf4, and cMyc). FIG. 1A. The process of reprogramming of urine cells, showing morphological changes and alkanin phosphotase (AP) staining; FIG. 1B. Immunostaining of biomarkers for pluripotent stem cells (Nanog, Tra-1-60, Tra-1-81, SSEA3, and SSEA4); FIG. 1C-1E. Additional pluripotency test (transgene silencing, expression of endogenous pluripotency genes, FACS of surface markers, promoter demythelation, karyotyping, embryoid body formation and expression of germ layer markers); and FIG. 1F. Teratoma formation, showing three germ layers.

    [0031] FIG. 2 Neural stem cells and neuronal cells (NSC, mixed neuron, dopaminergic neuron and motor neuron) derived from the parental hiPSC lines.

    [0032] FIGS. 3A-3C Map of donor vector used for generating hiPSC lines with ectopic expression of AD-related gene at AAVS1 site. The nucleic acid sequence involved in targeted integration comprises a homologous sequence to human AAVS1 site (HA-L and HA-R), a human PGK-1 promoter, a drug selection marker gene, a CAG promoter, an AD-related gene and a reporter gene, all in a cis fashion. Different AD-related genes can be easily replaced by restriction enzyme digestion using Xho-I and BglII. FIG. 3A. The backbone vector CIB-PCBEB; FIG. 3B. Donor vector for targeted integration of BACE1 gene; and FIG. 3C. Donor vector for targeted integration of PS1dE9 gene.

    [0033] FIGS. 4A-4C. Targeted integration of BACE1 gene into AAVS1 site. AAVS1 site is located in the intron region of Exon 1 and Exon 2 of PPP1R12C locus. F1, F2, F3, R1, R2, and R3 are primers used for verification of insertion by junction PCR. FIG. 4A. The targeted integration strategy; FIG. 4B. Screening of single cell clones by junction PCR (upper panel: 5′end junction PCR using F1+R1 primers. The clone 21 is iPSN0041-21 with insert and the clone 24 is a negative clone without insert; lower panel: 3′ end junction PCR); FIG. 4C. Sequences of 5′end and 3′end of the insert in iPSN0041-21.

    [0034] FIGS. 5A-5C. Targeted integration of PS1dE9 gene into AAVS1 site. AAVS1 site is located in the intron region of Exon 1 and Exon 2 of PPP1R12C locus. F1, F2, F3, R1, R2, and R3 are primers used for verification of insertion by junction PCR. FIG. 5A. The targeted integration strategy; FIG. 5B. Screening of single cell clones by junction PCR (upper panel: 5′end junction PCR using F1+R1 primers. 74 is the selected clone with insert for further characterization and 67 is a negative clone without insert; lower panel: 3′ end junction PCR); FIG. 5C. Sequences of 5′end and 3′end of the insert in clone 74; FIG. 5D. Over-expression of PS1dE9 gene in iPSC (UCIS3007-74).

    [0035] FIG. 6. Manufacturing process for making large quantities of neuronal cells from hiPSC, showing that having neural stem cells (NSCs) as an intermediate stage is a critical step for shortening the assay process and reducing variation. Neural stem cells are immunostaining with NSC-specific biomarkers sox-1 (red, staining nuclei) and nestin (green, staining cytoplasm). Functional neurons are immunostaining with neuron-specific biomarker Tujl (red) and nuclear staining dye Dapi (blue).

    [0036] FIGS. 7A-7B. Over-expression of BACE1 gene in iPSN0041-21 in comparison with iPSN0041, showing that iPSN0041-21 has significantly higher expression of BACE1 gene at RNA and protein levels compared to those of the parental line iPSN0041. FIG. 7A. mRNA expression in hiPSC and in neurons derived from hiPSC between iPSN0041-21 and iPSN0041; FIG. 7B. BACE1 protein expression in neural stem cells and neurons derived from the hiPSC line.

    [0037] FIGS. 8A-8B. Over-expression of Abeta-42 peptides in iPSN0041-21 in comparison with iPSN0041. FIG. 8A. Abeta-42 concentration in hiPSC-derived neurons, showing that neurons derived from iPSN0041-21 have higher Abeta-42 concentration than that from iPSN0041; FIG. 8B. Time course study of Abeta-42 expression between iPSN0041-21 and iPSN0041, showing the different expression patterns.

    [0038] FIGS. 9A-9B. Example of drug screening using iPSN0041-21, showing that two small molecule compounds not being reported before, B3 and B16, reduce production of both Abeta-40 and Abeta-42 peptides in hiPSC-derived neurons, but not affect the Abeta-42/40 ratio. A known beta-secretase inhibitor (10 uM) is used as the positive control. Data are from three biological repeats. FIG. 9A. Reduction of B3 and B16 on Abeta-40 production; FIG. 9B. Reduction of B3 and B16 on Abeta-42 production; and FIG. 9C. Abeta-42 vs. Abeta-40 ratio.

    DETAILED DESCRIPTION

    [0039] All technical and scientific terms used herein have the same meaning as is commonly understood by one of ordinary skill in the art unless defined otherwise. For example, for terms in the biological field provided herein, practitioners are particularly directed to Sambrook et al., Molecular Cloning: A Laboratory Manual, 2.sup.nd ed., Cold Spring Harbor Press, Plainsview, N.Y. (1989); and Ausubel et al., Current Protocols in Molecular Biology (Supplement 47), John Wiley & Sons, New York (1999). Those terms should not be construed to have a scope less than understood by a person of ordinary skill in the art.

    [0040] The term “comprising” is used in the present description and claims, it does not exclude other elements or steps. Where an indefinite or definite article is used when referring to a singular noun e.g. “a” or “an”, “the”, this includes a plural of that noun unless something else is specifically stated.

    [0041] “AD-related gene” indicates any gene associated with the onset of Alzheimer's disease (AD). Although the cause of Alzheimer's disease is poorly understood, about 70% of the risk is believed to be genetic with many genes usually involved, for example, mutant genes encoding amyloid precursor protein (APP) and presenilins (PS) 1 and 2. The mutations in APP gene result in abnormal APP protein that is preferentially cleaved by beta-secretase to produce more Abeta peptides; whereas mutations in PS genes leads to preferentially production of Abeta42 peptide (Abeta-42 peptide), the constituent of amyloid plaques. Although there is no mutation in the gene encoding beta-secretase was found in either FAD or SAD patients, it is clear that elevated BACE1 expression results in elevated expression of Abeta peptides and thus increases the level of Abeta-42 peptides in AD patients. These genes, together with other genes found or will be found closely related to the onset of AD, are collectively denoted as AD-related gene in the present invention.

    [0042] Mutant amyloid precursor protein (APP) or presenilins (PS) 1 and 2 gene herein indicates APP or PS1 or PS2 gene with mutations attributing to the onset of AD. The mutations of these genes may be naturally occurring in the AD patients or genetically created in vitro. When the term “BACE1 gene” is stated in the present invention, it encompassed not only the naturally occurring gene, but also its functional variants. The functional variants may be slightly different from the naturally occurring gene in amino acid sequence, for example, having at least 80%, preferably at least 90%, more preferably at least 95%, 96%, 97%, 98%, 99% homology with the amino acid sequence of the naturally occurring protein, but nevertheless, they still have the same function as the natural protein.

    [0043] “Constitutive expression” means a gene that is transcribed continually compared to a facultative gene which is only transcribed as needed. “Overexpress” means an excessively high level of gene expression which produces a pronounced gene-related phenotype. As far as the present invention, the AD-related gene integrated into hiPSC is constitutively overexpressed in the hiPSC and leads to the appearance of phenotype of AD in the process of amyloid precursor protein.

    [0044] “Phenotype of AD” in the present invention is related to the phenotype in the process of amyloid precursor protein induced by the integration of AD-related gene and constitutive overexpression of the integrated AD-related gene, including but not limited to increased beta-secretase level, amyloid beta peptide, Abeta-42 concentration and/or Abeta-42/Abeta-40.

    [0045] In the present invention, the AD-related gene is integrated into hiPSC for constitutively overexpressing the AD-related gene to generate AD phenotype. The integration is carried out preferably by site-specific manner, most preferably, by using a sequence homologous to safe harbor site, i.e., human AAVS1 site. Being “homologous” is required to achieve homologous recombination so that the foreign gene can be integrated into the target site. A skilled person in the art, based on common knowledge, knows how to design a sequence homologous to the sequence at the target integration site to achieve the purpose of homologous recombination at the human AAVS1 site. Therefore, for such sequence, the embodiments encompassed by the present invention include but not limit to the exemplified.

    Vectors

    [0046] The cellular AD model of the present invention can be produced using genetic recombinant methods to introduce AD-related gene to the hiPSC derived from a non-diseased person. For recombinant production of the cellular model of AD, nucleic acids encoding the AD-related proteins, for example, mutant APP or PS protein, or BACE1 enzyme, is isolated and inserted into a replicable vector for further cloning (amplification of the DNA) or for expression. DNA encoding said proteins may be readily isolated and sequenced using conventional procedures in the art.

    [0047] Many vectors are available for further arrangement for the purpose of the present invention. The components in the vectors generally include, but are not limited to, one or more of the following: an origin of replication, one or more marker genes, one or more report genes, an enhancer element, a promoter, and a transcription termination sequence.

    Origin of Replication

    [0048] Both expression and cloning vectors contain a nucleic acid sequence that enables the vector to replicate in the selected host cell.

    [0049] Generally, in cloning vectors this sequence is one that enables the vector to replicate independently of the host chromosomal DNA, and includes origins of replication or autonomously replicating sequences. Such sequences are well known for a variety of bacteria, yeast, and viruses. The origin of replication from the plasmid pBR322 is suitable for most Gram-negative bacteria, the 2p plasmid origin is suitable for yeast, and various viral origins (SV40, polyoma, adenovirus, VSV or BPV) are useful for cloning vectors in mammalian cells. Generally, the origin of replication component is not needed for mammalian expression vectors (the SV40 origin may typically be used only because it contains the early promoter).

    Selection Gene Component

    [0050] Expression and cloning vectors may contain a selection gene, also termed a selectable marker. Typical selection genes encode proteins that (a) confer resistance to antibiotics or other toxins, e.g., ampicillin, neomycin, methotrexate, or tetracycline, uromycine, kanamycine, and geneticine (b) complement auxotrophic deficiencies, or (c) supply critical nutrients not available from complex media, e.g., the gene encoding D-alanine racemase for Bacilli.

    [0051] One example of a selection scheme utilizes a drug to arrest growth of a host cell. Those cells that are successfully transformed with a heterologous gene produce a protein conferring drug resistance and thus survive the selection regimen. Examples of such dominant selection use the drugs neomycin, uromycine, kanamycine, and geneticine and hygromycin.

    [0052] Another example of suitable selectable markers for mammalian cells are those that enable the identification of cells competent to take up antibody encoding nucleic acid, such as DHFR, glutamine synthetase (GS), thymidine kinase, metallothionein-1 and -11, preferably primate metallothionein genes, adenosine 20 deaminase, ornithine decarboxylase, etc.

    [0053] For example, cells transformed with the DHFR gene are identified by culturing the transformants in a culture medium containing methotrexate (Mtx), a competitive antagonist of DHFR. Under these conditions, the DHFR gene is amplified along with any other co-transformed nucleic acid.

    [0054] Alternatively, cells transformed with the GS gene are identified by culturing the transformants in a culture medium containing L-methionine sulfoximine (Msx), an inhibitor of GS. Under these conditions, the GS gene is amplified along with any other co-transformed nucleic acid. The GS selection/amplification system may be used in combination with the DHFR selection/amplification system described above.

    Report Gene Component

    [0055] A reporter gene (often simply reporter) is a gene that researchers attach to a regulatory sequence of another gene of interest in organisms. Certain genes are chosen as reporters because the characteristics they confer on organisms expressing them are easily identified and measured, or because they are selectable markers. Reporter genes are often used as an indication of whether a certain gene has been taken up by or expressed in the cell or organism population.

    [0056] To introduce a reporter gene into an organism, scientists place the reporter gene and the gene of interest in the same DNA construct to be inserted into the cell or organism. Commonly used reporter genes that induce visually identifiable characteristics usually involve fluorescent and luminescent proteins. Examples include the gene that encodes jellyfish green fluorescent protein (GFP), which causes cells that express it to glow green under blue light, and the red fluorescent protein from the gene dsRed.

    Promoter Component

    [0057] Expression and cloning vectors generally contain a promoter that is recognized by the host cell and is operably linked to nucleic acid encoding the interested protein.

    [0058] Promoter sequences are known for eukaryotes. Virtually all eukaryotic genes have an AT-rich region located approximately to bases upstream from the site where transcription is initiated. Another sequence found 70 to 80 bases upstream from the start of transcription of many genes is a CNCAAT region where N may be any nucleotide. At the 3′ end of most eukaryotic genes is an AATAAA sequence that may be the signal for addition of the polyA tail to the 3′ end of the coding sequence. All of these sequences are suitably inserted into eukaryotic expression vectors.

    [0059] The AD disease-causing protein transcription from vectors in hiPSC can be controlled, for example, by promoters obtained from the genomes of viruses such as polyoma virus, fowlpox virus, adenovirus (such as Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, a retrovirus, hepatitis-B virus, Simian Virus 40 (SV40), or from heterologous mammalian promoters, e.g., the actin promoter or an immunoglobulin promoter, from heat-shock promoters, provided such promoters are compatible with the host cell systems.

    [0060] The early and late promoters of the SV40 virus are conveniently obtained as an SV40 restriction fragment that also contains the SV40 viral origin of replication. The immediate early promoter of the human cytomegalovirus is conveniently obtained as a HindIII E restriction fragment. A system for expressing DNA in mammalian hosts using the bovine papilloma virus as a vector is disclosed in U.S. Pat. No. 4,419,446. A modification of this system is described in U.S. Pat. No. 4,601,978. See also Reyes et al., Nature 297:598-601 (1982) on expression of human p-interferon cDNA in mouse cells under the control of a thymidine kinase 5 promoter from herpes simplex virus. Alternatively, the Rous Sarcoma Virus long terminal repeat can be used as the promoter.

    [0061] The CAG promoter is a strong synthetic promoter frequently used to drive high levels of gene expression in mammalian expression vectors (ref 37-38). It was constructed from the following sequences:

    (C) the cytomegalovirus (CMV) early enhancer element,
    (A) the promoter, the first exon and the first intron of chicken beta-actin gene,
    (G) the splice acceptor of the rabbit beta-globin gene

    [0062] The resulting synthetic element was used in the pCAGGS expression vector.

    [0063] Although the whole construct is commonly referred to as the “CAG promoter”, it is not a promoter in a strict sense, as it includes a part of the transcribed sequence and an intron) and enhancer elements. In addition to the CMV immediate early enhancer, the intron of the chicken beta actin gene contains an enhancer element, which is highly conserved among vertebrates. The 3′ part of the promoter has high GC content and is thus refractory to PCR amplification.

    [0064] The PGK-1 gene encodes the housekeeping enzyme, 3-phosphoglycerate kinase, and is ubiquitously expressed. This gene resides on the X chromosome in mammals and is always expressed except where it is silenced along with most other genes on the inactive X chromosome of female somatic cells or male germ cells. The PGK-1 promoter is in a region rich in nucleotides G and C. This promoter can efficiently drive high levels of expression of reporter genes such as E. coli lacZ and neo. The 120 bp upstream of the transcription start site functions as a core promoter. Upstream of this is a 320 bp region which enhances transcription from the core promoter in an orientation and position independent fashion. This 320 bp region does not enhance transcription from the core promoter of the SV40 early region. Nuclear proteins bind to this 320 bp fragment although the restricted regions to which binding can be demonstrated with gel mobility shift assays suggests that the activity of the enhancer may be mediated by factors which bind at multiple sites each with low affinity (ref 39).

    Enhancer Element Component

    [0065] Transcription of a DNA encoding the interested protein by higher eukaryotes is often increased by inserting an enhancer sequence into the vector. Many enhancer sequences are now known from mammalian genes (globin, elastase, albumin, a-fetoprotein, and insulin). Typically, however, one will use an enhancer from a eukaryotic cell virus. Examples include the SV40 enhancer on the late side of the replication origin (bp 100-270), the cytomegalovirus early promoter enhancer, the polyoma enhancer on the late side of the replication origin, and adenovirus enhancers. See also Yaniv, Nature 297:17-18 (1982) on enhancing elements for activation of eukaryotic promoters. The enhancer may be spliced into the vector at a position 5′ or 3′ to the antibody-encoding sequence, but is preferably located at a site 5′ from the promoter.

    Transcription Termination Component

    [0066] Expression vectors used in eukaryotic host cells, for example human cells, will also contain sequences necessary for the termination of transcription and for stabilizing the mRNA. Such sequences are commonly available from the 5′ and, occasionally 3′, untranslated regions of eukaryotic or viral DNAs or cDNAs. These regions contain nucleotide segments transcribed as polyadenylated fragments in the untranslated portion of the mRNA encoding the interested protein.

    [0067] In one embodiment, the vector of the present invention is designed for targeted integration of genes associated with Alzheimer's disease (AD)-related genes into human pluripotent stem cell (hiPSC) with high efficiency. Therefore, the vector is also arranged to contain a sequence for site-specific integration.

    [0068] The insertion of genes at known locations by enzymes with target recognition capacity is a kind of technology targeting genome edition, which enables researchers to delete, insert, or modify any genes or DNA segments at genome level with high efficiency and precision (ref 40-42). Such technology also includes recently wide-used CRISPRcas9 gene editing technique disclosed in for example, U.S. Pat. Nos. 8,697,359, 8,771,945, 8,795,965. In certain embodiments of the present invention, the AD-related genes are integrated specifically to the safe harbor site, i.e., AAVS1 site, by CRISPRcas9 gene editing technique.

    [0069] AAVS1 site is a natural AAV integration site on human chromosome 19. This region (AAVS1) has characteristics that make it an ideal target for transgenesis.

    [0070] In one specific embodiment of the present invention, the vector comprises a drug selection marker gene controlled by a first promoter, an AD-related gene linked with a reporter gene controlled by a second promoter, and sequences homologous to those at human AAVS1 site.

    [0071] In one specific embodiment of the present invention, the donor vector backbone contains a left arm for targeted integration (HA-L), PGK-1 promoter, a puromycine gene, a CAG promoter, a GFP reporter gene and a right arm for targeted integration (HA-RL) in a cis arrangement (FIG. 4A).

    [0072] As used herein, the left arm for targeted integration (HA-L) comprises the sequence:

    TABLE-US-00001 (SEQ ID NO. 1) TGCTTTCTCTGACCAGCATTCTCTCCCCTGGGCCTGTGCCGCTTTCTGTC TGCAGCTTGTGGCCTGGGTCACCTCTACGGCTGGCCCAGATCCTTCCCTG CCGCCTCCTTCAGGTTCCGTCTTCCTCCACTCCCTCTTCCCCTTGCTCTC TGCTGTGTTGCTGCCCAAGGATGCTCTTTCCGGAGCACTTCCTTCTCGGC GCTGCACCACGTGATGTCCTCTGAGCGGATCCTCCCCGTGTCTGGGTCCT CTCCGGGCATCTCTCCTCCCTCACCCAACCCCATGCCGTCTTCACTCGCT GGGTTCCCTTTTCCTTCTCCTTCTGGGGCCTGTGCCATCTCTCGTTTCTT AGGATGGCCTTCTCCGACGGATGTCTCCCTTGCGTCCCGCCTCCCCTTCT TGTAGGCCTGCATCATCACCGTTTTTCTGGACAACCCCAAAGTACCCCGT CTCCCTGGCTTTAGCCACCTCTCCATCCTCTTGCTTTCTTTGCCTGGACA CCCCGTTCTCCTGTGGATTCGGGTCACCTCTCACTCCTTTCATTTGGGCA GCTCCCCTACCCCCCTTACCTCTCTAGTCTGTGCTAGCTCTTCCAGCCCC CTGTCATGGCATCTTCCAGGGGTCCGAGAGCTCAGCTAGTCTTCTTCCTC CAACCCGGGCCCCTATGTCCACTTCAGGACAGCATGTTTGCTGCCTCCAG GGATCCTGTGTCCCCGAGCTGGGACCACCTTATATTCCCAGGGCCGGTTA ATGTGGCTCTGGTTCTGGGTACTTTTATCTGTCCCCTCCACCCCACAGTG GGGC.

    [0073] The PGK-puromycin cassette comprises the sequence:

    TABLE-US-00002 (SEQ ID NO. 2) ATAACTTCGTATAATGTATGCTATACGAAGTTATTACCGGGTAGGGGAGG CGCTTTTCCCAAGGCAGTCTGGAGCATGCGCTTTAGCAGCCCCGCTGGGC ACTTGGCGCTACACAAGTGGCCTCTGGCCTCGCACACATTCCACATCCCC CGGTAGGCGCCAACCGGCTCCGTTCTTTGGTGGCCCCTTCGCGCCACCTT CTACTCCTCCCCTAGTCAGGAAGTTCCCCCCCGCCCCGCAGCTCGCGTCG TGCAGGACGTGACAAATGGAAGTAGCACGTCTCACTAGTCTCGTGCAGAT GGACAGCACCGCTGAGCAATGGAAGCGGGTAGGCCTTTGGGGCAGCGGCC AATAGCAGCTTTGCTCCTTCGCTTTCTGGGCTCAGAGGCTGGGAAGGGGT GGGTCCGGGGGCGGGCTCAGGGGCGGGCTCAGGGGCGGGGCGGGCGCCCG AAGGTCCTCCGGAGGCCCGGCATTCTGCACGCTTCAAAAGCGCACGTCTG CCGCGCTGTTCTCCTCTTCCTCATCTCCGGGCCTTTCGGAATTCATGACC GAGTACAAGCCCACGGTGCGCCTCGCCACCCGCGACGACGTCCCCCGGGC CGTACGCACCCTCGCCGCCGCGTTCGCCGACTACCCCGCCACGCGCCACA CCGTCGACCCGGACCGCCACATCGAGCGGGTCACCGAGCTGCAAGAACTC TTCCTCACGCGCGTCGGGCTCGACATCGGCAAGGTGTGGGTCGCGGACGA CGGCGCCGCGGTGGCGGTCTGGACCACGCCGGAGAGCGTCGAAGCGGGGG CGGTGTTCGCCGAGATCGGCCCGCGCATGGCCGAGTTGAGCGGTTCCCGG CTGGCCGCGCAGCAACAGATGGAAGGCCTCCTGGCGCCGCACCGGCCCAA GGAGCCCGCGTGGTTCCTGGCCACCGTCGGCGTCTCGCCCGACCACCAGG GCAAGGGTCTGGGCAGCGCCGTCGTGCTCCCCGGAGTGGAGGCGGCCGAG CGCGCCGGGGTGCCCGCCTTCCTGGAGACCTCCGCGCCCCGCAACCTCCC CTTCTACGAGCGGCTCGGCTTCACCGTCACCGCCGACGTCGAGGTGCCCG AAGGACCGCGCACCTGGTGCATGACCCGCAAGCCCGGTGCCTGATAGAAC TTGTTTATTGCAGCTTATAATGGTTACAAATAAAGCAATAGCATCACAAA TTTCACAAATAAAGCATTTTTTTCACTGCATTCTAGTTGTGGTTTGTCCA AACTCATCAATGTATCTTATCATGTCTGATAACTTCGTATAATGTATGCT ATACGAAGTTAT.

    [0074] The CAG promoter comprises the sequence:

    TABLE-US-00003 (SEQ ID NO. 3) ATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTT CATAGCCCATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCC GCCTGGCTGACCGCCCAACGACCCCCGCCCATTGACGTCAATAATGACGT ATGTTCCCATAGTAACGCCAATAGGGACTTTCCATTGACGTCAATGGGTG GAGTATTTACGGTAAACTGCCCACTTGGCAGTACATCAAGTGTATCATAT GCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCTGGC ATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATC TACGTATTAGTCATCGCTATTACCATGGTCGAGGTGAGCCCCACGTTCTG CTTCACTCTCCCCATCTCCCCCCCCTCCCCACCCCCAATTTTGTATTTAT TTATTTTTTAATTATTTTGTGCAGCGATGGGGGCGGGGGGGGGGGGGGGC GCGCGCCAGGCGGGGCGGGGCGGGGCGAGGGGCGGGGCGGGGCGAGGCGG AGAGGTGCGGCGGCAGCCAATCAGAGCGGCGCGCTCCGAAAGTTTCCTTT TATGGCGAGGCGGCGGCGGCGGCGGCCCTATAAAAAGCGAAGCGCGCGGC GGGCGGGAGTCGCTGCGCGCTGCCTTCGCCCCGTGCCCCGCTCCGCCGCC GCCTCGCGCCGCCCGCCCCGGCTCTGACTGACCGCGTTACTCCCACAGGT GAGCGGGCGGGACGGCCCTTCTCCTCCGGGCTGTAATTAGCGCTTGGTTT AATGACGGCTTGTTTCTTTTCTGTGGCTGCGTGAAAGCCTTGAGGGGCTC CGGGAGGGCCCTTTGTGCGGGGGGAGCGGCTCGGGGGGTGCGTGCGTGTG TGTGTGCGTGGGGAGCGCCGCGTGCGGCTCCGCGCTGCCCGGCGGCTGTG AGCGCTGCGGGCGCGGCGCGGGGCTTTGTGCGCTCCGCAGTGTGCGCGAG GGGAGCGCGGCCGGGGGCGGTGCCCCGCGGTGCGGGGGGGCTGCGAGGGG AACAAAGGCTGCGTGCGGGGTGTGTGCGTGGGGGGGTGAGCAGGGGGTGT GGGCGCGTCGGTCGGGCTGCAACCCCCCCTGCACCCCCCTCCCCGAGTTG CTGAGCACGGCCCGGCTTCGGGTGCGGGGCTCCGTACGGGGCGTGGCGCG GGGCTCGCCGTGCCGGGCGGGGGGTGGCGGCAGGTGGGGGTGCCGGGCGG GGCGGGGCCGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCGCGGCGGCC CCCGGAGCGCCGGCGGCTGTCGAGGCGCGGCGAGTCGCAGCCATTGCCTT TTATGGTAATCGTGCGAGAGGGCGCAGGGACTTCCTTTGTCCCAAATCTG TGTGGAGCCGAAATCTGGGAGGCGCCGCCGCACCCCCTCTAGCGGGCGCG GGGCGAAGCGGTGCGGCGCCGGCAGGAAGGAAATGGGCGGGGAGGGCCTT CGTGCGTCGCCGCGCCGCCGTCCCCTTCTCCCTCTCCAGCCTCGGGGCTG TCCGCGGGGGGGCGGCTGCCTTCGGGGGGGACGGGGCAGGGCGGGGTTCG GCTTCTGGCGTGTGACCGGCGGCTCTAGAGCCTCTGCTAACCATGTTCAT GCCTTCTTCTTTTTCCTACAGCTCCTGGGCAACGTGCTGGTTATTGTGCT GTCTCATCATTTTGGCAAAGAATTCCTCGACCTCGAG.

    [0075] The GFP reporter gene comprises the sequence:

    TABLE-US-00004 (SEQ ID NO. 4) AGATCTGGCAGCGGAGAGGGCAGAGGAAGTCTTCTAACATGCGGTGACGT GGAGGAGAATCCCGGCCCTAGGTTCGAAATGGTGAGCAAGGGCGAGGAGC TGTTCACCGGGGTGGTGCCCATCCTGGTCGAGCTGGACGGCGACGTAAAC GGCCACAAGTTCAGCGTGTCCGGCGAGGGCGAGGGCGATGCCACCTACGG CAAGCTGACCCTGAAGTTCATCTGCACCACCGGCAAGCTGCCCGTGCCCT GGCCCACCCTCGTGACCACCTTGACCTACGGCGTGCAGTGCTTCGCCCGC TACCCCGACCACATGAAGCAGCACGACTTCTTCAAGTCCGCCATGCCCGA AGGCTACGTCCAGGAGCGCACCATCTTCTTCAAGGACGACGGCAACTACA AGACCCGCGCCGAGGTGAAGTTCGAGGGCGACACCCTGGTGAACCGCATC GAGCTGAAGGGCATCGACTTCAAGGAGGACGGCAACATCCTGGGGCACAA GCTGGAGTACAACTACAACAGCCACAAGGTCTATATCACCGCCGACAAGC AGAAGAACGGCATCAAGGTGAACTTCAAGACCCGCCACAACATCGAGGAC GGCAGCGTGCAGCTCGCCGACCACTACCAGCAGAACACCCCCATCGGCGA CGGCCCCGTGCTGCTGCCCGACAACCACTACCTGAGCACCCAGTCCGCCC TGAGCAAAGACCCCAACGAGAAGCGCGATCACATGGTCCTGCTGGAGTTC GTGACCGCCGCCGGGATCACTCTCGGCATGGACGAGCTGTACAAGTGA.

    [0076] The right arm for targeted integration (HA-RL) comprises the sequence (SEQ ID NO.5):

    TABLE-US-00005 TACTAGGGACAGGATTGGTGACAGAAAAGCCCCATCCTTAGGCCTCCTCC TTCCTAGTCTCCTGATATTGGGTCTAACCCCCACCTCCTGTTAGGCAGAT TCCTTATCTGGTGACACACCCCCATTTCCTGGAGCCATCTCTCTCCTTGC CAGAACCTCTAAGGTTTGCTTACGATGGAGCCAGAGAGGATCCTGGGAGG GAGAGCTTGGCAGGGGGTGGGAGGGAAGGGGGGGATGCGTGACCTGCCCG GTTCTCAGTGGCCACCCTGCGCTACCCTCTCCCAGAACCTGAGCTGCTCT GACGCGGCTGTCTGGTGCGTTTCACTGATCCTGGTGCTGCAGCTTCCTTA CACTTCCCAAGAGGAGAAGCAGTTTGGAAAAACAAAATCAGAATAAGTTG GTCCTGAGTTCTAACTTTGGCTCTTCACCTTTCTAGTCCCCAATTTATAT TGTTCCTCCGTGCGTCAGTTTTACCTGTGAGATAAGGCCAGTAGCCAGCC CCGTCCTGGCAGGGCTGTGGTGAGGAGGGGGGTGTCCGTGTGGAAAACTC CCTTTGTGAGAATGGTGCGTCCTAGGTGTTCACCAGGTCGTGGCCGCCTC TACTCCCTTTCTCTTTCTCCATCCTTCTTTCCTTAAAGAGTCCCCAGTGC TATCTGGGACATATTCCTCCGCCCAGAGCAGGGTCCCGCTTCCCTAAGGC CCTGCTCTGGGCTTCTGGGTTTGAGTCCTTGGCAAGCCCAGGAGAGGCGC TCAGGCTTCCCTGTCCCCCTTCCTCGTCCACCATCTCATGCCCCTGGCTC TCCTGCCCCTTCCCTACAGGGGTTCCTGGCTCTGCTCT.

    [0077] In another specific embodiment, the donor vector comprises a BACE1 gene that is inserted into the vector backbone at the BglII and XhoI site (FIG. 5B); cDNA sequence for BACE1 gene is disclosed in Genbank under locus NM_138973.3 (Homo sapiens beta-secretase 1, transcript variant d, mRNA). As used herein, “BACE1” denotes a transmembrane protease encoded by BACE1 gene. BACE1 catalyzes the first step in the formation of amyloid beta peptide from amyloid precursor protein. Amyloid beta peptides are the main constituent of amyloid beta plaques, which accumulate in the brains of human Alzheimer's disease patients.

    [0078] The DNA sequence of BACE1 gene in the donor vector is described as:

    TABLE-US-00006 (SEQ ID NO. 6) ATGGCCCAAGCCCTGCCCTGGCTCCTGCTGTGGATGGGCGCGGGAGTGCT GCCTGCCCACGGCACCCAGCACGGCATCCGGCTGCCCCTGCGCAGCGGCC TGGGGGGCGCCCCCCTGGGGCTGCGGCTGCCCCGGGAGACCGACGAAGAG CCCGAGGAGCCCGGCCGGAGGGGCAGCTTTGTGGAGATGGTGGACAACCT GAGGGGCAAGTCGGGGCAGGGCTACTACGTGGAGATGACCGTGGGCAGCC CCCCGCAGACGCTCAACATCCTGGTGGATACAGGCAGCAGTAACTTTGCA GTGGGTGCTGCCCCCCACCCCTTCCTGCATCGCTACTACCAGAGGCAGCT GTCCAGCACATACCGGGACCTCCGGAAGGGTGTGTATGTGCCCTACACCC AGGGCAAGTGGGAAGGGGAGCTGGGCACCGACCTGCTTTGTGGTGCTGGC TTCCCCCTCAACCAGTCTGAAGTGCTGGCCTCTGTCGGAGGGAGCATGAT CATTGGAGGTATCGACCACTCGCTGTACACAGGCAGTCTCTGGTATACAC CCATCCGGCGGGAGTGGTATTATGAGGTGATCATTGTGCGGGTGGAGATC AATGGACAGGATCTGAAAATGGACTGCAAGGAGTACAACTATGACAAGAG CATTGTGGACAGTGGCACCACCAACCTTCGTTTGCCCAAGAAAGTGTTTG AAGCTGCAGTCAAATCCATCAAGGCAGCCTCCTCCACGGAGAAGTTCCCT GATGGTTTCTGGCTAGGAGAGCAGCTGGTGTGCTGGCAAGCAGGCACCAC CCCTTGGAACATTTTCCCAGTCATCTCACTCTACCTAATGGGTGAGGTTA CCAACCAGTCCTTCCGCATCACCATCCTTCCGCAGCAATACCTGCGGCCA GTGGAAGATGTGGCCACGTCCCAAGACGACTGTTACAAGTTTGCCATCTC ACAGTCATCCACGGGCACTGTTATGGGAGCTGTTATCATGGAGGGCTTCT ACGTTGTCTTTGATCGGGCCCGAAAACGAATTGGCTTTGCTGTCAGCGCT TGCCATGTGCACGATGAGTTCAGGACGGCAGCGGTGGAAGGCCCTTTTGT CACCTTGGACATGGAAGACTGTGGCTACAACATTCCACAGACAGATGAGT CAACCCTCATGACCATAGCCTATGTCATGGCTGCCATCTGCGCCCTCTTC ATGCTGCCACTCTGCCTCATGGTGTGTCAGTGGCGCTGCCTCCGCTGCCT GCGCCAGCAGCATGATGACTTTGCTGATGACATCTCCCTGCTGA.

    [0079] And the protein sequence (SEQ ID NO.7) of BACE1 is described as:

    TABLE-US-00007 MAQALPWLLLWMGAGVLPAHGTQHGIRLPLRSGLGGAPLGLRLPRETDEE PEEPGRRGSFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFA VGAAPHPFLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLLCGAG FPLNQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEI NGQDLKMDCKEYNYDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFP DGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRITILPQQYLRP VEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSA CHVHDEFRTAVEGPFVTLDMEDCGYNIPQTDESTLMTIAYVMAAICALFM LPLCLMVCQWRCLRCLRQQHDDFADDISLLK.

    [0080] In another specific embodiment, the donor vector comprises PS1dE9 gene that is inserted into the vector backbone at the BglII and XhoI site (FIG. 4B). PS1dE9 is a mutant of PS1 gene with Exon 9 of PS1 gene being deleted. As used herein, the term “PS1” denotes a protein encoded by the presenilin 1 gene. cDNA sequence for PS1 gene is disclosed in Genbank under locus NM_000021.3 (Homo sapiens, presenilin 1, transcript variant 1, mRNA). Presenilin 1 is one of the four core proteins in presenilin complex, which mediate the regulated proteolytic events of several proteins in the cell, including gamma secretase. The term “PS1dE9” denotes a mutant gene of PS1, which causes abnormal Gamma-secretase cleavage that is favorable for production of Abeta-42 peptides and thus results in early onset of Alzheimer's disease.

    [0081] The DNA sequence of PS1dE9 in the donor vector is described below (highlighted is the deleted sequence):

    TABLE-US-00008 (SEQ ID NO. 8) ATGACAGAGTTACCTGCACCGTTGTCCTACTTCCAGAATGCACAGATGTC TGAGGACAACCACCTGAGCAATACTGTACGTAGCCAGAATGACAATAGAG AACGGCAGGAGCACAACGACAGACGGAGCCTTGGCCACCCTGAGCCATTA TCTAATGGACGACCCCAGGGTAACTCCCGGCAGGTGGTGGAGCAAGATGA GGAAGAAGATGAGGAGCTGACATTGAAATATGGCGCCAAGCATGTGATCA TGCTCTTTGTCCCTGTGACTCTCTGCATGGTGGTGGTCGTGGCTACCATT AAGTCAGTCAGCTTTTATACCCGGAAGGATGGGCAGCTAATCTATACCCC ATTCACAGAAGATACCGAGACTGTGGGCCAGAGAGCCCTGCACTCAATTC TGAATGCTGCCATCATGATCAGTGTCATTGTTGTCATGACTATCCTCCTG GTGGTTCTGTATAAATACAGGTGCTATAAGGTCATCCATGCCTGGCTTAT TATATCATCTCTATTGTTGCTGTTCTTTTTTTCATTCATTTACTTGGGGG AAGTGTTTAAAACCTATAACGTTGCTGTGGACTACATTACTGTTGCACTC CTGATCTGGAATTTTGGTGTGGTGGGAATGATTTCCATTCACTGGAAAGG TCCACTTCGACTCCAGCAGGCATATCTCATTATGATTAGTGCCCTCATGG CCCTGGTGTTTATCAAGTACCTCCCTGAATGGACTGCGTGGCTCATCTTG GCTGTGATTTCAGTATATGATTTAGTGGCTGTTTTGTGTCCGAAAGGTCC ACTTCGTATGCTGGTTGAAACAGCTCAGGAGAGAAATGAAACGCTTTTTC [00001]embedded image CAGAAAGCACAGAAAGGGAGTCACAAGACACTGTTGCAGAGAATGATGAT GGCGGGTTCAGTGAGGAATGGGAAGCCCAGAGGGACAGTCATCTAGGGCC TCATCGCTCTACACCTGAGTCACGAGCTGCTGTCCAGGAACTTTCCAGCA GTATCCTCGCTGGTGAAGACCCAGAGGAAAGGGGAGTAAAACTTGGATTG GGAGATTTCATTTTCTACAGTGTTCTGGTTGGTAAAGCCTCAGCAACAGC CAGTGGAGACTGGAACACAACCATAGCCTGTTTCGTAGCCATATTAATTG GTTTGTGCCTTACATTATTACTCCTTGCCATTTTCAAGAAAGCATTGCCA GCTCTTCCAATCTCCATCACCTTTGGGCTTGTTTTCTACTTTGCCACAGA TTATCTTGTACAGCCTTTTATGGACCAATTAGCATTCCATCAATTTTATA TCTAG.

    [0082] And the protein sequence of PS1dE9 is described below (highlighted is the miss-translated part due to deletion of Exon9):

    TABLE-US-00009 (SEQ ID NO. 9) MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPL SNGRPQGNSRQVVEQDEEEDEELTLKYGAKHVIMLFVPVTLCMVVVVATI KSVSFYTRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILL VVLYKYRCYKVIHAWLIISSLLLLFFFSFIYLGEVFKTYNVAVDYITVAL LIWNFGVVGMISIHWKGPLRLQQAYLIMISALMALVFIKYLPEWTAWLIL [00002]embedded image

    [0083] In another embodiment of the present invention, the donor vector of the invention may comprise any functional variant of BACE1 and/or any variant of PS1 attributing to the onset of AD. The variants include, for instance, naturally-occurring variants due to allelic variations between individuals (e.g., polymorphisms), alternative splicing forms, etc. Variants are preferably substantially homologous to sequences according to the present invention, i.e., exhibit a nucleotide sequence identity of typically at least about 80%, preferably at least about 90%, more preferably at least about 95%, 96%, 97%, 98%, 99% with sequences of the present invention. Variants of the genes of the present invention also include nucleic acid sequences, which hybridize to a sequence as defined above (or a complementary strand thereof) under stringent hybridization conditions. Typical stringent hybridization conditions include temperatures above 42° C. and salinity of equal or less than 200 mM.

    hiPSC Lines

    [0084] In one embodiment the present disclosure relates to creation of an hiPSC line that has an AD-related gene integrated at a safe harbor site (AAVS1 site) by the method of the present invention. The hiPSC line created by the present invention constitutively over-expresses the integrated gene and displays increased beta-secretase level and/or Abeta-42 peptides compared to an isogenic control hiPSC line without gene integration.

    [0085] In one specific embodiment, an hiPSC line made by the method of the present invention has an exogenous nucleic acid sequence integrated at AAVS1 site. The nucleic acid sequence comprises a PGK-1 promoter, a puromycin gene, a CAG promoter, a BACE1 gene, and a GFP gene and sequences that link different segments. The inserted nucleic acid sequence is described below (the underlined art is BACE1 gene):

    TABLE-US-00010 (SEQ ID NO. 10) ATAACTTCGTATAATGTATGCTATACGAAGTTATTACCGGGTAGGGGAGG CGCTTTTCCCAAGGCAGTCTGGAGCATGCGCTTTAGCAGCCCCGCTGGGC ACTTGGCGCTACACAAGTGGCCTCTGGCCTCGCACACATTCCACATCCCC CGGTAGGCGCCAACCGGCTCCGTTCTTTGGTGGCCCCTTCGCGCCACCTT CTACTCCTCCCCTAGTCAGGAAGTTCCCCCCCGCCCCGCAGCTCGCGTCG TGCAGGACGTGACAAATGGAAGTAGCACGTCTCACTAGTCTCGTGCAGAT GGACAGCACCGCTGAGCAATGGAAGCGGGTAGGCCTTTGGGGCAGCGGCC AATAGCAGCTTTGCTCCTTCGCTTTCTGGGCTCAGAGGCTGGGAAGGGGT GGGTCCGGGGGCGGGCTCAGGGGCGGGCTCAGGGGCGGGGCGGGCGCCCG AAGGTCCTCCGGAGGCCCGGCATTCTGCACGCTTCAAAAGCGCACGTCTG CCGCGCTGTTCTCCTCTTCCTCATCTCCGGGCCTTTCGGAATTCATGACC GAGTACAAGCCCACGGTGCGCCTCGCCACCCGCGACGACGTCCCCCGGGC CGTACGCACCCTCGCCGCCGCGTTCGCCGACTACCCCGCCACGCGCCACA CCGTCGACCCGGACCGCCACATCGAGCGGGTCACCGAGCTGCAAGAACTC TTCCTCACGCGCGTCGGGCTCGACATCGGCAAGGTGTGGGTCGCGGACGA CGGCGCCGCGGTGGCGGTCTGGACCACGCCGGAGAGCGTCGAAGCGGGGG CGGTGTTCGCCGAGATCGGCCCGCGCATGGCCGAGTTGAGCGGTTCCCGG CTGGCCGCGCAGCAACAGATGGAAGGCCTCCTGGCGCCGCACCGGCCCAA GGAGCCCGCGTGGTTCCTGGCCACCGTCGGCGTCTCGCCCGACCACCAGG GCAAGGGTCTGGGCAGCGCCGTCGTGCTCCCCGGAGTGGAGGCGGCCGAG CGCGCCGGGGTGCCCGCCTTCCTGGAGACCTCCGCGCCCCGCAACCTCCC CTTCTACGAGCGGCTCGGCTTCACCGTCACCGCCGACGTCGAGGTGCCCG AAGGACCGCGCACCTGGTGCATGACCCGCAAGCCCGGTGCCTGATAGAAC TTGTTTATTGCAGCTTATAATGGTTACAAATAAAGCAATAGCATCACAAA TTTCACAAATAAAGCATTTTTTTCACTGCATTCTAGTTGTGGTTTGTCCA AACTCATCAATGTATCTTATCATGTCTGATAACTTCGTATAATGTATGCT ATACGAAGTTATGCGGCCGCAATCGTCGACCTGCAGGCATGCAAGCTTAT TGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCA TAGCCCATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGC CTGGCTGACCGCCCAACGACCCCCGCCCATTGACGTCAATAATGACGTAT GTTCCCATAGTAACGCCAATAGGGACTTTCCATTGACGTCAATGGGTGGA GTATTTACGGTAAACTGCCCACTTGGCAGTACATCAAGTGTATCATATGC CAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCTGGCAT TATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTA CGTATTAGTCATCGCTATTACCATGGTCGAGGTGAGCCCCACGTTCTGCT TCACTCTCCCCATCTCCCCCCCCTCCCCACCCCCAATTTTGTATTTATTT ATTTTTTAATTATTTTGTGCAGCGATGGGGGCGGGGGGGGGGGGGGGCGC GCGCCAGGCGGGGCGGGGCGGGGCGAGGGGCGGGGCGGGGCGAGGCGGAG AGGTGCGGCGGCAGCCAATCAGAGCGGCGCGCTCCGAAAGTTTCCTTTTA TGGCGAGGCGGCGGCGGCGGCGGCCCTATAAAAAGCGAAGCGCGCGGCGG GCGGGAGTCGCTGCGCGCTGCCTTCGCCCCGTGCCCCGCTCCGCCGCCGC CTCGCGCCGCCCGCCCCGGCTCTGACTGACCGCGTTACTCCCACAGGTGA GCGGGCGGGACGGCCCTTCTCCTCCGGGCTGTAATTAGCGCTTGGTTTAA TGACGGCTTGTTTCTTTTCTGTGGCTGCGTGAAAGCCTTGAGGGGCTCCG GGAGGGCCCTTTGTGCGGGGGGAGCGGCTCGGGGGGTGCGTGCGTGTGTG TGTGCGTGGGGAGCGCCGCGTGCGGCTCCGCGCTGCCCGGCGGCTGTGAG CGCTGCGGGCGCGGCGCGGGGCTTTGTGCGCTCCGCAGTGTGCGCGAGGG GAGCGCGGCCGGGGGCGGTGCCCCGCGGTGCGGGGGGGCTGCGAGGGGAA CAAAGGCTGCGTGCGGGGTGTGTGCGTGGGGGGGTGAGCAGGGGGTGTGG GCGCGTCGGTCGGGCTGCAACCCCCCCTGCACCCCCCTCCCCGAGTTGCT GAGCACGGCCCGGCTTCGGGTGCGGGGCTCCGTACGGGGCGTGGCGCGGG GCTCGCCGTGCCGGGCGGGGGGTGGCGGCAGGTGGGGGTGCCGGGCGGGG CGGGGCCGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCGCGGCGGCCCC CGGAGCGCCGGCGGCTGTCGAGGCGCGGCGAGTCGCAGCCATTGCCTTTT ATGGTAATCGTGCGAGAGGGCGCAGGGACTTCCTTTGTCCCAAATCTGTG TGGAGCCGAAATCTGGGAGGCGCCGCCGCACCCCCTCTAGCGGGCGCGGG GCGAAGCGGTGCGGCGCCGGCAGGAAGGAAATGGGCGGGGAGGGCCTTCG TGCGTCGCCGCGCCGCCGTCCCCTTCTCCCTCTCCAGCCTCGGGGCTGTC CGCGGGGGGGCGGCTGCCTTCGGGGGGGACGGGGCAGGGCGGGGTTCGGC TTCTGGCGTGTGACCGGCGGCTCTAGAGCCTCTGCTAACCATGTTCATGC CTTCTTCTTTTTCCTACAGCTCCTGGGCAACGTGCTGGTTATTGTGCTGT CTCATCATTTTGGCAAAGAATTCCTCGACCTCGAGATGGCCCAAGCCCTG CCCTGGCTCCTGCTGTGGATGGGCGCGGGAGTGCTGCCTGCCCACGGCAC CCAGCACGGCATCCGGCTGCCCCTGCGCAGCGGCCTGGGGGGCGCCCCCC TGGGGCTGCGGCTGCCCCGGGAGACCGACGAAGAGCCCGAGGAGCCCGGC CGGAGGGGCAGCTTTGTGGAGATGGTGGACAACCTGAGGGGCAAGTCGGG GCAGGGCTACTACGTGGAGATGACCGTGGGCAGCCCCCCGCAGACGCTCA ACATCCTGGTGGATACAGGCAGCAGTAACTTTGCAGTGGGTGCTGCCCCC CACCCCTTCCTGCATCGCTACTACCAGAGGCAGCTGTCCAGCACATACCG GGACCTCCGGAAGGGTGTGTATGTGCCCTACACCCAGGGCAAGTGGGAAG GGGAGCTGGGCACCGACCTGCTTTGTGGTGCTGGCTTCCCCCTCAACCAG TCTGAAGTGCTGGCCTCTGTCGGAGGGAGCATGATCATTGGAGGTATCGA CCACTCGCTGTACACAGGCAGTCTCTGGTATACACCCATCCGGCGGGAGT GGTATTATGAGGTGATCATTGTGCGGGTGGAGATCAATGGACAGGATCTG AAAATGGACTGCAAGGAGTACAACTATGACAAGAGCATTGTGGACAGTGG CACCACCAACCTTCGTTTGCCCAAGAAAGTGTTTGAAGCTGCAGTCAAAT CCATCAAGGCAGCCTCCTCCACGGAGAAGTTCCCTGATGGTTTCTGGCTA GGAGAGCAGCTGGTGTGCTGGCAAGCAGGCACCACCCCTTGGAACATTTT CCCAGTCATCTCACTCTACCTAATGGGTGAGGTTACCAACCAGTCCTTCC GCATCACCATCCTTCCGCAGCAATACCTGCGGCCAGTGGAAGATGTGGCC ACGTCCCAAGACGACTGTTACAAGTTTGCCATCTCACAGTCATCCACGGG CACTGTTATGGGAGCTGTTATCATGGAGGGCTTCTACGTTGTCTTTGATC GGGCCCGAAAACGAATTGGCTTTGCTGTCAGCGCTTGCCATGTGCACGAT GAGTTCAGGACGGCAGCGGTGGAAGGCCCTTTTGTCACCTTGGACATGGA AGACTGTGGCTACAACATTCCACAGACAGATGAGTCAACCCTCATGACCA TAGCCTATGTCATGGCTGCCATCTGCGCCCTCTTCATGCTGCCACTCTGC CTCATGGTGTGTCAGTGGCGCTGCCTCCGCTGCCTGCGCCAGCAGCATGA TGACTTTGCTGATGACATCTCCCTGCTGAAGGTCGACAGATCTGGCAGCG GAGAGGGCAGAGGAAGTCTTCTAACATGCGGTGACGTGGAGGAGAATCCC GGCCCTAGGTTCGAAATGGTGAGCAAGGGCGAGGAGCTGTTCACCGGGGT GGTGCCCATCCTGGTCGAGCTGGACGGCGACGTAAACGGCCACAAGTTCA GCGTGTCCGGCGAGGGCGAGGGCGATGCCACCTACGGCAAGCTGACCCTG AAGTTCATCTGCACCACCGGCAAGCTGCCCGTGCCCTGGCCCACCCTCGT GACCACCTTGACCTACGGCGTGCAGTGCTTCGCCCGCTACCCCGACCACA TGAAGCAGCACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAG GAGCGCACCATCTTCTTCAAGGACGACGGCAACTACAAGACCCGCGCCGA GGTGAAGTTCGAGGGCGACACCCTGGTGAACCGCATCGAGCTGAAGGGCA TCGACTTCAAGGAGGACGGCAACATCCTGGGGCACAAGCTGGAGTACAAC TACAACAGCCACAAGGTCTATATCACCGCCGACAAGCAGAAGAACGGCAT CAAGGTGAACTTCAAGACCCGCCACAACATCGAGGACGGCAGCGTGCAGC TCGCCGACCACTACCAGCAGAACACCCCCATCGGCGACGGCCCCGTGCTG CTGCCCGACAACCACTACCTGAGCACCCAGTCCGCCCTGAGCAAAGACCC CAACGAGAAGCGCGATCACATGGTCCTGCTGGAGTTCGTGACCGCCGCCG GGATCACTCTCGGCATGGACGAGCTGTACAAGTGAGAGCTCCTCGACTGT GCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCT TGACCCTGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGAGGAA ATTGCATCGCATTGTCTGAGTAGGTGTCATTCTATTCTGGGGGGTGGGGT GGGGCAGGACAGCAAGGGGGAGGATTGGGAAGACAATAGCAGGCATGCGA TCG.

    [0086] Sequence at the 5′end junction between the insert and host genome is denoted as:

    TABLE-US-00011 (SEQ ID NO. 11) ACCCCACAGTGGGGCAAGCTTGGATCCTC and its complementary sequence.

    [0087] Sequence at the 3′end junction between the insert and host genome is denoted as:

    TABLE-US-00012 (SEQ ID NO. 12) CGATCGGCGGCCGCTACTAGGGACAGGATT and its complementarysequence.

    [0088] In one specific embodiment, an hiPSC line made by the method of the present invention has an exogenous nucleic acid sequence integrated at AAVS1 site. The nucleic acid sequence comprises a PGK-1 promoter, a puromycin gene, a CAG promoter, a mutant PS1 gene (PS1dE9), and a GFP gene and sequences that link different segments. The inserted nucleic acid sequence is described below (the underlined part is PS1dE9 gene):

    TABLE-US-00013 (SEQ ID NO. 13) ATAACTTCGTATAATGTATGCTATACGAAGTTATTACCGGGTAGGGGAGG CGCTTTTCCCAAGGCAGTCTGGAGCATGCGCTTTAGCAGCCCCGCTGGGC ACTTGGCGCTACACAAGTGGCCTCTGGCCTCGCACACATTCCACATCCCC CGGTAGGCGCCAACCGGCTCCGTTCTTTGGTGGCCCCTTCGCGCCACCTT CTACTCCTCCCCTAGTCAGGAAGTTCCCCCCCGCCCCGCAGCTCGCGTCG TGCAGGACGTGACAAATGGAAGTAGCACGTCTCACTAGTCTCGTGCAGAT GGACAGCACCGCTGAGCAATGGAAGCGGGTAGGCCTTTGGGGCAGCGGCC AATAGCAGCTTTGCTCCTTCGCTTTCTGGGCTCAGAGGCTGGGAAGGGGT GGGTCCGGGGGCGGGCTCAGGGGCGGGCTCAGGGGCGGGGCGGGCGCCCG AAGGTCCTCCGGAGGCCCGGCATTCTGCACGCTTCAAAAGCGCACGTCTG CCGCGCTGTTCTCCTCTTCCTCATCTCCGGGCCTTTCGGAATTCATGACC GAGTACAAGCCCACGGTGCGCCTCGCCACCCGCGACGACGTCCCCCGGGC CGTACGCACCCTCGCCGCCGCGTTCGCCGACTACCCCGCCACGCGCCACA CCGTCGACCCGGACCGCCACATCGAGCGGGTCACCGAGCTGCAAGAACTC TTCCTCACGCGCGTCGGGCTCGACATCGGCAAGGTGTGGGTCGCGGACGA CGGCGCCGCGGTGGCGGTCTGGACCACGCCGGAGAGCGTCGAAGCGGGGG CGGTGTTCGCCGAGATCGGCCCGCGCATGGCCGAGTTGAGCGGTTCCCGG CTGGCCGCGCAGCAACAGATGGAAGGCCTCCTGGCGCCGCACCGGCCCAA GGAGCCCGCGTGGTTCCTGGCCACCGTCGGCGTCTCGCCCGACCACCAGG GCAAGGGTCTGGGCAGCGCCGTCGTGCTCCCCGGAGTGGAGGCGGCCGAG CGCGCCGGGGTGCCCGCCTTCCTGGAGACCTCCGCGCCCCGCAACCTCCC CTTCTACGAGCGGCTCGGCTTCACCGTCACCGCCGACGTCGAGGTGCCCG AAGGACCGCGCACCTGGTGCATGACCCGCAAGCCCGGTGCCTGATAGAAC TTGTTTATTGCAGCTTATAATGGTTACAAATAAAGCAATAGCATCACAAA TTTCACAAATAAAGCATTTTTTTCACTGCATTCTAGTTGTGGTTTGTCCA AACTCATCAATGTATCTTATCATGTCTGATAACTTCGTATAATGTATGCT ATACGAAGTTATGCGGCCGCAATCGTCGACCTGCAGGCATGCAAGCTTAT TGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCA TAGCCCATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGC CTGGCTGACCGCCCAACGACCCCCGCCCATTGACGTCAATAATGACGTAT GTTCCCATAGTAACGCCAATAGGGACTTTCCATTGACGTCAATGGGTGGA GTATTTACGGTAAACTGCCCACTTGGCAGTACATCAAGTGTATCATATGC CAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCTGGCAT TATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTA CGTATTAGTCATCGCTATTACCATGGTCGAGGTGAGCCCCACGTTCTGCT TCACTCTCCCCATCTCCCCCCCCTCCCCACCCCCAATTTTGTATTTATTT ATTTTTTAATTATTTTGTGCAGCGATGGGGGCGGGGGGGGGGGGGGGCGC GCGCCAGGCGGGGCGGGGCGGGGCGAGGGGCGGGGCGGGGCGAGGCGGAG AGGTGCGGCGGCAGCCAATCAGAGCGGCGCGCTCCGAAAGTTTCCTTTTA TGGCGAGGCGGCGGCGGCGGCGGCCCTATAAAAAGCGAAGCGCGCGGCGG GCGGGAGTCGCTGCGCGCTGCCTTCGCCCCGTGCCCCGCTCCGCCGCCGC CTCGCGCCGCCCGCCCCGGCTCTGACTGACCGCGTTACTCCCACAGGTGA GCGGGCGGGACGGCCCTTCTCCTCCGGGCTGTAATTAGCGCTTGGTTTAA TGACGGCTTGTTTCTTTTCTGTGGCTGCGTGAAAGCCTTGAGGGGCTCCG GGAGGGCCCTTTGTGCGGGGGGAGCGGCTCGGGGGGTGCGTGCGTGTGTG TGTGCGTGGGGAGCGCCGCGTGCGGCTCCGCGCTGCCCGGCGGCTGTGAG CGCTGCGGGCGCGGCGCGGGGCTTTGTGCGCTCCGCAGTGTGCGCGAGGG GAGCGCGGCCGGGGGCGGTGCCCCGCGGTGCGGGGGGGCTGCGAGGGGAA CAAAGGCTGCGTGCGGGGTGTGTGCGTGGGGGGGTGAGCAGGGGGTGTGG GCGCGTCGGTCGGGCTGCAACCCCCCCTGCACCCCCCTCCCCGAGTTGCT GAGCACGGCCCGGCTTCGGGTGCGGGGCTCCGTACGGGGCGTGGCGCGGG GCTCGCCGTGCCGGGCGGGGGGTGGCGGCAGGTGGGGGTGCCGGGCGGGG CGGGGCCGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCGCGGCGGCCCC CGGAGCGCCGGCGGCTGTCGAGGCGCGGCGAGTCGCAGCCATTGCCTTTT ATGGTAATCGTGCGAGAGGGCGCAGGGACTTCCTTTGTCCCAAATCTGTG TGGAGCCGAAATCTGGGAGGCGCCGCCGCACCCCCTCTAGCGGGCGCGGG GCGAAGCGGTGCGGCGCCGGCAGGAAGGAAATGGGCGGGGAGGGCCTTCG TGCGTCGCCGCGCCGCCGTCCCCTTCTCCCTCTCCAGCCTCGGGGCTGTC CGCGGGGGGGCGGCTGCCTTCGGGGGGGACGGGGCAGGGCGGGGTTCGGC TTCTGGCGTGTGACCGGCGGCTCTAGAGCCTCTGCTAACCATGTTCATGC CTTCTTCTTTTTCCTACAGCTCCTGGGCAACGTGCTGGTTATTGTGCTGT CTCATCATTTTGGCAAAGAATTCCTCGACCTCGAGATGACAGAGTTACCT GCACCGTTGTCCTACTTCCAGAATGCACAGATGTCTGAGGACAACCACCT GAGCAATACTGTACGTAGCCAGAATGACAATAGAGAACGGCAGGAGCACA ACGACAGACGGAGCCTTGGCCACCCTGAGCCATTATCTAATGGACGACCC CAGGGTAACTCCCGGCAGGTGGTGGAGCAAGATGAGGAAGAAGATGAGGA GCTGACATTGAAATATGGCGCCAAGCATGTGATCATGCTCTTTGTCCCTG TGACTCTCTGCATGGTGGTGGTCGTGGCTACCATTAAGTCAGTCAGCTTT TATACCCGGAAGGATGGGCAGCTAATCTATACCCCATTCACAGAAGATAC CGAGACTGTGGGCCAGAGAGCCCTGCACTCAATTCTGAATGCTGCCATCA TGATCAGTGTCATTGTTGTCATGACTATCCTCCTGGTGGTTCTGTATAAA TACAGGTGCTATAAGGTCATCCATGCCTGGCTTATTATATCATCTCTATT GTTGCTGTTCTTTTTTTCATTCATTTACTTGGGGGAAGTGTTTAAAACCT ATAACGTTGCTGTGGACTACATTACTGTTGCACTCCTGATCTGGAATTTT GGTGTGGTGGGAATGATTTCCATTCACTGGAAAGGTCCACTTCGACTCCA GCAGGCATATCTCATTATGATTAGTGCCCTCATGGCCCTGGTGTTTATCA AGTACCTCCCTGAATGGACTGCGTGGCTCATCTTGGCTGTGATTTCAGTA TATGATTTAGTGGCTGTTTTGTGTCCGAAAGGTCCACTTCGTATGCTGGT TGAAACAGCTCAGGAGAGAAATGAAACGCTTTTTCCAGCTCTCATTTACT CCTGCACAGAAAGGGAGTCACAAGACACTGTTGCAGAGAATGATGATGGC GGGTTCAGTGAGGAATGGGAAGCCCAGAGGGACAGTCATCTAGGGCCTCA TCGCTCTACACCTGAGTCACGAGCTGCTGTCCAGGAACTTTCCAGCAGTA TCCTCGCTGGTGAAGACCCAGAGGAAAGGGGAGTAAAACTTGGATTGGGA GATTTCATTTTCTACAGTGTTCTGGTTGGTAAAGCCTCAGCAACAGCCAG TGGAGACTGGAACACAACCATAGCCTGTTTCGTAGCCATATTAATTGGTT TGTGCCTTACATTATTACTCCTTGCCATTTTCAAGAAAGCATTGCCAGCT CTTCCAATCTCCATCACCTTTGGGCTTGTTTTCTACTTTGCCACAGATTA TCTTGTACAGCCTTTTATGGACCAATTAGCATTCCATCAATTTTATATCT AGAGATCTGGCAGCGGAGAGGGCAGAGGAAGTCTTCTAACATGCGGTGAC GTGGAGGAGAATCCCGGCCCTAGGTTCGAAATGGTGAGCAAGGGCGAGGA GCTGTTCACCGGGGTGGTGCCCATCCTGGTCGAGCTGGACGGCGACGTAA ACGGCCACAAGTTCAGCGTGTCCGGCGAGGGCGAGGGCGATGCCACCTAC GGCAAGCTGACCCTGAAGTTCATCTGCACCACCGGCAAGCTGCCCGTGCC CTGGCCCACCCTCGTGACCACCTTGACCTACGGCGTGCAGTGCTTCGCCC GCTACCCCGACCACATGAAGCAGCACGACTTCTTCAAGTCCGCCATGCCC GAAGGCTACGTCCAGGAGCGCACCATCTTCTTCAAGGACGACGGCAACTA CAAGACCCGCGCCGAGGTGAAGTTCGAGGGCGACACCCTGGTGAACCGCA TCGAGCTGAAGGGCATCGACTTCAAGGAGGACGGCAACATCCTGGGGCAC AAGCTGGAGTACAACTACAACAGCCACAAGGTCTATATCACCGCCGACAA GCAGAAGAACGGCATCAAGGTGAACTTCAAGACCCGCCACAACATCGAGG ACGGCAGCGTGCAGCTCGCCGACCACTACCAGCAGAACACCCCCATCGGC GACGGCCCCGTGCTGCTGCCCGACAACCACTACCTGAGCACCCAGTCCGC CCTGAGCAAAGACCCCAACGAGAAGCGCGATCACATGGTCCTGCTGGAGT TCGTGACCGCCGCCGGGATCACTCTCGGCATGGACGAGCTGTACAAGTGA GAGCTCCTCGACTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCT CCCCCGTGCCTTCCTTGACCCTGGAAGGTGCCACTCCCACTGTCCTTTCC TAATAAAATGAGGAAATTGCATCGCATTGTCTGAGTAGGTGTCATTCTAT TCTGGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATTGGGAAGACA ATAGCAGGCATGCGATCG.

    [0089] Sequence at the 5′end junction between the insert and host genome is denoted as:

    TABLE-US-00014 (SEQ ID NO. 11) ACCCCACAGTGGGGCAAGCTTGGATCCTC and its complementary sequence

    [0090] Sequence at the 3′end junction between the insert and host genome is denoted as:

    TABLE-US-00015 (SEQ ID NO. 12) CGATCGGCGGCCGCTACTAGGGACAGGATT and its complementary sequence.

    [0091] In another embodiment, the inserted nucleic acid sequence may contain sequence that encodes any variant of BACE1 and/or any variant of PS1. The variants include, for instance, naturally-occurring variants due to allelic variations between individuals (e.g., polymorphisms), alternative splicing forms, etc. Variants are preferably substantially homologous to sequences according to the present invention, i.e., exhibit a nucleotide sequence identity of typically at least about 80%, preferably at least about 90%, more preferably at least about 95% with sequences of the present invention. Variants of the genes of the present invention also include nucleic acid sequences, which hybridize to a sequence as defined above (or a complementary strand thereof) under stringent hybridization conditions. Typical stringent hybridization conditions include temperatures above 42° C. and salinity of equal or less than 200 mM.

    Drug Screening Method

    [0092] In one embodiment the present disclosure relates to a process of using hiPSC lines created by the method of the present invention to screen therapeutic agents for treatment of AD. The process may include multiple steps of re-differentiating hiPSC line into functional neurons, administrating drug compounds into the neuron culture media, culturing neurons in presence of drug compounds for a period of time, and measuring beta-secretase level, Abeta-40 concentration, Abeta-42 concentration, and Abeta-42/Abeta-40 ratio, etc.

    [0093] The measurement of beta-secretase can be conducted by testing the expression of BACE1 gene at RNA and protein levels by conventional methods in the art.

    [0094] In one specific embodiment, a hiPSC line that over-expresses BACE1 gene will be used to produce large quantities of functional neurons. Neuronal cells derived from the hiPSC line will be cultured in a 96-well plate. Compounds to be screened will be added to the neurons culture for 2 days to 2 weeks. The effect of a compound on reduction of beta-secretase and/or Abeta-42 peptides will be measured in parallel.

    [0095] In another specific embodiment, an hiPSC line that over-expresses PS1dE9 gene will be used to produce large quantities of functional neurons. Neuronal cells derived from the hiPSC line will be cultured in a 96-well plate. Compounds to be screened will be added to the neurons culture for 2 days to 2 weeks. The effect of a compound on reduction of Abeta-42 peptides will be measured.

    [0096] In another embodiment, a hiPSC line that over-expresses any variant of BACE1 gene and/or any variant of PS1 gene at AAVS1 site will be used to produce large quantities of functional neurons. The variants include, for instance, naturally-occurring variants due to allelic variations between individuals (e.g., polymorphisms), alternative splicing forms, etc. Variants are preferably substantially homologous to sequences according to the present invention, i.e., exhibit a nucleotide sequence identity of typically at least about 80%, preferably at least about 90%, more preferably at least about 95% with sequences of the present invention. Variants of the genes of the present invention also include nucleic acid sequences, which hybridize to a sequence as defined above (or a complementary strand thereof) under stringent hybridization conditions. Typical stringent hybridization conditions include temperatures above 42° C. and salinity of equal or less than 200 mM.

    [0097] Reference will be made in detail to embodiments of the present disclosure. The embodiments described herein with reference to drawings are explanatory, illustrative, and used to generally understand the present disclosure. The embodiments shall not be construed to limit the present disclosure. The same or similar elements and the elements having same or similar functions are denoted by like reference numerals throughout the descriptions. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present invention will be limited only by the appended claims.

    EXAMPLES

    [0098] The examples are provided only with a purpose of illustration.

    Example 1: Generation of Parental hiPSC Lines for Genome Editing

    [0099] Two hiPSC lines, UCIS3007 and iPSN0041, were generated and used as parental hiPSC lines for making isogenic diseased hiPSC lines. UCIS3007 was derived from urine cells of a non-diseased female donor by a retrovirus vector-mediated reprogramming method that uses four transcription factors (Oct4, Sox1, Klf4, and cMyc). The donor urine epithelial cells were cultured with urine epithelial cell proliferation medium (CIB, cat #UC-0302). About 20,000 urine epithelial cells were inoculated into 12-well plates one day before the virus infection. The cells transfected with retroviral vectors were cultured with the hiPSC re-programming serum medium (CIB, Cat #. RE-0201). On day 6, the cells were plated onto a T25 flask containing feeder cells and treated with mitomycin C. About 10,000 cells were seeded in each T25 flask and cultured with reprogramming medium for about 20 days until hiPSC clones appears. Then, the clones were picked up onto Matrigel (Corning Cat #352477) coated plates for further purification and expansion.

    [0100] iPSN0041 was derived from umbilical cord matrix cells of a non-diseased donor by a footprint-free method using episomal vector with six transcription factors. About one million umbilical cord matrix cells were electrotransfered with episome plasmids (3 μg pCEP4-EO2S-EN2K, 2.4 μg pCEP4-M2L, 3.2 μg pCEP4-EO2S-1) mixed with a nuclear transfer reagent (Lonza, Cat. No. VPI-1005) using Amaxa Nucleofector kit II. The transfected cells were immediately inoculated into two T25 flasks coated with Matrigel (Corning Cat #352477), cultured with hiPSC reprogramming medium (CIB, Cat. No. RE-0202). The medium was changed to mTeSR1 on the 15th day after transfection and cultured for additional 7 days until hiPSC colonies appear. Clones with typical hiPSC morphology were selected for further purification and expansion.

    [0101] Characterization of hiPSC clones were followed the international standard (ref 43-44), including exogenous gene silencing and pluripotency marker expression detection, exogenous gene integration assays, promoter demethylation analysis, karyotyping test, differentiation potential test (embryoid body formation), teratoma test, and cell ID (STR) test (ref 43-44), etc. (FIGS. 1A-1F). In addition, the neural lineage differentiation potential for these two parental hiPSC lines was also validated before conducting genome editing work (FIG. 2).

    Example 2: Construction of Donor Vector and Targeting Vectors

    [0102] hiPSC genetic engineering was conducted using the most commonly used genome editing technology, CRISPR/Cas9 system. For targeted integration of AD-related genes into a safe harbor site (AAVS1 site), a specific CRISPR sgRNA vector targeted the AAVS1 site was constructed. sgRNA design and construction followed the method described in literature (ref 29). The target site of the BpiI enzyme is located on the vector and the recognition site is at the cleavage moiety. Therefore, the target site spacer sequence can be cloned into the vector by one step digestion. The vector contains 5′GTGG3′ and 5′GTTT3′ cohesive ends after digestion. By synthesizing the cohesive end of the CACC+target spacer sequence and the cohesive terminal AAAC+reverse complement sequence, sgRNA becomes a double stranded oligo sequence with additional cohesive ends, which can be connected to the cas9 vector. CRISPR-cas9 plasmid is generally constructed by a two-step method. The first step is to treat the synthesis of the cleavage site of oligo sequence. The second step is to ligate the treated oligo sequence with the CRISPR-Cas9 vector treated by restriction enzyme digestion.

    [0103] For donor construction, a backbone vector that comprises PGK-PURO-SV40PA, P2A-EGFP-BGHPA and CAG promoters, and a multiple cloning site (MSC) was generated first. To construct the final donor, five plasmids were generated: 1) T-HindIII-CAG-EcoRI; 2) T-SalI-P2A-EGFP-BGHPA-NotI; 3) T-HindIII-PGK-PURO-SV40PA-HindIII; 4) Synthetic PUC19-EcoRI-BACE1cds-SalI; and 5) PZD vector (Sigma-Aldrich). The first step is to digest plasmid 1, 2, 4, and 5, recover four fragments, HindIII-CAG-EcoRI-, -LALI-EGA-EGFP-BGHPA-NotI-, EcoRI-BACE1cds-SalI-, and HindIII-PZDonor-HindIII-, and then ligate all fragments together. After transformation into DH5α cell the positive clones were identified as the intermediate vector of PCBEB6. The final donor vector was generated by HindIII digestion and then ligation of PCBEB6 and T-HindIII-PGK-PURO-SV40PA-HindIII. This donor vector is named as CIB-PCBEB (FIG. 3A). All exogenous genes for over-expression at AAVS1 site was done by synthesizing the gene sequence with BglII and XhoI cleavage sites at both ends. The gene of interest is inserted into the vector by digestion of the vector with BglII and XhoI, and then ligation of the insert with the vector. The final donor plasmid was used to transform DH5α cell and then verified by sequencing. Donor constructs for over-expression of BACE1 gene and PS1dE9 gene were shown in FIGS. 3B and 3C.

    Example 3: Targeted Integration of AD-Related Genes at AAVS1 Site

    [0104] For introducing AD-related genes into AAVS1 site, parental hiPSC was cultured with mTeSR1 (Stemcell Technologies, cat. no. 05850) on a six well plate coated with Matrigel (Corning, Cat. no. 354277) at 37° C., 5% C02. Cells were harvested at 80% confluence and were co-transfected with Cas9-sgRNA plasmid and donor plasmid by electroporelation method (Amaxa Nucleofector II, program A-024). The number of cells for each transfection reaction was 0.5 to 1×10.sup.6, and the amount of plasmids was: Cas9-sgRNA 2.5 μg and donor plasmid 4 μg. The transfected cells were immediately inoculated into a six-well plate coated with Matrigel, incubated with mTeSR1 and 10 uM Y-27632 (Sigma, cat. No. Y0503). After 48-hour incubation, 0.5 μg/ml of Puromycin (Xiya Reagent, cat. No. 1014553) was added to culture media for 24 hours for drug selection. Single cell clones were prepared by inoculating Puromycin-resistant cells onto Matrigel-coated T25 flasks at a density of 1000 cells/ml, incubated with mTeSR1 and 10 uM Y-27632. Single-cell clones were picked up 10 days later with assistant of microscopy and then transferred to 96-well plates coated with Matrigel. Each clone was divided into two aliquots and was cultured on two 96-well plates, one for propagation and one for identification. To verify gene integration, cells were lysed by DNA lysis kit (QuickExtract™ DNA Extraction Solution 1.0, Epicentre, Cat. #QE09050) and then presence of insert was identified by junction PCR (FIG. 4B). Positive clones identified by junction PCR were further verified by sequencing (FIG. 4C). In addition, selected clones were also subjected to pluripotency test and karyotyping to eliminate variation introduced by the single cell cloning process (FIG. 4D). Two hiPSC lines that constitutively overexpress BACE1 and PS1dE9 gene were created using a similar strategy (FIG. 4A and FIG. 5A).

    Example 4: Large Scale Production of Neuronal Cells

    [0105] As described above, being able to make large quantities of AD-relevant human neurons consistently and reproducibly is pivotal for building a physiological cellular platform for drug screening. In the current art, differentiation of hiPSC into functional neurons involves a lengthy process and is subjected to a series of changes of culture conditions. Therefore, directly seeding hiPSC in 96-well plate to make neurons will result in huge well-to-well variation in terms of number and quality of differentiated neurons. Such large variation is not suitable for drug screening. To solve this problem, a step-wise process has been developed to control variations. The first step is to produce high quality neural stem cells (NSCs) from hiPSC. This step shortens the whole process from hiPSC to mature neuron by 6-8 weeks. Second step is to differentiate NSC into neuronal progenitor cell (NPC), which further reduces the differentiation time for making mature neurons. For production of NSC stock, hiPSC were inoculated on a 12-well plate containing Neural Induction Medium (Stemcell Technologies, Cat. No. 05835) and 10 uM Y-27632 (Sigma, Cat. No. Y0503). After 5 days, the embryoid body ball formed was spread on a 12-well plate coated with Matrigel, incubated in a CO.sub.2 incubator at 37° C., and changed daily with Neural Induction Medium. After 7 days, NSC-like rosette was picked and transferred into 24-well plates. The medium was replaced with NSC Proliferation Medium (CIB, Cat. No. NE-0603). After 7-8 days, NSC-like cells were picked up and transferred to 48-well plates. When NSC density reaches 90% confluence, transfer them into 6-well plates for further expansion and storage. For making functional neurons, about 8×10.sup.4/cm.sup.2 NSC were transferred to a 6-well plate coated with Poly-L-Ornithine (Sigma, Cat. No. P4957) and Laminin (Sigma, Cat. No. 2020) and cultured in Neuron Induction Medium (Stemcell Technologies, Cat. No. 08500). After 7 days, change the culture medium into Neuron Maturation Medium (Stemcell Technologies, Cat. No. 08510) and continue culture for 2-3 weeks. Mature neurons were verified by immunostaining of neuron-specific biomarkers such as Tuj1 (FIG. 6).

    Example 5: Over-Expression of Beta Scretase in Modified hiPSC Line

    [0106] As described above, two hiPSC lines have been made using the vectors created by the present invention. One hiPSC line (iPSN0041-21) contains a constitutively expressed BACE1 gene at AAVS1 site. For this line, expression of BACE1 gene at RNA and protein levels has been compared with those of its isogenic parental line (iPSN0041). For quantification of BACE1 mRNA expression, total RNA was extracted with TRIzol (Sigma, cat. No. T9424). qPCR was carried out using ABITM 7500 system and the fluorescent dye SYBR Premix EXTaqTMII (TaKaRa, cat. no. RR820A). The house keeping gene beta-actin was used as reference and each data point was average of three repeats. The result showed that BACE1 mRNA expression of iPSN0041-21 is much higher in iPSC and in iPSC-derived neurons compared to those of iPSN0041, indicating that the transgenic BACE1 gene is indeed constitutively over-expressed in iPSN0041-21 (FIG. 7A). Expression of BACE1 protein was carried out using an ELISA kit (Thermo Fisher, Cat. No. P0013). iPSN0041 and mature neurons were obtained using the method described above, the cells were lysed by protein lysis buffer (Biyuntian Biotechnology, Cat. No. P0013) and BACE1 protein concentration was measured using the ELISA kit according to manufacturer's instruction. Similar to the RNA result, BACE1 protein (Beta-secretase 1) level in iPSN0041-21 is significantly higher than that of the parental line iPSN0041 in hiPSC-derived NSC and neurons (FIG. 7B)

    Example 6: Expression of Abeta-42 Peptides in Modified hiPSC Line

    [0107] For Abeta-42 peptides detection, mature neurons were cultured in Neuron Maturation Medium (Stemcell Technologies, Cat. No. 08510) for up to 7 weeks. Supernatant was collected at 1 week intervals. Concentration of Abeta-42 peptides was measured using the Human/rat A42 ELISA kit (WAKO, Cat. No. 290-62601). For normalization, total protein from each collection was also measured (Thermo-Fisher, Pierce BCA Protein Assay Kit, Cat. No. 23225). As expected, a much higher expression of Abeta-42 peptides in iPSN0041-21 neuron culture was observed compared to those of iPSN0041 neurons (FIG. 8A). Further study over a six-week period of time showed that neurons derived from iPSN0041-21 have a different expression pattern compared to that of iPSN0041-derived neurons. Abeta-42 peptide level in iPSN0041-derived neurons (wild type) was very low at the first week of neuron culture and increased over time with a peak at the fifth week and decreased at the sixth week; whereas Abeta-42 expression in neurons derived from iPSN0041-21 was high at the first two weeks of neuron culture and decreased over time (FIG. 8B). Since neuronal cell culture in vitro for six weeks mimics the aging process of mature neurons, our observation suggested that for the wild type neurons, Abeta-42 level increased during the aging process of neurons, which is consistent with the disease mechanism for AD. The drop of Abeta-42 at sixth week might be due to neuron death in the culture. On the other hand, the high level expression of Abeta-42 in iPSN0041-21 neurons at early stage can be explained as over-expression of BACE1 transgene and the decrease in Abeta-42 expression after 3 weeks could be due to pre-mature neuron dysfunction or death as a result of too much beta-secretase. This observation suggested that elevated beta-secretase expression is harmful for neuron survival.

    Example 7: Screening of Drug Compounds Using Modified hiPSC Lines

    [0108] Large quantities of neuron progenitor cells (NPCs) have been produced from the modified hiPSC line IPSN0041-21. To conduct compound screening assay, NPCs were seeded in 96-well plates with a cell density at 50,000 cells/well. NPCs were cultured in Neuron Maturation Medium (Stemcell Technologies, Cat. No. 08510) for up to 4 weeks. Supernatant were collected at one-week intervals. Abeta-40 and Abeta-42 concentrations were measured at two, three, or four weeks using the Human/rat Aβ42 ELISA kit (WAKO, Cat. No. 290-62601). Compounds to be tested were added to neuron culture medium one week before measurement of Abeta-40 and Abeta-42 peptides. As shown in FIGS. 9A-9C, effect of two novel chemical compounds (B3 and B16) on Abeta peptide production were tested. The result showed that B3 and B16 reduce production of both Abeta-40 and Abeta-42 peptides, but did not affect the Abeta-42 vs. Abeta-40 ratio. One interesting notion was that the positive control, a commonly used beta-secretase inhibitor (Sigma-Aldrich, cat #S4562), disproportionally reduced production of Abeta-40 peptides as indicated by a higher Abeta-42 vs. Abeta-40 ratio compared to those of B3 and B16 treatment. This observation suggested that elevated expression of Abeta peptides in IPSN0041-21 due to over-expression of BACE1 gene indeed increases assay sensitivity of Abeta-40 and Abeta-42 peptides measurement, which allows differentiation of effect of potential drug compounds on different classes of Abeta peptides. In particularly, the system enables screening of compounds that are more effective for reduction of Abeta-42 production.

    CONCLUSION

    [0109] The present invention described creation of physiologically relevant cellular models for AD by over-expression of AD-related genes, e.g. BACE1 and PS1 and variants thereof in hiPSC. Several unique donor vectors have been created for targeted integration of AD-related genes at a safe harbor site (AAVS1) in human genome with high efficiency. Targeted integration of AD-related genes at AAVS1 site provides a safe and controlled transgene expression that overcomes drawbacks of commonly used random integration method, such as unknown copy numbers and potential disruption to endogenous genes. hiPSC lines created by those donor vectors display high level of beta-seretase activity and/or high level of Abeta-42 peptides that is the major component for amyloid plaque formation. A novel cellular assay platform has been established using neuronal cells derived from hiPSC lines over-expressing AD-related genes. Preliminary screening of potential drug candidate compounds indicated that the cellular platform created by the present invention offers clear advantages for screening new beta-seretase inhibitors and/or Abeta-42 peptides inhibitors compared to current art in the field.

    REFERENCE

    [0110] 1) Heritability of different forms of memory in the Late Onset Alzheimer's Disease Family Study . . . Journal of Alzheimer's Disease. 2011; 23(2):249-55. [0111] 2) Role of genes and environments for explaining Alzheimer disease. Arch. Gen. Psychiatry. 2006; 63(2):168-74. doi:10.1001/archpsyc.63.2.168. [0112] 3) Alzheimer's Disease. Lancet. 2006; 368(9533):387-403. doi:10.1016/S0140-6736(06)69113-7. [0113] 4) Genome-wide association studies in Alzheimer disease. Archives of Neurology. 2008; 65(3):329-34.doi:10.1001/archneur.65.3.329. [0114] 5) Selkoe D J. Translating cell biology into therapeutic advances in Alzheimer's disease. Nature. 1999; 399(6738 Suppl):A23-31. [0115] 6) Apolipoprotein E: high-avidity binding to beta-amyloid and increased frequency of type 4 allele in late-onset familial Alzheimer disease. Proceedings of the National Academy of Sciences of the United States of America. 1993; 90(5):1977-81. [0116] 7) Apolipoprotein E4: a causative factor and therapeutic target in neuropathology, including Alzheimer's disease. Proceedings of the National Academy of Sciences of the United States of America. 2006; 103(15):5644-51. [0117] 8) Variant of TREM2 associated with the risk of Alzheimer's disease. The New England Journal of Medicine. 2012; 368(2):107-16. [0118] 9) TREM2 variants in Alzheimer's disease. The New England Journal of Medicine. 2012; 368(2):117-27. [0119] 10) Tanzi, R. E. & Bertram, L. Twenty years of the Alzheimer's disease amyloid hypothesis: a genetic perspective. Cell 120: 545-555 (2005). [0120] 11) Michel, G. et al. A Century of Alzheimer's Disease. Science 314: 777-781 (2006). [0121] 12) Crews, L. & Masliah, E. Molecular mechanisms of neurodegeneration in Alzheimer's disease. Hum. Mol. Genet. 19 (R1): R12-R20 (2010). [0122] 13) Muratore, C. R. et al. The familial Alzheimer's disease APPV717I mutation alters APP processing and Tau expression in iPSC-derived neurons. Hum Mol Genet. 23 (13): 3523-3536(2014). [0123] 14) Musiek, E. S. & Holtzman, D. M. Three Dimensions of the Amyloid Hypothesis: Time, Space, and “Wingmen”. Nat Neurosci 18(6): 800-806 (2016). [0124] 15) Fukumoto, H. et al. Beta-secretase protein and activity are increased in the neocortex in Alzheimer disease. Arch Neurol 59: 1381-9 (2002). [0125] 16) Yang, L. B. et al. Elevated beta-secretase expression and enzymatic activity detected in sporadic Alzheimer disease. Nat Med. 9: 3-4 (2003). [0126] 17) Li, R. et al. Amyloid beta peptide load is correlated with increased beta-secretase activity in sporadic Alzheimer's disease patients. Proc. Natl Acad. Sci. USA 101: 3632-3637(2004). [0127] 18) Willem M, Garratt A N, Novak B, Citron M, Kaufmann S, Rittger A, DeStrooper B, Saftig P, Birchmeier C, Haass C (October 2006). “Control of peripheral nerve myelination by the beta-secretase BACE1”. Science. 314 (5799): 664-6. [0128] 19) Evin, G. & Hinc, C. BACE1 as a therapeutic target in Alzheimer's disease: rationale and current status. Drugs Aging 30(10): 755-64 (2013). [0129] 20) Ghosh, A. K., Brindisi, M. & Tang, J. Developing β-secretase inhibitors for treatment of Alzheimer's disease. J Neurochem 120(Suppl 1): 71-83 (2013). [0130] 21) Ghosh, A. K. & Tang, J. Prospects of β-Secretase Inhibitors for the Treatment of Alzheimer's Disease. Chem Med Chem 10(9): 1463-1466 (2015). [0131] 22) Menting, K. W. & Claassen, J. A. H. R. β-secretase inhibitor; a promising novel therapeutic drug in Alzheimer's disease. Front Aging Neurosci 6: 165 (2014). [0132] 23) Nie, Q., Du, X. G. & Geng, M. Y. Small molecule inhibitors of amyloid β peptide aggregation as a potential therapeutic strategy for Alzheimer's disease. Acta Pharmacologica Sinica 32: 545-551 (2011). [0133] 24) Habchi, J. et al. Systematic development of small molecules to inhibit specific microscopic steps of Aβ42 aggregation in Alzheimer's disease. Proc. Natl Acad. Sci. USA 114:E200-E208(2016). [0134] 25) Crunkhorn, S. Identification of novel A inhibitors. Nature Reviews Drug Discovery 16: 88 (2017). [0135] 26) Vassar, R. BACE1 inhibitor drugs in clinical trials for Alzheimer's disease. Alzheimer's Research & Therapy 6: 89 (2014). [0136] 27) Higgins, G. A. & Jacobsen, H. Transgenic mouse models of Alzheimer's disease: phenotype and application. Behavioural Pharmacology 14: 419-438 (2003). [0137] 28) Takahashi, K. & Yamanaka, S. Induction of Pluripotent Stem Cells from Mouse Embryonic and Adult Fibroblast Cultures by Defined Factors. Cell 126 (4): 663-676 (2006). [0138] 29) Takahashi, K. et al. Induction of pluripotentstem cells from adult human fibroblasts by defined factors. Cell 131 (5): 861-872 (2007). [0139] 30) Yagi, T. et al. Modeling familial Alzheimer's disease with induced pluripotent stem cells. Hum. Mol. Genet. 20: 4530-4539 (2011). [0140] 31) Israel, M. A. et al. Probing sporadic and familial Alzheimer's disease using induced pluripotent stem cells. Nature 482: 216-220 (2012). [0141] 32) Young, J. E. & Goldstein, L. S. B. Alzheimer's disease in a dish: promises and challenges of human stem cell models. Hum. Mol. Genet. 21(R1): R82-R89 (2012). [0142] 33) Kondo, T. et al. Modeling Alzheimer's disease with iPSCs reveals stress phenotypes associated with intracellular Ab and differential drug responsiveness. Cell Stem Cell 12:487-496(2013). [0143] 34) Muratore, C. R. et al. The familial Alzheimer's disease APPV717I mutation alters APP processing and Tau expression in iPSC-derived neurons. Hum. Mol. Genet. 23: 3523-3536(2014). [0144] 35) Sproul, A. A. et al. Characterization and molecular profiling of PSEN1 familial Alzheimer's disease iPSC-derived neural progenitors. PLoS ONE 9: e84547 (2014). [0145] 36) Young, J. E. et al. Elucidating molecular phenotypes caused by the SORL1 Alzheimer's disease genetic risk factor using human induced pluripotent stem cells. Cell Stem Cell 16 (4): 373-385 (2015). [0146] 37) Okabe M, Ikawa M, Kominami K, Nakanishi T, Nishimune Y. ‘Green mice’ as a source of ubiquitous green cells. FEBS Lett. 1997 May 5; 407(3):313-9. [0147] 38) Alexopoulou A N, Couchman J R, and Whiteford J R. The CMV early enhancer/chicken beta actin (CAG) promoter can be used to drive transgene expression during the differentiation of murine embryonic stem cells into vascular progenitors. BMC Cell Biology 9: 2, 2008. [0148] 39) M W McBurney, L C Sutherland, C N Adra, B Leclair, M A Rudnicki, and K Jardine, The mouse Pgk-1 gene promoter contains an upstream activator sequence, Nucleic Acids Res. 1991 Oct. 25; 19(20):5755-5761. [0149] 40) Hsu, P. D., Lander, E. S. and Zhang, F. Development and Applications of CRISPR-Cas9 for Genome Engineering. Cell 157: 1262-1278 (2014). [0150] 41) Cong, L. et al. Multiplex Genome Engineering Using CRISPR/Cas Systems. Science 339 (6121):819-823 (2013). [0151] 42) Ran, F. A. et al. Genome engineering using the CRISPR-Cas9system. Nature Protocols 8:2281-2308(2013). [0152] 43) Wang, J. et al. Generation of clinical-grade human pluripotent stem cells in Xeno-free conditions. Stem Cell Research & Therapy, (6): 223 (2015). [0153] 44) Zhou, T. et al. Generation of human induced pluripotent stem cells from urine samples. Nat Protoc. 7(12): 2080-2089 (2012).