PROTEIN AND PEPTIDE BIOMARKERS FOR TRAUMATIC INJURY TO THE CENTRAL NERVOUS SYSTEM
20210270847 · 2021-09-02
Inventors
- Kevin Ka-Wang Wang (Gainesville, FL)
- George Anis SARKIS (Lexington, MA, US)
- Manasi KAMAT (Gainesville, FL, US)
- Hamad YADIKAR (Gainesville, FL, US)
- Ahmed MOGHIEB (Royersford, PA, US)
Cpc classification
G01N2800/2871
PHYSICS
International classification
Abstract
The invention relies on detection of specific identified proteins, protein breakdown products, and peptide fragments, to diagnose and evaluate traumatic brain injury, spinal cord injury, and any traumatic injury to the CNS in a subject. These analytes (proteins, protein breakdown products thereof, and peptide fragments thereof) are released from injured tissue into blood and/or cerebrospinal fluid, and can be used to identify the central nervous system cell types (i.e. neuron, astrocyte, oligodendrocyte, and the like) or subcellular structure (e.g., axon, dendrites, presynaptic terminal, post-synaptic terminal, and extracellular matrix) affected, and to determine the diagnosis, location, and severity of the injury. Time course measurements of these analytes measured at different times after an injury or suspected injury also are used as tools for diagnosis and prognosis of central nervous system injury. Proteins, protein breakdown products, and peptide fragments are claimed, as well as kits and methods for their use.
Claims
1. A method of diagnosing trauma to the central nervous system in a subject in need thereof, comprising: testing a first fluid biological sample obtained from the subject for the level of at least two proteins, or their protein breakdown products (about 85%, or less, the size of the intact proteins and greater than 10 kDa) and lower molecular weight peptide fragments (ranging from 500 Da to 10 kDa) selected from the group consisting of (a) Neurogranin-protein breakdown products, or peptide fragment (b) Tau-758 (Tau-G) isoform; (c) Tau-441 (Tau-F)N- or C-terminal peptide fragment (d) Synapsin (Synapsin I, Synapsin II, Synapsin III); (e) Vimentin; (f) GFAP-C- and N-terminal peptide fragments (g) Golli-Myelin Basic Protein (MBP) (without or with classic MBP); (h) MAP6; (i) Complement protein (C1q (a, b, c components), C3, C5, C1s, CR1, CR2, C1QRF) wherein levels of the at least two proteins or their protein breakdown products, or peptide fragments that are at least two-fold higher in the fluid biological sample from the subject than the levels of the at least two proteins or protein breakdown products in a fluid biological sample from an uninjured subject indicate the presence of a central nervous system injury.
2. The method of claim 1 wherein the at least two peptide fragments are selected from the group consisting of: Phospho-Neurogranin peptide (position 16-64) ILDIPLDDPGANAAAAKIQAS(p)*FRGHMARKKIKSGERGRKGPGPGGPGGA (*(p)=phospho-Serine)(SEQ ID NO: 482), Neurogranin peptide (position 16-64) ILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGA (SEQ ID NO: 483), Neurogranin peptide (position 57-75) GPGGPGGAGVARGGAGGGP (SEQ ID NO: 450), Golli-MBP N-terminal peptide HGSKYLATASTMD (SEQ ID NO: 494), Golli-MBP internal peptide NAWQDAHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDE (SEQ ID NO: 499) Tau-G (P10636-9; 776 aa)-specific peptide (internal) [411-457] SPKHPTPGSSDPLIQPSSPAVCPEPPSSPKYVSSVTSRTGSSGAKEM (SEQ ID NO: 477) Tau-441 (P10636-8, 441 aa)N-terminal peptide [2-21] AEPRQEFEVMEDHAGTYGLG_(SEQ ID NO: 471) Tau-441 (P10636-8, 441 aa)C-terminal peptide [421-438] SPQLATLADEVSASLAK (SEQ ID NO: 474); GFAP N-terminal peptide [12-33] RSYVSSGEMMVGGLAPGRRLGP (SEQ ID NO: 502), GFAP C-terminal peptide [388-400] QIRETSLDTKSVSE (SEQ ID NO: 81), GFAP C-terminal peptide [417-423] DGEVIKES (SEQ ID NO:506); Vimentin N-terminal peptide [1-75] MSTRSVSSSS YRRMFGGPGT ASRPSSSRSY VTTSTRTYSL GSALRPSTSR SLYASSPGGV YATRSSAVRL RSSVP (SEQ ID NO: 492), Vimentin C-terminal peptide [400-464] YRKLLEGEESR ISLPLPTFSS LNLRETNLES LPLVDTHSKR TLLIKTVETR DGQVINETSQ HHDD (SEQ ID NO: 490), Classic MBP peptide [isoform−1; 115-125] KNIVTPRTPPP (SEQ ID NO: 195), Classic MBP peptide, [isoform−5; 105-140] GRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRF (SEQ ID NO: 162; SEQ ID NO: 347) Classic MBP peptide [isoform-1; 107-116] TQDENPVVHF (SEQ ID NO: 322)
3. A method of diagnosing trauma to the central nervous system in a subject in need thereof, comprising: testing a first fluid biological sample obtained from the subject for the level of a Phospho-Neurogranin peptide (position 16-64) ILDIPLDDPGANAAAAKIQAS(p)FRGHMARKKIKSGERGRKGPGPGGPGGA (SEQ ID NO: 482); and/or a Neurogranin peptide (position 16-64) ILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGA (SEQ ID NO: 483) wherein levels of the Phospho-Neurogranin peptide and/or Neurogranin peptide that are at least two-fold higher in the fluid biological sample from the subject than the levels in a fluid biological sample from an uninjured subject indicate the presence of a central nervous system injury.
4. The method of claim 1, claim 2 or claim 3 wherein the first fluid biological sample is obtained from the subject within 24 hours of the trauma to the central nervous system.
5. The method of claim 1, claim 2 or claim 3 wherein the first fluid biological sample is obtained from the subject within 3 days of the trauma to the central nervous system.
6. The method of claim 1, claim 2 or claim 3 wherein one or more additional fluid biological samples are obtained from the subject at subsequent times to the first fluid biological sample.
7. The method of claim 1, claim 2 or claim 3 wherein the testing comprises subjecting the fluid biological samples are subjected to ultrafiltration using a ultrafiltration membrane filter with a molecular weight cutoff of about 10,000 Da to separate an ultrafiltrate fraction and then subjecting the ultrafiltrate fraction to assay for proteins, protein breakdown products or peptide fragments.
8. The method of claim 1, claim 2 or claim 3 wherein an increasing level of the at least two proteins, protein breakdown products, or peptide fragments in fluid biological samples taken at subsequent times indicates worsening of the severity of the central nervous system injury.
9. The method of claim 1, claim 2 or claim 3 wherein a decreasing level of the at least two proteins, protein breakdown products, or peptide fragments in fluid biological samples taken at subsequent times indicates improvement in the central nervous system injury.
10. The method of claim 1, claim 2 or claim 3 wherein an unchanging level of the at least two proteins, protein breakdown products, or peptide fragments in fluid biological samples taken at subsequent times indicates a leveling of the severity of the central nervous system injury.
11. The method of claim 1, claim 2 or claim 3 wherein the testing will additionally examine the anatomical location of trauma to the central nervous system in a subject in need thereof, comprising additional testing a fluid biological sample obtained from the subject for the presence of any combination of: (a) one or more cortexin proteins, protein breakdown products, or peptide fragments, the presence of which above control levels identifies the cortex as the anatomical location; (b) one or more myelin basic protein proteins, protein breakdown products, or peptide fragments, the presence of which above control levels identifies the white matter as the anatomical location; and (c) one or more striatin proteins, protein breakdown products, or peptide fragments, the presence of which above control levels identifies the striatum as the anatomical location.
12. The method of claim 1, claim 2 or claim 3 wherein the testing will additionally examine cell types injured in trauma to the central nervous system in a subject in need thereof, comprising testing a fluid biological sample obtained from the subject for the presence of any combination of: (a) one or more protein, or protein breakdown product of brain acidic soluble protein−1, glutamate decarboxylase 1, glutamate decarboxylase 2, neurochondrin or any combination thereof, the presence of which above control levels identifies the cell type as neurons; (b) one or more protein, or protein breakdown product of GFAP or Vimentin, the presence of which above control levels identifies the cell type as astroglia; or (c) one or more protein, or protein breakdown product of myelin basic protein 5 or Golli-myelin basic protein, the presence of which above control levels identifies the cell type as oligodendrocytes.
13. The method of claim 1, claim 2 or claim 3 wherein the testing will additionally examine the subcellular location of injury to the central nervous system after trauma in a subject in need thereof, comprising testing a fluid biological sample obtained from the subject for the presence of any combination of: (a) one or more protein, or protein breakdown product of neurexin-1, neurexin-2, neurexin-3, synapsin-I, synapsin-II, synapsin-III or any combination thereof, the presence of which above control levels identifies the subcellular location as the presynaptic terminal; (b) one or more protein, or protein breakdown product of neurogranin, the presence of which above control levels identifies the subcellular location as the post-synaptic terminal; (c) one or more protein, or protein breakdown product of brain acidic soluble protein 2, growth associated protein 43 or a combination thereof, the presence of which above control levels identifies the subcellular location as the growth cone; (d) one or more protein, or protein breakdown product of nesprin-1, the presence of which above control levels identifies the subcellular location as the neuronal nucleus; (e) one or more protein, or protein breakdown product of Calmodulin regulated spectrin-associated protein 1, Calmodulin regulated spectrin-associated protein 2, Calmodulin regulated spectrin-associated protein 3, or any combination thereof, the presence of which above control levels identifies the subcellular location as the cortical cytoskeleton and axon; (f) one or more protein, or protein breakdown product of microtubule associated protein 6, the presence of which above control levels identifies the subcellular location as dendrites; or (g) one or more protein, or protein breakdown product of chondroitin sulfate proteoglycan 4, neurocan, brevican or any combination thereof, the presence of which above control levels identifies the subcellular location as the extracellular matrix.
14. A method of diagnosing the severity of trauma to the central nervous system in a subject in need thereof, comprising the steps of: (a) testing a first fluid biological sample obtained from the subject up to 3 days after central nervous system injury for the levels of one or more proteins, protein breakdown products, and peptide fragments selected from claim 1, claim 2 or claim 3 (b) testing a second subsequent fluid biological sample obtained from the subject subsequent to the first fluid biological sample for the levels of the same one or more proteins, protein breakdown products, and peptide fragments as step (a); (c) optionally testing further subsequent fluid biological samples for the levels of the same one or more proteins, protein breakdown products, and peptide fragments as step (a); (d) comparing the levels of the one or more proteins, protein breakdown products, and peptide fragments in the fluid biological samples to a control sample from an uninjured subject and to each other; and (e) when the levels of peptide breakdown products in the fluid biological samples increase in subsequent samples, diagnosing a severe central nervous system injury.
15. A method of distinguishing severe trauma to the central nervous system with pathoanatomical lesions detectable by CT, MRI, or both, from less severe central nervous system trauma with no detectable pathoanatomical lesions in a subject in need thereof, comprising: (a) testing at least one first fluid biological sample obtained from the subject within 24 hours after central nervous system injury for the levels of one or more peptide fragments of a protein selected from claim 1, claim 2 or claim 3; (b) testing a second subsequent fluid biological sample obtained from the subject about 2 days to about 6 months subsequent to the first fluid biological sample for the levels of the same one or more peptide fragments as step (a); (c) comparing the levels of the same one or more peptide fragments in the first and second fluid biological samples to a control sample from an uninjured subject and to each other; and (d) when the levels of the same one or more peptide fragments in the first fluid biological sample are above those in the control sample but decrease in the second fluid biological samples, diagnosing an acute central nervous system injury; and when the levels of the same one or more peptide fragments in the first fluid biological samples are above those in the control sample and increase or remain constant in subsequent samples, diagnosing a chronic central nervous system injury.
16. The method of claim 1, claim 2 or claim 3 wherein the trauma is cortical impact, closed head injury, blast overpressure induced brain injury, concussion or spinal cord injury.
17. The method of claim 1, claim 2 or claim 3 wherein the fluid biological sample is cerebrospinal fluid, blood, plasma, serum, saliva, urine, wound fluid, or biopsy, necropsy or autopsy samples of brain tissue, spinal tissue, retinal tissue, and/or nerves.
18. A diagnostic kit comprising: (a) detection agents for antibody, aptamer or mass spectrometry detection methods for detection of one or more peptide fragments selected from the group consisting of Phospho-Neurogranin peptide (position 16-64) ILDIPLDDPGANAAAAKIQAS (p)FRGHMARKKIKS GERGRKGPGPGGPGGA (*(p) phospho-Serine) (SEQ ID NO: 482), Neurogranin peptide (position 16-64) ILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGA (SEQ ID NO: 483), Neurogranin peptide (position 57-75) GPGGPGGAGVARGGAGGGP (SEQ ID NO: 450), Golli-MBP N-terminal peptide HGSKYLATASTMD (SEQ ID NO: 494), Golli-MBP internal peptide NAWQDAHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDE (SEQ ID NO: 499) Tau-G (P10636-9; 776 aa)-specific peptide (internal) [411-457] SPKHPTPGSSDPLIQPSSPAVCPEPPSSPKYVSSVTSRTGSSGAKEM (SEQ ID NO: 477) Tau-441 (P10636-8, 441 aa)N-terminal peptide [2-21] AEPRQEFEVMEDHAGTYGLG (SEQ ID NO: 471) Tau-441 (P10636-8, 441 aa)C-terminal peptide [421-438] SPQLATLADEVSASLAK (SEQ ID NO: 474); GFAP N-terminal peptide [12-33] RSYVSSGEMMVGGLAPGRRLGP (SEQ ID NO: 502), GFAP C-terminal peptide [388-400] QIRETSLDTKSVSE (SEQ ID NO: 81), GFAP C-terminal peptide [417-423] DGEVIKES (SEQ ID NO:506); Vimentin N-terminal peptide [1-75] MSTRSVSSSS YRRMFGGPGT ASRPSSSRSY VTTSTRTYSL GSALRPSTSR SLYASSPGGV YATRSSAVRL RSSVP_(SEQ ID NO: 492), Vimentin C-terminal peptide [400-464] YRKLLEGEESR ISLPLPTFSS LNLRETNLES LPLVDTHSKR TLLIKTVETR DGQVINETSQ HHDD (SEQ ID NO: 490), Classic MBP Peptide [isoform−1; 115-125] KNIVTPRTPPP (SEQ ID NO: 195), Classic MBP peptide, [isoform−5; 105-140] GRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRF (SEQ ID NO: 162; SEQ ID NO: 347) Classic MBP peptide [isoform-1; 107-116] TQDENPVVHF (SEQ ID NO: 322) (b) an analyte protein, protein breakdown product, or peptide fragment to serve as internal standard and/or positive control; and (c) a signal generation coupling component.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0030] The following figures are included to further demonstrate certain non-limiting embodiments of the present invention. The invention may be better understood by reference to one or more of these drawings in combination with the detailed description of specific embodiments presented herein.
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
TABLE-US-00003 SEQ ID NO: 83 [M].AEPRQEFEVMEDHAGTY.[G],; SEQ ID NO: 84 [M].AEPRQEFEVMEDHAGTYG.[L],; SEQ ID NO: 85 [E].PRQEFEVMEDHAGTYG.[L],; SEQ ID NO: 86 [G].DRKDQGGYTMHQDQEGSEEPGSETSDAK.[S],; SEQ ID NO: 87 [K].ESPLQTPTEDGSEEPGSETSDAK.[S],; SEQ ID NO: 88 [A].AAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVT.[Q],; SEQ ID NO: 89 [A].AQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVT.[Q],; SEQ ID NO: 90 [T].EIPEGTTAEEAGIGDTPSLEDEAAGHVT.[Q],; SEQ ID NO: 91 [T].EIPEGTTAEEAGIGDTPSLEDEAAGHVTq.[A],; SEQ ID NO: 92 [G].TTAEEAGIGDTPSLEDEAAGHVT.[Q],; SEQ ID NO: 93 [Q].TAPVPMPDLK.[N],; SEQ ID NO: 94 [T].APAVPMPDLK.[N],; SEQ ID NO: 95 [D].LSVTSKCGSLG.[N],; SEQ ID NO: 96 [K].SEKLDFKDRVQ.[S],; SEQ ID NO: 97 [F].RENAKAKTDHGAEIVYKSPVVSGDT.[S],; SEQ ID NO: 98 [N].AKAKTDHGAEIVYKSPVVSGDT.[S],; SEQ ID NO: 99 [A].KAKTDHGAEIVYKSPVVSGDT.[S],; SEQ ID NO: 100 [K].TDHGAIVYKSPVVSGDT.[S],; SEQ ID NO: 101 [G].AEIVYKSPVVSGDT.[S],; SEQ ID NO: 102 [T].SPRHLSNVSSTGSIDMVDSPQLATLADEVS.[A],; SEQ ID NO: 103 [T].SPRHLSNVSSTGSIDMVDSPQLA.[T],; SEQ ID NO: 104 [S].STGSIDMVDSPQLA.[T],; and [S].ASLAKQGL.[-].
[0049] digestion. The sequences in the order shown are
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
[0081]
[0082]
[0083]
[0084]
[0085]
DETAILED DESCRIPTION
1. Definitions
[0086] Unless otherwise defined, all technical and scientific terms used herein are intended to have the same meaning as commonly understood in the art to which this invention pertains and at the time of its filing. Although various methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, suitable methods and materials are described below. However, the skilled should understand that the methods and materials used and described are examples and may not be the only ones suitable for use in the invention. Moreover, it should also be understood that as measurements are subject to inherent variability, any temperature, weight, volume, time interval, pH, salinity, molarity or molality, range, concentration and any other measurements, quantities or numerical expressions given herein are intended to be approximate and not exact or critical figures unless expressly stated to the contrary. Hence, where appropriate to the invention and as understood by those of skill in the art, it is proper to describe the various aspects of the invention using approximate or relative terms and terms of degree commonly employed in patent applications, such as: so dimensioned, about, approximately, substantially, essentially, consisting essentially of, comprising, and effective amount. Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art.
[0087] As used herein, the terms “protein breakdown product” or “PBP” refer to a high molecular weight product of protein proteolysis, produced by one or more cleavages of a peptide bonds in the amino acid sequence, i.e., a product of protein cleavage, including chains of any length shorter than the native full-length sequence and longer than about 10,100 Da. The terms “peptide fragment,” or “PF” refer to a low molecular weight products of protein proteolysis, produced by one or more cleavages of a peptide bonds in the amino acid sequence, i.e., a product of protein cleavage. In one example, PFs may include fragments of the intact protein having 85 percent or less the size of the intact protein and greater than 10,000 Da. In another embodiment, PFs may include smaller fragments, i.e. including chains of any length shorter than about 10,000 Da, or 10,100 Da, or such peptide fragments that are able to pass through an ultrafiltration membrane with an approximate 10,000 Da cutoff, including PFs in the range of about 1,000 Da to about 10,000 Da, preferably about 2,000 to 8,000 Da, and most preferably about 2,000 to 5,000 Da. In general, a peptide fragment (PF), as used in this application, refers to an amino acid chain small enough to pass through an ultrafiltration membrane with an approximate 10,000 Da cutoff. As used herein, the term “analyte” and all of its cognates refers to any and all of the proteins, PBPs, or PFs that are analyzed or detected according to this invention.
[0088] The PFs and PBPs of the invention are referenced in this application by sequence, amino acid residue number from a protein, or by name. The invention, however, is intended to include peptides that are variants of these particular disclosed sequences. For example, minor differences such as deletion of one or two C- or N-terminal amino acids (or both) of the sequence are contemplated for use with the invention as peptide variants. Other minor differences such a an addition of one or two C- or N-terminal amino acids (or both) of the sequence likewise are contemplated for use with the invention. Minor differences which are caused by variable sequences of the protein, also are contemplated as part of the invention, including differences caused by natural differences in the protein sequence among species or among individuals are intended to be included in certain embodiments of the invention, as well.
[0089] As used herein, the phrase “trauma to the central nervous system,” “CNS trauma,” or “traumatic brain injury” includes any sudden injury to the brain, retina, spinal cord, or any part thereof, and includes injury to the projections (e.g., axons, dendrites, neurites) and subcellular parts of cells of the central nervous system due to trauma such as a physical impact or force, or a blast overpressure wave. Examples of CNS trauma include traumatic brain injury (TBI) or traumatic spinal cord injury (SCI). Much of the time, the injury will be the direct result of a traumatic injury, however the invention contemplates uses for injury or destruction of central nervous system tissue and/or cells indirectly caused by trauma, including but not limited to inflammation induced by trauma, swelling induced by trauma, or degenerative disease induced by trauma (such as CTE, Alzheimer's disease, Parkinsonianism, and the like).
[0090] As used herein, the term “subject in need” or “subject in need thereof” refers to any animal or a human subject that has been subjected to or suffers from a central nervous system trauma, or is suspected of suffering from a central nervous system injury as a result of trauma.
[0091] As used herein, the term “fluid biological sample” refers to a liquid or liquified sample obtained from a subject in need, and includes cerebrospinal fluid, whole blood, plasma, serum, wound fluid, and biopsy or autopsy samples of brain tissue, spinal tissue, retinal tissue, and/or nerves, such as tissue lysates. The samples preferably are prepared for analysis by, for example, centrifugation and/or filtration, preferably by ultrafiltration.
[0092] As used herein, in the term “testing a fluid biological sample of the subject for the level” and the term “levels” in the context of test results, “level” refers to the amount or concentration of a target analyte such as a peptide in a fluid biological sample.
[0093] As used herein, in the term “anatomical location” refers to a major central nervous system area, such as cortex, hippocampus, striatum, corpus callosum, cerebellum, retina, spinal cord, and the like, but also to cell type such as neuron, glia, astrocyte and the like, and to subcellular regions such as axon, dendrite, extracellular matrix, neuronal nucleus, cortical cytoskeleton and the like.
[0094] It is to be understood that in instances where a range of values are provided that the range is intended to encompass not only the end point values of the range but also intermediate values of the range as explicitly being included within the range and varying by the last significant figure of the range. By way of example, a recited range of from 1 to 4 is intended to include 1-2, 1-3, 2-4, 3-4, and 1-4.
2. Overview
[0095] It was discovered that brain proteins from different central nervous system (CNS) cell types are proteolytically broken down after brain injury into PBP and PF. PBP and PF are released from injured tissue into biofluid, typically cerebrospinal fluid and blood. These proteolytic events are brain injury-mediated and are not found in biofluids of subjects that have not had a traumatic brain injury (TBI).
[0096] The present invention identifies a multitude of full-length proteins, PBPs and PFs are produced after traumatic brain injury and released into biological fluids. These compounds can be used to identify specific anatomical regions of the brain and subcellular structures affected, and for diagnostic and prognostic tests. The marker PFs and PBPs are identified from fluid biological samples such as cerebrospinal fluid (CSF), serum, plasma or blood samples. Use of methods such as mass spectrometry identifies unique fragments from proteins damaged from traumatic brain injury.
[0097] Unique PBPs and PFs are identified which can locate brain damage to specific brain regions such as the cortex, striatum, white matter and the like. Damage can be linked to brain cell types such as neurons, astrocytes, and oligodendrocytes as well as subcellular structures such as axons, dendrites, growth cones, cortical cytoskeleton, intermediate filaments and extracellular matrix.
[0098] Brain-specific or specifically brain-enriched proteins from various CNS cell types (including neuron, astrocyte, oligodendrocytes) and extracellular matrix are released and also are proteolytically broken down into PBPs and PFs of large and small sizes as a result of trauma to the central nervous system and are released from the injured tissue into biofluids, such as cerebrospinal fluid and blood, where they can be measured. Since these proteolytic events are brain injury-mediated, these PBP and PF can be used as injury-specific biomarkers, as well as the proteins. This was supported by the identification in the present application of unique PBPs and PFs. The presence and amount of combinations of these markers allows one to determine the presence of damage or injury to specific brain regions, including the cortex, striatum, and white matter, specific brain cell types such as neurons, astrocytes, and oligodendrocytes, and specific subcellular structures, including axons, dendrites, growth cones, cortical cytoskeleton, intermediate filaments and extracellular matrix.
[0099] Methods of the invention involve testing fluid biological samples from a subject, such as a mouse traumatic brain injury model or a human central nervous system trauma subject. The sample is subjected to ultrafiltration with a low molecular weight (10,000 Da) cutoff membrane to separate the smaller PFs from the larger PBPs and proteins, then the resulting fractions are subjected to testing to identify specific peptides in the filtrate and the larger peptides and proteins in the retentate. Testing can include a tandem mass spectrometry proteomic method and/or immunological methods such as high sensitivity immunoblotting. Time course measurements of post-injury biofluid levels of these proteins, PBPs, or PFs can be used as TBI and CNS injury diagnostic and prognostic tools at different time periods post-injury when compared to levels as recovery progresses and in normal controls.
3. Embodiments of the Invention
A. Introduction
[0100] A biomarker as defined by the National Academy of Sciences, and as used herein, the presence of which indicates or signals one or more events in biological samples or systems. Biomarkers for central nervous system injury are valuable and unbiased tools in defining the severity of CNS injury because they reflect the extent of brain and spinal cord damage in emergency medicine, neurointensive care and hospitalization settings. The invention therefore includes a fast turn around point-of-care diagnostic biofluid test and device for deployment in various hospital settings. A small amount of subjects' blood samples can be used on the device and levels of specific combination of two or more of the biomarker PFs can be determined.
[0101] Generally, the higher the levels of these biomarker levels, the more severe the injury. For example, in an emergency medicine setting, the more severe brain or spinal cord injury subjects can then be admitted to hospital for treatment and monitoring while the mildly injured subjects can be released. Thus the biomarkers of the invention can be used as triaging tools. For subjects already in a neurointensive care unit, unresolved high biofluid levels of CNS biomarkers or further elevations of such biomarkers can indicate the deterioration of the subject's condition or the evolution of the injury. Thus aggressive medical interventions (such as surgery or other procedures or treatments) might be administrated. The PBP and PF biomarkers can be used for monitoring and management of critically injured subjects. For those TBI or spinal cord injury patients who are moderately injured and are staying in hospital, periodic monitoring of their biofluid levels of CNS biomarkers can be useful to detect delayed elevations of the biomarkers, which could indicate occurrence of a secondary injury or the deterioration or evolution of the initially moderate injury to a more severe condition, or development of post-trauma neurodegeneration, allowing more aggressive medical monitoring or medical intervention to be administered. CNS injury biomarkers in the acute or subacute phase can inform on and/or improve neurological recovery or patient outcome. This information can be very useful for patient or caretaker in terms of future care planning, personal life decision-making and arrangement of rehabilitation.
[0102] Some metabolite candidates such as N-acetyl aspartate (NAA, a neuronal/axonal marker), creatine (gliosis marker), and choline (indicator of cellular turnover related to both membrane synthesis and degradation) can be used as biomarkers for monitoring the pathobiological changes of primary and secondary damage in TBI using proton magnetic resonance spectroscopy (1H-MRS). In vivo 1H-MRS is a valuable tool for noninvasive monitoring of brain biochemistry by quantifying the changes in the metabolites in brain tissue. However, due to the relatively small size of the spinal cord and magnetic susceptibility effects from the surrounding bony structures, acquiring MR spectra with adequate signal to-noise ratio (SNR) is difficult, and does not allow detection of subtle changes in metabolite levels.
[0103] Proteomic analysis is a technique for simultaneously detecting multiple proteins in a biological system. It provides robust methods to study protein abundance, expression patterns, interactions, and subcellular localization in blood, organelle, cell, tissue, organ or organism to provide accurate and comprehensive data about that system. For example, proteomics can use extensive sample procedures and data-dependent acquisition to follow disease-specific proteins (identity and concentration). It facilitates the identification of all differentially expressed proteins at any given time in a proteome (the entire complement of proteins that can be expressed by a cell, tissue, or organism) and correlates and compares these patterns with those in a healthy system during disease progression. Proteomics has been used to study protein expression at the molecular level with a dynamic perspective that helps to understand the mechanisms of the disease.
[0104] The complexity, immense size and variability of the neuroproteome and the extensive protein—protein and protein—lipid interactions limit the ability of mass spectrometry to detect all peptides/proteins contained within the sample. Further, some peptides/proteins are extraordinarily resistant to isolation. Therefore, the analytical methods for the separation and identification of peptides/proteins must manage all of these issues. This invention addresses these problems by using separation techniques combined with powerful new mass spectrometry technologies to expand the scope of protein identification, quantitation and characterization.
[0105] The complexity of a biological sample can be reduced by separation or fractionation at the protein or peptide level. Multidimensional liquid chromatography (LC) was used in two or more different types of sequential combinations to significantly improve the resolution power and resulted in a large number of proteins being identified. Any of these methods are contemplated for use with the invention.
[0106] Ion-exchange chromatography (IEC) in the first dimension was very suitable for the separation of proteins and PFs by separating proteins based on their differences in overall charges. IEC's stationary phase is either an anion or a cation exchanger, prepared by immobilization of positively or negatively charged functional groups on the surface of chromatographic media, respectively. Protein or peptide separation occurs by linear change of the mobile-phase composition (salt concentration or pH) that decreases the interactions of proteins with the stationary phase, resulting in finally eluting the proteins. SDS-PAGE can be used for further protein separation by apparent molecular weight with the resolving distance optimized for the proteome of interest. PFs can be separated by their hydrophobicity using a reversed phase C18 column directly coupled to the electrospray mass spectrometer (ESI-LC-MS/MS). Reversed-phase liquid chromatography (RPLC) is most often used in the second dimension due to its compatibility with downstream mass spectrometry (sample concentration, desalting properties, and volatile solvents).
[0107] Mass spectrometry (MS) also is an important tool for protein identification and characterization in proteomics due to the high selectivity and sensitivity of the analysis and can be used in the invention. Electrospray ionization (ESI) is considered a preferred ionization source for protein analysis due to two characteristics: first, the ability to produce multiply-charged ions from large molecules (producing ions of lower m/z that are readily separated by mass analyzers such as quadrupoles and ion traps), and second, the ease of interfacing with chromatographic liquid-phase separation techniques. Electrospray ionization followed by tandem mass spectrometry (ESI-MS/MS) is one of the most commonly used approaches for protein identification and sequence analysis.
[0108] This invention takes advantage of proteomic analysis to identify biomarkers in complex biological samples, for example biofluids, to diagnose CNS traumatic injury in a subject, to assess the severity and location of the traumatic injury, and to make a determination of prognosis for the subject. The subject preferably is a human or other mammal, for example a laboratory animal, farm animal, companion animal, zoo animal, or most preferably is a rodent or primate, including a human subject or patient. The mammals contemplated as subjects with respect to this invention include rats, mice, ferrets, swine, monkeys, and primates, including humans.
B. Subjects and Sampling
[0109] The injuries contemplated for diagnosis, determination of severity and location, or prognosis include any injury to the central nervous system, of whatever cause. Injuries to the peripheral nerves also are included and are contemplated with respect to this invention. The injury includes injury to the brain, retina, and/or spinal cord, or the peripheral or cranial nerves, and may be localized to a particular physical area or may be generalized. Injuries can be caused by direct trauma, or by inflammation or swelling and edema, contusion, diffuse axonal injury, cerebrovascular injury, hypoxia or anoxia, ischemia, a thromboembolic event, cerebrovascular occlusion or other acute or chronic circulatory disorder, toxins or poisons, envenomation, hemorrhage or hypovolemia, and the like, which cause a physical trauma, directly or indirectly, to the central nervous system. Thus, the subjects referred to herein are any mammal that either suffers from or is suspected of suffering from an injury as discussed above.
[0110] The samples that can be usefully collected and tested for protein breakdown products according to the invention include fluid biological samples such as cerebrospinal fluid, whole blood, plasma, serum, and the like, or biopsy, autopsy or necropsy CNS lysate samples and other fluid samples. These samples are collected from the subject according to methods known in the art.
[0111] Samples are collected from the subject after an injury to the central nervous system, or an incident that indicates such an injury may have occurred. Incidents such as physical and direct trauma to the head or spine (i.e., sports injury, surgery, vehicular accident, falls, and the like) and its sequelae, illness (i.e., tumor, encephalitis, and the like), or hypoxia (i.e., near drowning, myocardial infarction, embolism, and the like), are specifically contemplated, but are not intended to be limited. The person of skill in the art, such as physician or trauma specialist can easily determine if an injury to the central nervous system is present or should be suspected. Preferably, a sample for diagnostic purposes is collected up to 24 hours after initial injury or up to 3 days (72 hours) after initial injury.
[0112] The initial samples can be collected immediately or within about 72 hours after trauma occurs or after injury is suspected, preferably within about 24 hours or one day, and can include one sample only or multiple samples (such as two or more of CSF and blood, serum, brain biopsy, and the like). Further, a second or more than one subsequent sample(s) can be collected at one or several additional subsequent times. For example, samples can be collected hourly, twice daily, daily, every two days, weekly, monthly, or any convenient interval for a period of time deemed to be necessary based on the condition of the patient. A suitable time for continued testing can include two days, a week, two weeks, a month, two months, six months, a year, several years, or for the remainder of a patient's lifetime.
[0113] An advantage to collecting multiple samples over a time course (for example, over a week, month, several months, years or longer) is that it allows the practitioner to compare the number, type, and amount of protein breakdown products appearing in the samples over time, to assist in determining the course of the injury or the progress of the subject or patient. Repeated sampling allows the practitioner to determine if peptide levels are diminishing or remaining elevated, thus determining whether the injury to the central nervous system is improving, becoming chronic, or becoming more severe over a course of time.
C. Protein Breakdown Products and Peptide Fragments
[0114] Intact proteins such as calcium binding protein S100 beta (S100β), glial fibrillary acidic protein (GFAP), myelin basic protein (MBP), neuron specific enolase (NSE), neurofilament protein (NFL), SBDP150/SBDP145/SBDP120, ubiquitin C-terminal hydrolase-L1 (UCH-L1) and microtubule-associated 2 (MAP-2) have been identified as potential markers of brain damage. However, due to the complexity of TBI and other central nervous system injury, multiple interventions that target the different complications of the injury may be required in a clinical setting. Previous methods using a single biomarker are unlikely to be successful for either diagnostic or prognostic purposes in human patients. Therefore, although the sample or samples can be tested for only one of the biomarkers disclosed here as part of the invention, it is preferable to test for more than one in each sample. Preferred PFs according to the invention are provided in Table 1, below. In preferred methods, one or two PFs from each protein in the table are tested in each sample. In other embodiments, proteins, PBPs, and/or PFs from each category are analyzed.
TABLE-US-00004 TABLE 1 Preferred Peptide Fragment Biomarkers Protein Name, Source, Uniprot number, and amino acid SEQ ID residues Peptide Sequence Injury Indicated Peptide Name NO Human Tau-441, (isoform 2; isoform Tau-441, Tau 4); P10636-8 2-21 AEPRQEFEVMEDHA Axonal injury, “Tau-441 N- 132 GTYGLG neurodegeneration terminal peptide 1” 90-123 AAQPHTEIPEGTTAE Axonal injury, “Tau-441 N- 133 EAGIGDTPSLEDEAA neurodegeneration terminal peptide 2” GHVTQARMVS 311-323 KPVDLSKVTSKCG Axonal injury, “Tau-441 center 134 neurodegeneration peptide 1” 315-326 LSKVTSKCGSLG Axonal injury, “Tau-441 center 135 neurodegeneration peptide 2” 379-403 RENAKAKTDHGAEI Axonal injury, “Tau-441 136 VYKSPVVSGDT neurodegeneration center peptide 3” 404-426 SPRHLSNVSSTGSID Axonal injury, “Tau-441 C- 137 MVDSPQLA neurodegeneration terminal peptide 1” 427-441 TLADEVSASLAKQGL Axonal injury, “Tau-441 C- 138 neurodegeneration terminal peptide 2” 434-441 ASLAKQGL Axonal injury, “Tau-441 C- 139 neurodegeneration terminal peptide 3” Phosphorylated Human Tau-441, (isoform 2; isoform Tau-441, Tau 4); P10636-8 395-412 KSPVVSGDTSPRHLS Axonal injury, “Phospho-Tau-441 140 3xPhospho- NVS neurodegeneration C-terminal peptide sites 1” S396(100); S400(100); S404(88.9) 395-426 KSPVVSGDTSPRHLS Axonal injury, “Phospho-Tau-441 141 3xPhospho NVSSTGSIDMVDSP neurodegeneration C-terminal peptide S396(99) QLA 2” 413-426 STGSIDMVDSPQLA Axonal injury, “Phospho-Tau-441 142 1xPhospho- neurodegeneration C-terminal peptide site 3” S416(99.9) Human Tau-758 (isoform 1, isoform PNS-Tau, PHF-Tau), P10636-1 372-401 PQLKARMVSKSKDGTG Axonal injury, “Tau-758 specific 143 SDDKKAKTSTRSSA neurodegeneration center peptide 1” 411-457 SPKHPTPGSSDPLIQPSS Axonal injury, “Tau-758 specific 144 PAVCPEPPSSPKYVSSV neurodegeneration center peptide 2” TSRTGSSGAKEM 435-486 PPSSPKYVSSVTSRTGSS Axonal injury, “Tau-758 specific 145 GAKEMKLKGADGKTKI neurodegeneration center peptide 3” ATPRGAA 444-465 SVTSRTGSSGAKEMKL Axonal injury, “Tau-758 specific 146 KGADGK neurodegeneration peptide” 411-434 SPKHPTPGSSDPLIQPSS Axonal injury, “Tau-758 specific 147 PAVCPE neurodegeneration center peptide 2” 435-459 PPSSPKYVSSVTSRTGSS Axonal injury, “Tau-758 specific 148 GAKEMKL neurodegeneration center peptide 3” Human Neurogranin Q92686 18-64 ILDIPLDDPGANAAAAK Synaptic Injury “Neurogranin 149 IQASFRGHMARKKIKSG Peptide 1” ERGRKGPGPGGPGGA 18-64 ILDIPLDDPGANAAAAK Synaptic Injury “Neurogranin 150 IQAS(p)FRGHMARKKIK Peptide 2 (Ser-36 SGERGRKGPGPGGPGGA phosphorylated)” 13-38 DDDILDIPLDDPGANAA Synaptic Injury “Neurogranin 151 AAKIQASFR Peptide 3” 13-38 DDDILDIPLDDPGANAA Synaptic Injury “Neurogranin 152 AAKIQAS(p)FR Peptide 4 (Ser-36 phosphorylated)” 24-65 PGANAAAAKIQASFRG Synaptic Injury “Neurogranin 153 HMARKKIKSGERGRKG Peptide 5” PGPGG 24-65 PGANAAAAKIQAS(p)FR Synaptic Injury “Neurogranin 154 GHMARKKIKSGERGRK Peptide 6 (Ser-36 GPGPGG phosphorylated)” Human Vimentin P08670 Astroglial Injury 388-399 NVKMALDIEIAT Astroglial Injury “Vimentin C- 155 terminal peptide 1” 403-424 LLEGEESRISLPLPNFSS Astroglial Injury “Vimentin C- 156 LNLR terminal peptide 2” 388-465 NVKMALDIEIATYRKLL Astroglial Injury “Vimentin C- 157 EGEESRISLPLPNFSSLN terminal peptide 3” LRETNLDSLPLVDTHSK RTLLIKTVETRDGQVIN 1-75 MSTRSVSSSS Astroglial Injury “Vimentin N- 492 YRRMFGGPGT terminal peptide 1” ASRPSSSRSY VTTSTRTYSL GSALRPSTSR SLYASSPGGV YATRSSAVRL RSSVP 2-47 STRSVSSSSYRRMFGGP Astroglial Injury “Vimentin N- 159 GTASRPSSSRSYVTTST terminal peptide 2” RTYSLGSALR Human MBP Isoform 5 P02686-5 Myelin damage/ oligodendrocyte injury 11-24 HGSKYLATASTMD Myelin damage/ “MBP N-terminal 160 oligodendrocyte peptide 1” injury 11-43 HGSKYLATASTMDHAR Myelin damage/ “MBP N-terminal 161 HGFLPRHRDTGILDSIG oligodendrocyte peptide 2” R injury 105-140 GRTQDENPVVHFFKNI Myelin damage/ “MBP center 162 VTPRTPPPSQGKGRGLS oligodendrocyte peptide” LSRF injury 165-178 HKGFKGVDAQGTLS Myelin damage/ “MBP C-terminal 163 oligodendrocyte peptide” injury Human Golli-MBP1 P02686-1 Myelin damage/ oligodendrocyte injury 4-38 HAGKRELNAEKASTNS Myelin damage/ “Golli-MBP1 164 ETNRGESEKKRNLGELS oligodendrocyte isoform-specific N- RTT injury terminal peptide” 75-116 NAWQDAHPADPGSRPH Myelin damage/ “Golli-MBP1 165 LIRLFSRDAPGREDNTF oligodendrocyte isoform-specific KDRPSESDE injury center peptide” Human Glial Fibrillary Acidic protein Astroglial injury P14136-1 6-43 ITSAARRSYVSSGEMM Astroglial injury “GFAP N-terminal 166 VGGLAPGRRLGPGTRL peptide 1” SLARMP 14-38 YVSSGEMMVGGLAPG Astroglial injury “GFAP N-terminal 167 RRLGPGTRLS peptide 2” 12-33 RSYVSSGEMMVGGLAP Astroglial injury “GFAP N-terminal 168 GRRLGP peptide 3” 9-49 AARRSYVSSGEMMVG Astroglial injury “GFAP N-terminal 169 GLAPGRRLGPGTRLSLA peptide 4” RMPPPLPTR 11-30 ARRSYVSSGEMMVGGL Astroglial injury “GFAP N-terminal 170 APGRR peptide 5” 26-45 APGRRLGPGTRLSLAR Astroglial injury “GFAP N-terminal 171 MPP peptide 5” 372-399 GEENRITIPVQTFSNLQI Astroglial injury “GFAP C-terminal 172 RETSLDTKSV peptide 1” 382-416 QTFSNLQIRETSLDTKS Astroglial injury “GFAP C-terminal 173 VSEGHLKRNIVVKTVE peptide 2” MR 417-423 DGEVIKES Astroglial injury “GFAP C-terminal 174 peptide 3” 417-422 DGEVIKE Astroglial injury “GFAP C-terminal 175 peptide 4” 417-332 DGEVIKESKQEHKDVM Astroglial injury “GFAP C-terminal 176 peptide 5” 384-400 FSNLQIRETSLDTKSVSE Astroglial injury “GFAP C-terminal 177 peptide 6” 417-423 DGEVIKESK Astroglial injury “GFAP C-terminal 178 peptide 7” Microtubule-associated Protein 6 (MAP6) Q7TSJ2 31-51 TKYSEATEHPGAPP Astroglial injury “MAP6 N-terminal 179 QPPPPQQ peptide 1” 788-812 QLPTVSPLPRVMIPT Astroglial injury “MAP6 C-terminal 180 APHTEYIESS peptide 1” Synapsin I (SYNI) P17600-1 or P17600-2 684-694 QDEVKAETIRS Pre-synaptic terminal 181 injury Synapsin II (SYN2) Q9277-1 or Q64332 540-557 SQSLTNAFSFSESSFF Pre-synaptic terminal 182 RS injury Synapsin III (SYN3) Q14994-1 or P07437 540-557 DWSKYFHGKKVNG Pre-synaptic terminal 183 EIEIRV injury 359-391 GEHVEEDRQLmADL Pre-synaptic terminal 184 VVS injury Complement C1q subcomponent subunit B D6R934 HGEFGEKGDPGIPG Microglia activation 701 Complement C3 P01024 HWESASLL Microglia activation 702 VKVFSLAVNLIAI Microglia activation 703 Complement receptor type 1 CR1 E9PDY4 KTPEQFPFAS Microglia activation 704 Complement C5 P01031 VTcTNAELVKGRQ Microglia activation 705 Complement C1s P09871 IISGDTEEGRLcGQR Microglia activation 706 SSNNPHSPIVE
[0115] The above table shows novel CNS traumatic injury biomarkers identified as PFs derived from CNS proteins due to traumatic injury activated proteolysis, in accordance with the schematic diagram in
[0116] Additional TBI proteolytic biomarker PBPs or PFs were also derived from brain proteins Synapsin-I, II, III (SYN1, SYN2, SYN3), Cortexin-1,2,3 (CTXN1, CTXN2, CTXN3), Striatin (STRN), NRGN (fragment), MBPS (fragment) Golli-MBP1, VIM, Brain acidic soluble protein (BASP1, BASP2 (GAP33)), Neurochondrin, Nesprin-1 Glutamate Decarboxylase-1, 2 (GAD1, GAD2), Neurexin-1, 2, 3 (NRXN1, NRXN2, NRXN3) Calmodulin-binding spectrin associated proteins-1, 2, 3 (CAMSAP1, 2, 3), and Chondroitin sulfate proteoglycans (CSPG4, Neurocan (CSPG3) and brevican. These proteins are listed in Table 2, below, showing the brain area in which they are located, and therefore the brain area which is associated with the appearance of the biomarker(s) upon injury. Thus, to determine if an injury to astroglia, for example, is to be diagnosed or investigated, VIM-derived PFs should be analyzed; if an injury to neuron cell bodies is to be diagnosed or investigated, BASP1 and neurochondrin derived PFs should be analyzed.
TABLE-US-00005 TABLE 2 Brain Proteins with PBP or PF Released after Traumatic CNS Injury and their Associated Brain Area Signifying Injury to Brain Protein Area/Location Cortex-1 cortex Neurochondrin Neuron cell body Neurogranin post-synaptic Synapsin LII, III presynaptic Striatin striatum Vimentin astroglia MBP (classic) white matter/oligodendrocyte Golli-MBP white matter/oligodendrocyte GAD1, GAD2 neuron cell body Chondroitin sulfate proteoglycan 4 extracellular matrix Neurocan extracellular matrix Brevican extracellular matrix CAMSAP1,2,3 cortical cytoskeleton/axon Neurexin-1, -2, -3 presynaptic BASP1 neuron cell body GAP43/BASP2 neuron growth cone Nesprin-1 neuron nucleus MAP6 dendrite Tau-441 isoform (Tau isoform 2, axon Tau-F; P10636-8) Tau-758 (isoform 1, PHF-Tau; axon P10636-1
[0117] The above table provides proteins or proteolytic PFs released after traumatic injury to the CNS (e.g. TBI) and their associated brain region, brain cell type or neuronal subcellular location. The work presented here used an in vitro brain injury model with mouse brain lysate and purified brain protein incubation with calcium solution or protease calpain, an in vivo mouse traumatic brain injury model and human traumatic brain injury biofluid (cerebrospinal fluid or CSF) samples. These samples were analyzed using separation by ultrafiltration with low a molecular cutoff filter, a tandem mass spectrometry proteomic method and immunological methods including high sensitivity immunoblotting to detect and identify a number of brain-specific or brain-enriched proteins from various CNS cell types (neurons, astrocytes, oligodendrocytes) or extracellular matrix. Proteins in the central nervous system are proteolytically broken down into PBPs and PFs upon injury to the tissues. The PBPs and PFs are released from injured tissue into biofluids (such as cerebrospinal fluid and blood) and can be detected there as shown above. Since these proteolytic events are brain injury-mediated, the PBPs and PFs were identified to be injury-specific biomarkers.
[0118]
[0119]
[0120]
[0121]
D. Methods of Use
[0122] The proteins, PBPs, and PFs described here are identified in a sample from a subject such as a human patient who has suffered an injury to the central nervous system or who is suspected of having suffered such an injury. Preferably, a sample is obtained from the subject within 24 hours of the injury or suspected injury. A series of samples also can be taken over a period of days or weeks so that progress can be determined. The sample preferably is CSF or whole blood/serum. Secondary preferred samples are saliva, urine, nasal fluid and tears.
[0123] In the case of diagnosing an acute injury or suspected acute injury, a first sample is taken after the injury, preferably as soon as possible and within 24 hours, and further samples can be taken over a time course to obtain information on continued injury or recovery. Testing can be performed to detect a single protein, PBP, or PF, or a combination of one or more proteins, PBPs, or PFs. In some inventive embodiments, at least one protein, PBP, or PF for each of the injury types in Table 1, above, is tested. A high level of one or more of these (approximately twice the level as found in a control sample or uninjured subject or more) indicates an injury, and the identity of the peptide indicates the particular area that has been injured. A peptide level of about 1.5-2.5 times higher than control, or 2.0-2.5 times higher than control (for example about 1.5, 1.75, 2, 2.25, or 2.5 times higher than control), indicates a mild injury; a peptide level of about 2.5-4.0 times higher than control (for example about 2.5, 2.75, 3.0, 3.25, 3.5, 3.75 or 4 times higher than control) indicates a moderate injury; a peptide level of more than about 4.0 times higher than control (for example 4.25, 4.5, 4.75, 5, 5.25, 5.5, 6, 6.5, 7 or more) indicates a severe injury, with amounts higher than 6 times higher than control indicating a very severe injury.
[0124] In the case of diagnosing a chronic injury or a suspected chronic injury, a series of samples are taken periodically so that the results can be compared along a time course as well as compared to a control sample from an uninjured subject or an in vitro sample produced for that purpose. Analyte (protein, PBP, or PF) levels that increase over time indicate a chronic or worsening injury; analyte levels that remain about the same over time indicate a stable state or chronic injury; analyte levels that decrease over time indicate that the injury is improving or is not continuing. The levels for determining the severity of the chronic injury are the same as those discussed above for an acute injury.
[0125] The precise testing of the samples to be performed to make a diagnosis can be determined by the routine practitioner, depending on the condition of the patient and the suspected type and severity of the injury. For example, if a particular injury to a brain area or subcellular area is suspected after examination of the subject, the sample can be tested for breakdown products derived from the protein identified as correlating with that particular area in this application so that the diagnosis can be confirmed. If the injury is unknown, a large number of tests or the entire panel of tests for all breakdown products can be performed on the sample to make a specific diagnosis.
[0126] A diagnosis of a particular injury is made by comparing the results of a subject sample to an uninjured control. If the subject sample has a significantly higher amount of the diagnostic protein, PBP, or PF than the control, a positive diagnosis can be made.
[0127] To determine the severity of an injury or prognosis for the subject, the level of a protein, PBP, or PF, or a battery of proteins, PBPs, and PFs can be compared to control samples of varying injury. For example, higher biofluid levels of one or more of the analytes can be correlated to the severity of traumatic injury, to the likelihood of development of post-trauma complications, or to a poor patient prognosis.
E. Kits
[0128] The invention contemplates kits for testing for brain protein breakdown products as described herein, and can include, for example, one or more of the following: suitable containers and equipment for obtaining a subject sample such as CSF or blood; ultrafiltration cell(s) or units with a molecular weight cutoff of about 10 kDa; one or more antibodies or aptamers that specifically recognize a protein, PBP, or PF according to the invention as described herein; and protein, PBPs, and/or PFs according to the invention as described herein to be used as standards in assays. Alternatively, if a mass spectrometry method is to be used for analyte detection, the kit can include analyte standards to be used as internal standards (spike in) or external standards (side-on-side).
[0129] A kit according to the invention comprises components for detecting and/or measuring the breakdown products described herein in a sample from a subject. Preferably, the kit contains a primary antibody or aptamer reagent or reagents that each specifically bind to a peptide breakdown product. The antibodies or aptamers can be organized into groups of reagents that recognize the breakdown products of a single protein or a group of proteins that indicate a certain type of central nervous system injury, if desired. Also, the antibodies or aptamers can be organized into panels of reagents that together can detect the breakdown of some or all of the indicator proteins identified here.
[0130] The primary antibodies (preferably monoclonal antibodies or fragments thereof) or aptamers specifically recognize and bind to a single peptide or class of peptides. One or more secondary antibodies (optionally labeled) that bind to the primary antibody or aptamer also can be included, as well as a target antigen (the peptide to be detected in the sample). The secondary antibodies can be, for example, antibodies directed toward the constant region of the primary antibody (optionally IgG) (e.g., rabbit anti-human IgG antibody), which may itself be detectably labeled {e.g., with a radioactive, fluorescent, colorimetric or enzyme label), or which may be detected by a labeled tertiary antibody {e.g., goat anti-rabbit antibody).
[0131] The antibody- or aptamer-based detection methods can involve a western blot, immunoassays such as enzyme linked immunosorbant assays (ELISA), sandwich assay, or radioimmunoassay (RIA), mass spectrometry, or antibodies or aptamers can be used in combination with mass spectrometry detection methods (e.g., LC-MS/MS). Any detection assay method for proteins and/or peptides known in the art can be used. Suitable containers for performing the assays also can be included in a kit for convenience. Such assays are well known in the art, and any of these known methods can be used with the invention to detect PBP or PF according to the invention. In certain embodiments of the invention, a fast turn around point-of-care diagnostic biofluid test and device can be deployed in various hospital settings. The test will use a biochip or cartridge that contains one or two biomarker target-specific capture and detection antibodies or aptamers. The POC device ha s receptacle for the biochip or cartridge as well as a part that can generate a readout signal. Commonly for these detection methods, the biomarker readout is in the form of light, chemiluminescence or fluorescence signals, chemoelectric signals, radiation signal or absorbance signals. However, mass spectrometry and tandem mass spectrometry methods might also be employed.
[0132] A diagnostic test kit generally includes a cartridge or biochip with embedded capature and/or detecting agents (e.g specific antibodies) for one or more protein, PBP. and/or PF biomarker, along with a companion reader or analyzer with a receptacle for the detection cartridge as well as a component capable of producing a biomarker readout. Alternatively a detection kit can be a sandwich ELISA (with capture and detection antibodies for each biomarker) in a singlet or multiplex fashion, as it is commonly described in the field of diagnostics. The detection kit also can be an immunoblotting or western blotting format, as it is commonly described in the field of biochemistry and diagnostics. The common readout from the above mentioned test kits is in the form of light signals (e.g. fluorescence, chemiluminescence), absorbance changes or electrochemical signals. However, mass spectrometry and tandem mass spectrometry methods might also be employed.
[0133] Preferably, instructions are packaged with the other components of the kits of the invention, for example, a pamphlet or package label. The instructions explain how to perform testing and methods according to the invention.
[0134] In some embodiments, a diagnostic kit comprises (a) detection agents for antibody, aptamer or mass spectrometry detection methods for detection of one or more PFs or other analytes, (b) an analyte protein, protein breakdown product, or PF to serve as internal standard and/or positive control; and (c) a signal generation coupling component. Such signal generation components either are based on detection tool (e.g. antibody) coupled enzyme, which carries out enzymatic reaction to generate a product or direct coupled of a tagging molecule to the detection tool (e.g. antibodies). These enzymatic protein or ragging molecules generally product a light, fluorescence, or chemiluminescence signal, or absorbance changes or electrochemical signals, or the like, to allow detection. However, mass spectrometry and tandem mass spectrometry methods might also be employed.
4. Examples
[0135] This invention is not limited to the particular processes, compositions, or methodologies described, as these may vary. The terminology used in the description is for the purpose of describing the particular versions or embodiments only, and is not intended to limit the scope of the present invention which will be limited only by the appended claims. Unless defined, otherwise, all technical and scientific terms used herein have the same meanings as commonly understood by one of ordinary skill in the art. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of embodiments of the present invention, the preferred methods, devices, and materials are now described. All publications mentioned herein, are incorporated by reference in their entirety. Nothing herein is to be construed as an admission that the invention is not entitled to antedate such disclosure by virtue of prior invention.
[0136] The following examples are provided as illustrations of the invention and are in no way to be considered limiting.
Example 1
Specific Methods
[0137] 1. Sample Collection and Preparation
[0138] Brain samples from CB57BL/6 male mice, 3 to 4 months old, were used. Cortex, corpus callosum and hippocampus regions were isolated from each mouse brain. The brain samples were pulverized to powder using mortar and pestle placed over dry ice to maintain a cold environment. The pulverized brain samples were then lysed using Triton lysis buffer (20 mM Tris-CHl, 5 mM EGTA, 100 mM NaCl, with 1% Triton) by incubating at 4° C. for 90 minutes. After incubation, the samples were centrifuged and a protein assay was performed to estimate the concentration of the mouse brain lysates. Brain lysate equivalent to 120 μg of protein was used.
[0139] For some samples, purified protein (GFAP, MBP, NRGN (2-10 ug)), or brain lysate (50-160 ug) were subjected to in vitro incubation with 7 mM calcium chloride CaCl.sub.2) or with calcium and human calpain-1 protease (protease: brain protein ratio of 1:20 to 1:50) and 20 mM (NH.sub.4).sub.2CO.sub.3, 10 mM dithiothreitol (DTT) and 7 mM CaCl.sub.2) (pH 7.4). This condition mimics the brain injury induced calpain activation in animal and human brain, and serves as an in vitro model of central nervous system injury.
[0140] Centrifuged CSF samples (500 uL) were obtained from human subjects with severe TBI (Glasgow coma score of 3-8) and from control, uninjured subjects.
[0141] Ultrafiltration was used to separate smaller from larger peptide molecules. The brain lysate and the CSF samples were filtered through 10,000 Da molecular weight cutoff membrane filters (Sartorius Stedim Biotech®, Goettingen, Germany). This filtration technique allows the isolation in the ultrafiltrate of molecules that are smaller than or equal to 10,000 Da, from the retentate.
[0142] The ultrafiltrate then was concentrated using a vacuum evaporation method (SpeedVac™; (Thermo Scientific®) to a volume of 5 μL. The concentrated samples were reconstituted with water containing 0.1% formic acid. These samples were ready for liquid chromatography-tandem mass spectrometry. The samples of retentate of ultrafiltration were analyzed using western immunoblotting methods.
2. Mass Spectrometry
[0143] Tandem mass spectrometry-based proteomic methods first were used to identify PFs derived from the brain injury protein biomarkers using in vitro calcium or calpain digestion of purified protein or TBI-model mouse brain lysate. The samples were analyzed using a system with a Thermo Scientific® LTQ-XL (Thermo Fisher Scientific®, San Jose, Calif., USA) with a Waters® nanoACQUITY UPLC system ((Waters®, Milford, Mass., USA). LC-MS grade water and acetonitrile, both with 0.1% formic acid, were used as mobile phases with a 115 minute gradient at a flow rate of 300 nL/min on a 1.7 μm BEH130 C18 column (100 μm×100 mm). Tandem mass spectra with data-dependent acquisition (top 10 most abundant ions) method was performed using Xcalibur® 2.0.7 (Thermo®). MS/MS data were searched using Proteome Discoverer® 1.3 (Thermo®) against mouse database and human database respectively with no enzyme.
3. Western Blotting
[0144] Western blot was performed on the higher molecular weight proteins (greater than about 10,100 Da) that were retained on the membrane filter. Western blot was used to confirm proteolysis of proteins in the CCI and TBI samples. SDS-gel electrophoresis and immunoblotting was done using standard published methods (see Yang et al., PLOS ONE 5, e15878, 2010). Blotting membrane was probed with specific target-based antibody (1/500 to 1/2,000 dilution) followed by secondary anti-mouse or anti-rabbit HRP (horse radish peroxidase) conjugate antibody and then detected visually using 5-Bromo-4-chloro-3-indolyl phosphate/Nitro blue tetrazolium (NBT/BCIP) as substrate (colorimetric development). Other immunological assays, such as ELISA (i.e., sandwich assays), RIA, and others known in the art can be used to detect and quantitate the proteins, PBPs and PFs according to the invention, as is convenient to the practitioner. In general, immunological assays such as a sandwich ELISA are preferable for detection of larger peptides and proteins.
Example 2
Animal Models
[0145] In order to produce an in vivo model of traumatic brain injury in mice, a controlled cortical impact (CCI) device was used according to known methods (see Yang et al., J. Cerebral Blood Flow Metab. 34:1444-1452, 2014). CB57BL/6 mice (male, 3 to 4 months old, Charles River Laboratories®, Raleigh, N.C., USA) were anesthetized with 4% isoflurane in oxygen as a carrier gas for 4 minutes followed by maintenance anesthesia of 2% to 3% isoflurane. After reaching a deep plane of anesthesia, mice were mounted in a stereotactic frame in a prone position, and secured by ear and incisor bars. A midline cranial incision was made and a unilateral (ipsilateral) craniotomy (3 mm diameter) was performed adjacent to the central suture, midway between the bregma and the lambda. The dura mater was kept intact over the cortex. Brain trauma was induced using a PSI TBI-0310 Impactor (Precision Systems and Instrumentation®, LLC, Natick, Mass., USA) by impacting the right cortex (ipsilateral cortex) with 2 mm diameter impactor tip at a velocity of 3.5 m/second, 1.5 mm compression depth, and a 200 millisecond dwell time (compression duration). Sham-injured control animals underwent identical surgical procedures but did not receive an impact injury. Naïve animals underwent no procedure.
Example 3
General Methods
[0146] See
Example 4
Localization of Brain Protein-Derived Breakdown Products
[0147]
[0148] From the list of mass spectrometry data on PFs obtained using database searches and complimentary immunblotting evidence from protein digestions on samples from a mouse model of TBI and human central nervous system injured subject biofluid samples (based on the peptide XCorr valuses (e.g., XCorr >3.0), brain cell type specific markers identified in this application include the proteins in Table 2, above. See also
Example 5
TBI-Induced Peptide Fragments in Mouse Cortex and Hippocampus
[0149] Mice subjected to traumatic brain injury as described in Example 2 were sacrificed. Cortex and hippocampus tissue sample lysates were subjected to ultrafiltration and the ultrafiltrates tested by nLC-MSMS to identify TBI-induced PFs. The PFs were identified by comparison with immunoblotting data on proteins/PBPs. Results are shown in Table 3, below. The data showed that the in vitro incubation model and the mouse model of TBI both resulted in production of similar brain PBPs/PFs than those found in the CSF samples of human TBI subjects. PBPs or PFs identified by all three methods therefore can have utility in diagnosing or monitoring human brain damage.
TABLE-US-00006 TABLE 3 Identification of TBI-induced Peptide Fragments from mouse CCI cortex and hippocampal samples (ultrafiltrate by nLC-MSMS). Mouse Accession Mouse Mol. Wt. Number Protein Name Gene (kDa) Origin Q8R5A3 Amyloid beta A4 precursor protein-binding Apbb1ip 74.3 Neuron-axonal family B member 1-interacting protein H7BX08 Calmodulin-regulated spectrin-associated Camsap2 166 Neuron-axonal protein 2 E9Q5B0 Calmodulin-regulated spectrin-associated Camsap3 135.2 Neuron-axonal protein 3 Q8VHY0 Chondroitin sulfate proteoglycan 4 Cspg4 252.2 Extracell. Matrix D6R934 Complement Protein C1q C1q 26.7 Microglia/ macrophage P09871 Complement Protein C1s C1s 76.6 Microglia/ macrophage P01024 Complement Protein C3 C3 180.0 Microglia/ macrophage P01031 Complement Protein C5 C5 188.3 Microglia/ macrophage E9PDY4; Complement C3b/C4b receptor CR1 223.6 Microglia/ P17927 receptor CR1 (CD35) macrophage P20023 Complement receptor CR2 110.0 Microglia/ receptor 2, CR2 (CD21) macrophage Q91XM9 Disks large homolog 2, PSD98 Dlg2 103 Post-synaptic term. P03995-2 Glial fibrillary acidic protein Gfap 49.8 Astrocyte P48318 Glutamate decarboxylase 1 Gad1 66.6 Neuron-cell body G3X9H5 Huntingtin Htt 344.6 Neuron-cell body Q9Z0E0-2 Neurochondrin Ncdn 77.4 Extracell.. matrix Q61830 Macrophage mannose receptor 1 (MRC1, Mrc1 1456 Microglia/ CD206) macrophage A2ARP8 Microtubule-associated protein 1A Map1a 325.7 Neuron-dendritic P14873 Microtubule-associated protein 1B Map1b 270.1 Neuron-dendritic P20357 Microtubule-associated protein 2 Map2 199 Neuron-dendritic Q7TSJ2 Microtubule-associated protein 6 Map6 96.4 Neuron-dendritic P04370 Myelin A1 protein (Golli-MBP) Mbp(A1) 27.2 Oligodendrocyte P04370-4 myelin basic protein isoform 4 MBP (4) 21.5 Oligodendrocyte Q3UR85 Myelin regulatory factor MYRF 123.3 Oligodendrocyte P60761 Neurogranin NRGN 8.2 Post-synaptic term. E0CY11 Neurexin-1 Nrxn1 164.1 Pre-synaptic term. Q6P9K9 Neurexin-3 Nrxn3 173.3 Pre-synaptic term. P55066 Neurocan core protein Ncan 137.1 Extracell. Matrix E9PW06 Neurofascin Nfasc 132.1 Neuron-axonal P19246 Neurofilament heavy polypeptide Nefh 116.9 Neuron-axonal P08551 Neurofilament light polypeptide Nef1 61.5 Neuron-axonal Q03517 Secretogranin-2 Scg 70.6 Pre-synaptic term. A3KGU5 Spectrin alpha chain, non-erythrocytic 1 Sptan1 282.7 Neuron-axonal Q62261 Spectrin beta chain, non-erythrocytic 1 Sptbn1 274.1 Neuron-axonal (isoform 2) Q64332-2 Synapsin-2 (isoform IIb) Syn 63.3 Pre-synaptic term. P46097 Synaptotagmin-2 Syt2 47.2 Pre-synaptic term. Q9D6F9 Tubulin beta-4A chain Tubb4a 49.6 Neuron-dendritic P68372 Tubulin beta-4B chain Tubb4b 49.8 Neuron-dendritic P20152-1 Vimentin Vim 53.7 astrocyte
Example 6
Identification of Neurogranin Peptide in Mouse Brain Lysate Ultrafiltrate
[0150]
TABLE-US-00007 TABLE 4 MS/MS Data for FIG. 5. SEQ ID NO: #1 b.sup.+ b.sup.2+ b.sup.3+ 187 y.sup.+ y.sup.2+ y.sup.3+ #2 1 98.06 49.53 33.36 P 37 2 155.08 78.04 52.37 G 3637.90 1819.45 1213.31 36 3 226.12 113.56 76.04 A 3580.88 1790.94 1194.30 35 4 340.16 170.58 114.06 N 3509.84 1755.43 1170.62 34 5 411.20 206.10 137.74 A 3395.80 1698.40 1132.61 33 6 482.24 241.62 161.42 A 3324.76 1662.89 1108.93 32 7 553.27 277.14 185.10 A 3253.73 1627.37 1085.25 31 8 624.31 312.66 208.77 A 3182.69 1591.85 1061.57 30 9 752.40 376.71 251.47 K 3111.65 1556.33 1037.89 29 10 865.49 433.25 289.17 I 2983.56 1492.28 995.19 28 11 993.55 497.28 331.85 Q 2870.47 1435.74 957.50 27 12 1064.58 532.80 355.53 A 2742.42 1371.71 914.81 26 13 1151.62 576.31 384.54 S 2671.38 1336.19 891.13 25 14 1298.69 649.85 433.57 F 2584.35 1292.68 862.12 24 15 1454.79 727.90 485.60 R 2437.28 1219.14 813.10 23 16 1511.81 756.41 504.61 G 2281.18 1141.09 761.06 22 17 1648.87 824.94 550.29 H 2224.15 1112.58 742.06 21 18 1795.90 898.45 599.31 M 2087.10 1044.05 696.37 20 (ox) 19 1866.94 933.97 622.98 A 1940.06 970.53 647.36 19 20 2023.04 1012.02 675.02 R 1869.02 935.02 623.68 18 21 2151.14 1076.07 717.72 K 1712.92 856.96 571.65 17 22 2279.23 1140.12 760.41 K 1584.83 792.92 528.95 16 23 2392.31 1196.66 798.11 I 1456.73 728.87 486.25 15 24 2520.41 1260.71 840.81 K 1343.65 672.33 448.55 14 25 2607.44 1304.22 869.82 S 1215.55 608.28 405.86 13 26 2664.46 1332.74 888.83 G 1128.52 564.76 376.85 12 27 2793.51 1397.26 931.84 E 1071.50 536.25 357.84 11 28 2953.54 1477.27 985.18 C 942.46 471.73 314.82 10 (carb) 29 3010.56 1505.78 1004.19 G 782.43 391.72 261.48 9 30 3166.66 1583.83 1056.22 R 725.41 363.21 242.47 8 31 3294.75 1647.88 1098.92 K 569.30 285.16 190.44 7 32 3351.77 1676.39 1117.93 G 441.21 221.11 147.74 6 33 3448.83 1724.92 1150.28 P 384.19 192.60 128.73 5 34 3505.85 1753.43 1169.29 G 287.14 144.07 96.38 4 35 3602.90 1801.95 1201.64 P 230.11 115.56 77.38 3 36 3659.92 1830.47 1220.65 G 133.06 67.03 45.03 2 37 G 76.04 38.52 26.02 1
TABLE-US-00008 TABLE 5 MS/MS Data for FIG. 6. SEQ ID NO: #1 b.sup.+ b.sup.2+ b.sup.3+ 188 y.sup.+ y.sup.2+ y.sup.3+ #2 1 116.03 58.52 39.35 D 26 2 231.06 116.03 77.69 D 2597.32 1299.16 866.45 25 3 346.09 173.55 116.03 D 2482.29 1241.65 828.10 24 4 459.17 230.09 153.73 I 2367.27 1184.14 789.76 23 5 572.26 286.63 191.42 L 2254.18 1127.59 752.07 22 6 687.28 344.15 229.77 D 2141.10 1071.05 714.37 21 7 800.37 400.69 267.46 I 2026.07 1013.54 676.03 20 8 897.42 449.21 299.81 P 1912.99 957.00 638.33 19 9 1010.50 505.76 337.51 L 1815.93 908.47 605.98 18 10 1125.53 563.27 375.85 D 1702.85 851.93 568.29 17 11 1240.56 620.78 414.19 D 1587.82 794.42 529.95 16 12 1337.61 669.31 446.54 P 1472.80 736.90 491.60 15 13 1394.63 697.82 465.55 G 1375.74 688.38 459.25 14 14 1465.67 733.34 489.23 A 1318.72 659.86 440.25 13 15 1579.71 790.36 527.24 N 1247.69 624.35 416.57 12 16 1650.75 825.88 550.92 A 1133.64 567.32 378.55 11 17 1721.79 861.40 574.60 A 1062.61 531.81 354.87 10 18 1792.82 896.92 598.28 A 991.57 496.29 331.19 9 19 1863.86 932.43 621.96 A 920.53 460.77 307.52 8 20 1991.96 996.48 664.66 K 849.49 425.25 283.84 7 21 2105.04 1053.02 702.35 I 721.40 361.20 241.14 6 22 2233.10 1117.05 745.04 Q 608.32 304.66 203.44 5 23 2304.14 1152.57 768.72 A 480.26 240.63 160.76 4 24 2391.17 1196.09 797.73 S 409.22 205.11 137.08 3 25 2538.24 1269.62 846.75 F 322.19 161.60 108.07 2 26 R 175.12 88.06 59.04 1
[0151] NGRN (NP_071312) PFs identified in TBI mice brain lysate ultrafiltrate samples are given in
[0152]
Example 7
Identification of Vimentin Peptide in Mouse Brain Lysate Ultrafiltrate
[0153]
TABLE-US-00009 TABLE 6 MS/MS Data for FIG. 8A. SEQ ID #1 b.sup.+ b.sup.2+ NO:192 y.sup.+ y.sup.2+ #2 1 58.03 29.52 G 34 2 225.03 113.02 S (p) 3747.65 1874.33 33 3 282.05 141.53 G 3580.65 1790.83 32 4 383.10 192.05 T 3523.63 1762.32 31 5 550.09 275.55 S (p) 3422.58 1711.80 30 6 717.09 359.05 S (p) 3255.59 1628.30 29 7 873.19 437.10 R 3088.59 1544.80 28 8 970.25 485.63 P 2932.49 1466.75 27 9 1057.28 529.14 S 2835.43 1418.22 26 10 1144.31 572.66 S 2748.40 1374.70 25 11 1258.35 629.68 N 2661.37 1331.19 24 12 1414.45 707.73 R 2547.33 1274.17 23 13 1501.49 751.25 S 2391.23 1196.12 22 14 1664.55 832.78 Y 2304.19 1152.60 21 15 1763.62 882.31 V 2141.13 1071.07 20 16 1864.67 932.84 T 2042.06 1021.53 19 17 1965.71 983.36 T 1941.01 971.01 18 18 2052.75 1026.88 S 1839.97 920.49 17 19 2153.79 1077.40 T 1752.94 876.97 16 20 2309.89 1155.45 R 1651.89 826.45 15 21 2410.94 1205.97 T 1495.79 748.40 14 22 2574.01 1287.51 Y 1394.74 697.87 13 23 2661.04 1331.02 S 1231.68 616.34 12 24 2774.12 1387.56 L 1144.64 572.83 11 25 2831.14 1416.08 G 1031.56 516.28 10 26 2918.18 1459.59 S 974.54 487.77 9 27 2989.21 1495.11 A 887.51 444.26 8 28 3102.30 1551.65 L 816.47 408.74 7 29 3258.40 1629.70 R 703.38 352.20 6 30 3355.45 1678.23 P 547.28 274.15 5 31 3442.48 1721.74 S 450.23 225.62 4 32 3543.53 1772.27 T 363.20 182.10 3 33 3630.56 1815.78 S 262.15 131.58 2 34 R 175.12 88.06 1
TABLE-US-00010 TABLE 7 MS/MS Data for FIG. 8B. SEQ ID NO: #1 b.sup.+ b.sup.2+ b.sup.3+ 193 y.sup.+ y.sup.2+ y.sup.3+ #2 1 115.05 58.03 39.02 N 31 2 228.13 114.57 76.72 L 3564.8 1782.9 1188.9 30 3 357.18 179.09 119.73 E 3451.7 1726.4 1151.2 29 4 524.18 262.59 175.40 S 3322.7 1661.8 1108.2 28 (p) 5 637.26 319.13 213.09 L 3155.7 1578.3 1052.6 27 6 734.31 367.66 245.44 P 3042.6 1521.8 1014.9 26 7 847.40 424.20 283.14 L 2945.5 1473.3 982.5 25 8 946.46 473.74 316.16 V 2832.5 1416.7 944.8 24 9 1061.49 531.25 354.50 D 2733.4 1367.2 911.8 23 10 1162.54 581.77 388.18 T 2618.4 1309.7 873.5 22 11 1299.60 650.30 433.87 H 2517.3 1259.2 839.8 21 12 1466.60 733.80 489.54 S 2380.3 1190.6 794.1 20 (p) 13 1594.69 797.85 532.24 K 2213.3 1107.1 738.4 19 14 1750.79 875.90 584.27 R 2085.2 1043.1 695.7 18 15 1851.84 926.42 617.95 T 1929.1 965.0 643.7 17 16 1964.92 982.97 655.65 L 1828.0 914.5 610.0 16 17 2078.01 1039.51 693.34 L 1714.9 858.0 572.3 15 18 2191.09 1096.05 731.04 I 1601.8 801.4 534.6 14 19 2319.19 1160.10 773.73 K 1488.8 744.9 496.9 13 20 2420.24 1210.62 807.42 T 1360.7 680.8 454.2 12 21 2519.30 1260.16 840.44 V 1259.6 630.3 420.5 11 22 2648.35 1324.68 883.45 E 1160.6 580.8 387.5 10 23 2749.39 1375.20 917.14 T 1031.5 516.3 344.5 9 24 2905.49 1453.25 969.17 R 930.5 465.7 310.8 8 25 3020.52 1510.76 1007.51 D 774.4 387.7 258.8 7 26 3077.54 1539.28 1026.52 G 659.3 330.2 220.5 6 27 3205.60 1603.30 1069.21 Q 602.3 301.7 201.4 5 28 3304.67 1652.84 1102.23 V 474.3 237.6 158.8 4 29 3417.75 1709.38 1139.92 I 375.2 188.1 125.7 3 30 3531.80 1766.40 1177.94 N 262.1 131.6 88.0 2 31 E 148.1 74.5 50.0 1
[0154]
Example 8
Characterization of Myelin Basic Protein Protein Breakdown Products and Peptide Fragments in Mouse Brain after TBI
[0155]
TABLE-US-00011 TABLE 8 MS/MS Data for FIG. 10A. SEQ ID b.sup.+ b.sup.2+ NO: 196 y.sup.+ y.sup.2+ 1 129.18 65.09 K 11 2 243.29 122.15 N 1092.28 546.65 10 3 356.45 178.73 I 978.18 489.59 9 4 455.58 228.29 V 865.02 433.01 8 5 556.68 278.85 T 765.89 383.45 7 6 653.80 327.40 P 664.78 332.90 6 7 809.99 405.50 R 567.67 284.34 5 8 911.09 456.05 T 411.48 206.24 4 9 1008.21 504.61 P 310.37 155.69 3 10 1105.33 553.17 P 213.26 107.13 2 11 P 116.14 58.57 1
[0156]
Example 9
Characterization of Brain Acidic Soluble Protein 1 Peptides
[0157]
TABLE-US-00012 TABLE 9 MS/MS Data for FIG. 11. SEQ ID b.sup.+ b.sup.2+ NO:227 y.sup.+ y.sup.2+ 1 130.12299 65.56519 E 13 2 201.201669 101.10454 A 1089.14629 545.07684 12 3 298.31849 149.66294 P 1018.06759 509.53749 11 4 369.39719 185.20229 A 920.95079 460.97909 10 5 440.47589 220.74164 A 849.87209 425.43974 9 6 511.55459 256.28099 A 778.79339 389.90039 8 7 582.63329 291.82034 A 707.71469 354.36104 7 8 669.71129 335.35934 S 636.63599 318.82169 6 9 756.78929 378.89834 S 549.55799 275.28269 5 10 885.90489 443.45614 E 462.47999 231.74369 4 11 1014.03580 507.52160 Q 333.36439 167.18589 3 12 1101.11380 551.06060 S 205.23348 103.12044 2 13 V 118.15548 59.58144 1
Example 10
Human Glial Fibrillary Protein N- and C-Peptidome—In Vitro Calpain Digestion
[0158] The peptides identified in this Example show the distinct PFs released into the fluid biological sample ultrafiltrate of in vitro calpain proteolyzed human GFAP protein. This method mimics the human TBI conditions where calpain is known to be hyperactivated and to attack cellular proteins in the brain.
[0159]
[0160]
[0161] Table 11 shows the GFAP PFs identified in ultrafiltrate samples from a calpain-digested sample of purified human GFAP protein. The calpain proteolysis mimics CNS traumatic injury-induced calpain activation. A number of GFAP PFs were identified, as shown in Table 11, below.
[0162] The sequence of human GFAP (Accession No. P14136; 432 amino acids; GI:251802) is as below (regions with GFAP PFs identified are shown in bold).
TABLE-US-00013 SEQ ID NO: 236 MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRV DFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAE LNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLAT VRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFL RKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRTQYEAMASSNM HEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLR GTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQ DLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVS EGHLKRNIVVKTVEMRDGEVIKESKQEHKDVM
TABLE-US-00014 TABLE 11 Peptide Fragments Released from Human GFAP (P14136) upon in Vitro Calpain Proteolysis. # MH+ m/z SEQ ID Sequence aa # PSMs ΔCn XCorr Charge [Da] [Da] NO: AARRSYVSSGEMMV 9-28 1 0.0000 2.05 2 1997.33 998.66 237 GGLAPG ARRSYVSSGEMMVG 10-29 1 0.0000 2.23 2 2079.79 1039.89 238 GLAPGR RRSYVSSGEMmVGG 11-27 1 0.0122 1.81 3 1812.07 604.02 239 LAP RSYVSSGEmmVGGL 11-30 1 0.0000 1.41 2 2041.77 1020.88 240 APGRR YVSSGEmMVGGLAP 14-27 2 0.0000 1.80 3 1414.29 471.43 241 FSNLQIRET 384-391 2 0.0000 2.24 2 1108.15 554.08 242 FSNLQIRETS 384-392 1 0.0000 2.35 2 1194.65 597.32 243 SNLQIRETSLDTKS 385-396 2 0.0000 2.20 3 1593.59 531.20 244 SNLQIRETSLDTK 385-396 1 0.0000 1.78 3 1506.11 502.04 245 SNLQIRETSLDTKSVS 385-398 1 0.0000 2.92 3 1776.46 592.15 246 QIRETSLDTKSVS 388-400 2 0.0000 2.55 3 1464.58 488.19 247 DGEVIKESK 416-423 9 0.0000 2.36 2 1005.51 502.76 248
[0163] Since GFAP is a major astrogial protein that is also involved in post-injury gliosis (glia cell hypertrophy and proliferation), the release of GFAP PFs can indicate astroglia cell injury. Thus, this example shows that biofluid-based monitoring of the GFAP-released PFs can be used to monitor astroglia injury mediated by calpain activation.
Example 11
Calpain Digestion of Tau-441
[0164] Table 11 shows Tau PFs, generated by calpain digestion of Tau-441 protein and are found in ultrafiltrate samples. Tau-441 PFs generated by calpain digestion (mimicking TBI) include Tau N-terminal region peptide 1 AEPRQEFEVMEDHAGTYGLG (aa 2-21; SEQ ID NO:249); Tau N-terminal region peptide 2AAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQARMVS (aa 90-123; SEQ NO:250); Tau center region peptide LSKVTSKCGSLG (aa 315-326; SEQ ID NO:251); Tau C-terminal region peptide 1 SPRHLSNVSSTGSIDMVDSPQLA (aa 404-426; SEQ ID NO:252); and Tau C-terminal region peptide 2 TLADEVSASLAKQGL (aa 427-441; SEQ ID NO:253). Table 11 lists further PFs along with MS/MS data for PFs found in TBI subject CSF ultrafiltrate samples or derived from in vitro calpain digestion of Tau and phospho-Tau protein (Tau-441; a model that mimics CNS traumatic injury-induced calpain activation).
[0165] The sequence of human Tau-441 (microtubule-associated protein Tau isoform 2; P10636-8) is:
TABLE-US-00015 SEQ ID NO: 254 MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQT PTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEG TTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTK IATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSP GSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPM PDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHV PGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRV QSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVS GDTSPRHLSNVSSTGSIDMV DSPQLATLADEVSASLAKQGL.
[0166] The Tau PFs identified are shown in bold. Key Tau PFs identified here are shown in Table 12, below.
TABLE-US-00016 TABLE 12 Human Tau-441 Peptide Fragments (released by calpain digestion) as Identified by LC-MS/MS. SEQ proteolysis Positions Theo. ID of Tau or in Protein MH+ m/z ΔM NO Annotated Sequence P-Tau Proteins MOdifications PSMs (Da) Charge (Da) (ppm) XCorr 255 AEPRQEFEVMEDHA Tau 2-19 none 65 2065.89 3 689.625 468.96 4.71 GTYG 256 KPVDLSKVTSKCG P-Tau 311-323 none 2 1361.746 2 681.415 56.61 3.44 257 LSKVTSKCGSLG Tau 315-326 none 46 1179.64 1 1179.6 −31.01 3.73 258 RENAKAKTDHGAEI Tau 379-403 none 26 2672.36 3 891.934 533.08 5.3 VYKSPVVSGDT 259 KSPVVSGDTSPRHLS P-Tau 395-412 P10636-8 17 2106.866 2 1054.207 256.77 5.4 NVS 3xPhospho [S396(100); S400(100); S404(88.9)] 260 KSPVVSGDTSPRHLS P-Tau 395-426 P10636-8 2 3508.51 3 1170.501 278.43 5.01 NVSSTGSIDMVDSPQ 3xPhospho LA [S396(99)] 261 SPRHLSNVSSTGSID Tau 404-426 none 39 2414.16 2 1208.29 582.72 5.95 MVDSPQLA 262 STGSIDMVDSPQLA P-Tau 413-426 P10636-8 40 1500.629 2 751.0989 374.32 4.18 1xPhospho [S416(99.9)] 263 STGSIDMVDSPQLA P-Tau 413-426 none 37 1420.662 2 711.1865 495.08 4.2 264 TLADEVSASLAKQG Tau 427-441 none 37 1502.81 3 502.358 1498.97 4.47 L.[-] 265 ASLAKQGL.[-] Tau 434-441 none 32 787.467 2 394.375 349.85 2.51
[0167]
TABLE-US-00017 TABLE 13 MS/MS Data for FIG. 13B. SEQ ID #1 b.sup.+ b.sup.2+ b.sup.3+ NO:268 y.sup.+ y.sup.2+ y.sup.3+ #2 1 72.04439 36.52593 24.68631 A 18 2 201.08698 101.04713 67.70051 E 1994.85488 997.93108 665.62314 17 3 298.13975 149.57351 100.05143 P 1865.81229 933.40978 622.60895 16 4 454.24086 227.62407 152.08514 R 1768.75952 884.88340 590.25803 15 5 582.29944 291.65336 194.77133 Q 1612.65841 806.83284 538.22432 14 6 711.34203 356.17465 237.78553 E 1484.59984 742.80356 495.53813 13 7 858.41044 429.70886 286.80833 F 1355.55724 678.28226 452.52393 12 8 987.45304 494.23019 329.82253 E 1208.48883 604.74805 403.50113 11 9 1086.52145 543.76436 362.84533 V 1079.44624 540.22676 360.48693 10 10 1217.56193 609.28461 406.52550 M 980.37782 490.69255 327.46412 9 11 1346.60453 673.80590 449.53969 E 849.33734 425.17231 283.78396 8 12 1461.63147 731.31937 487.88201 D 720.29474 360.65101 240.76977 7 13 1598.69038 799.84883 533.56831 H 605.26780 303.13754 202.42745 6 14 1669.72750 835.36739 557.24735 A 468.20889 234.60808 156.74115 5 15 1726.74896 86.87812 576.25450 G 397.17178 199.08953 133.06211 4 16 1827.79664 914.40196 609.93706 T 340.15031 170.57879 114.05496 3 17 1990.85997 995.93362 664.29151 Y 239.10263 120.05496 80.37240 2 18 G 76.03930 38.52329 26.01795 1
TABLE-US-00018 TABLE 14 MS/MS Data for FIG. 13C. SEQ ID #1 b.sup.+ b.sup.2+ NO:269 y.sup.+ y.sup.2+ #2 1 102.05496 51.53112 T 15 2 215.13902 108.07315 L 1401.75838 701.38283 14 3 286.17613 143.59170 A 1288.67432 644.84080 13 4 401.20308 201.10518 D 1217.63721 609.32224 12 5 530.24567 265.62647 E 1102.61026 551.80877 11 6 629.31408 315.16068 V 973.56767 487.28747 10 7 716.34611 358.67699 S 874.49926 437.75327 9 8 787.38322 394.19525 A 787.46723 394.23725 8 9 874.41525 437.71126 S 716.43012 358.71870 7 10 987.49932 494.25330 L 629.39809 315.20268 6 11 1058.53643 529.77185 A 516.31402 258.66065 5 12 1186.63139 593.81934 K 445.27691 223.14209 4 13 1314.68997 657.84862 Q 317.18195 159.09461 3 14 1371.71143 686.35936 G 189.12337 95.06532 2 15 L 132.10191 66.55459 1
[0168]
Example 12
Summary Chart of Additional Cortical and Hippocampus Fragments
[0169] Table 15, below shows the origin of PBP and PF biomarkers derived from additional proteins in mouse cortex or hippocampal ultrafiltrate samples after TBI (day 1 to day 3 post-injury. This example further supports use of biofluid-based monitoring of either specific brain protein PBPs or their unique PFs to inform on different brain vulnerabilities after brain injury (i.e., axonal marker astroglia, myelin and presynaptic terminal damage, respectively).
TABLE-US-00019 TABLE 15 Representative Peptide Fragments Identified from Mouse CCI (TBI) Cortex or Hippocampal Ultrafiltrate Samples. Full Protein Name (Mouse Gene Name) Protein Mouse Accession Sequence Number of PMSs/ Group MH+ ΔM m/z RT SEQ ID NO Number (Amino Acid Residues) Proteins/Groups Accesions Modifications XCorr Charge [Da] [ppm] [Da] [min] 270 Amyloid beta A4 GAPGNSEQDFMSD 1/1/1 Q8R5A3 2.05 3 1355.64 189.12 452.55 55.71 precursor protein- (645-656) binding family B member 1-interacting protein (Apbb1ip) Q8R5A3 271 Calmodulin-regulated IQALAQKGLY 1/3/1 H7BX08 2.36 3 1105.93 544.05 369.31 14.96 spectrin-associated (104-115) protein 2 (Camsap2) H7BX08 272 Calmodulin-regulated MGAHLAVI 1/3/1 E9Q5B0 2.41 2 812.61 720.42 406.81 14.98 spectrin-associated (134-141) protein 3 (Camsap3) E9Q5B0 273 Chondroitin sulfate FFGENHLEVPVPSAL 1/2/1 Q8VHY0 2.10 3 3372.22 −173.21 1124.75 70.85 proteoglycan 4 TRVDLLLQFSTSQPE (Cspg4) Q8VHY0 (32-61) 274 Disks large homolog 2, TmPSSGPGGPAS 2/2/1 Q91XM9-4 M2 (Oxidation) 2.20 2 1061.62 −494.62 531.31 99.75 isoform 4, PSD93-delta (50-61) (Dlg2) Q91XM9 275 Glial fibrillary acidic EERHARESASYQEAL 1/2/1 P03995-2 2.55 3 4548.34 −116.66 1516.79 90.67 protein (Gfap) P03995-2 ARLEEEGQSLKEEMA RHLQEYQD (311-348) 276 Glutamate RVAPKIKALMMESG 1/1/1 P48318 M32(Oxidation) 2.32 3 3834.34 189.17 1278.78 76.00 decarboxylase 1 TTMVGYQPQGDKAN (Gad1) P48318 FFRmVI (536-579) 277 Glutamate LEYVTLKK 1/1/1 P48320 2.21 2 994.66 442.34 497.83 15.83 decarboxylase 2 (215-223) (Gad2) P48320 278 Huntingtin (Htt) QQVKDTSLKGSFGVT 1/3/1 G3X9115 M19 (Oxidation) 2.23 3 2155.76 −331.23 719.26 43.38 G3X9H5 RKEm (306-325) 279 Neurochondrin (Ncdn) LKEPQKVQLVSIMKE 1/2/1 Q9Z0E0-2 2.24 3 1955.92 258.88 652.65 53.22 Q9Z0E0-2 AI (339-355) 280 Macrophage mannose DEQVQFTHWNADMP 1/1/1 Q61830 C20 2.21 3 4352.66 −56.09 1451.56 67.94 receptor 1 (MRC1, GRKAGcVAMKTGVA (Carbamidomethyl); CD206)(Mrc1) GGLWDVLScEE (581- C37 Q61830 619) (Carbamidomethyl) 281 Microtubule-associated IQAEPLYRVVSNTIEP 1/3/1 A2ARP8 M30 (Oxidation) 2.12 3 4979.38 102.20 1660.46 96.18 protein 1A (Map1a) LTLFHKMGVGRLDm A2ARP8 YVLNPVKDSKEMQ (409-451) 282 Microtubule-associated NASASKSAKTATAGP 1/1/1 P14873 C37 2.06 3 3650.08 −19.20 1217.36 65.84 protein 1B (Map1b) GTTKTAKSSTVPPGL (Carbamidomethyl) P14873 PVYLDLc (2340-2357) 283 Microtubule-associated SPGPLTPMREKDVLE 1/4/1 P20357 2.27 3 3639.09 −16.87 1213.70 83.79 protein 2 (Map2) DIPRWEGKQFDSPMP P20357 SP (283-314) 284 Microtubule-associated SVDRETVAAPGRSGL 1/3/1 Q7TSJ2 2.00 3 2616.14 −255.48 872.72 60.50 protein 6 (Map6) GLGAASASTSGSGP Q7TSJ2 (86-114) 285 Myelin A1 protein HYGSLPQKSQ 1/17/2 P04370; 2.70 2 1145.83 499.19 573.42 10.27 (GOLI-MBP) (198-207) F6VME3 (Mbp(A1)) P04370 286 Myelin basic protein KNIVTPRTPPPSQGK 1/15/4 P04370; 3.78 3 1677.61 −202.90 559.87 10.10 isoform 4 (MBP (4)) G (114-130) F6RT34; P04370-4 F6TYB7; F7A0B0 287 Myelin regulatory RKHSESPPNTLN 1/4/1 Q3UR85 2.07 3 1380.40 −74.32 460.81 43.81 factor (MYRF) (256-267) Q3UR85 288 Neurogranin (NRGN) AAKIQASF (27-37) 2/1/1 P60761 2.89 2 836.53 664.08 418.77 26.19 P60761 289 Neurexin-1 (Nrxn1) RLVGEVPSSmTTEST 1/10/2 E0CY11; M10 (Oxidation) 2.32 3 1854.09 21.19 618.70 98.25 E0CY11 ATA (1313-1330) P0DI97 290 Neurexin-3, isoform IMTEKRYISVVPSSFI 1/3/1 Q6P9K9 M23 (Oxidation); 2.28 3 4830.21 116.74 1610.74 77.78 2a (Nrxn3) Q6P9K9-2 GHLQSLmFNGLLYID C33 LcKNGDIDYc (444-484) (Carbamidomethyl); C41 (Carbamidomethyl) 291 Neurocan core protein TIAAPVEASHRSPDA 1/1/1 P55066 1.99 3 4377.09 −161.54 1459.70 73.06 (Ncan) P55066 DSIEIEGTSSMRATKH PISGPWASLDS (699- 740) 292 Neurofascin (Nfasc) DIYSARGVAERTPSF 1/1/1 E9PW06 C37 1.50 3 4352.19 −194.02 1451.40 70.08 E9PW06 MYPQGTSSSQMVLR (Carbamidomethyl) GMDLLLEcIA (243- 281) 293 Neurofilament heavy KmEAKVKEDDKSLS 1/1/1 P19246 M2 (Oxidation) 2.16 3 3469.62 204.48 1157.21 63.22 polypeptide (Neth) KEPSKPKTEKAEKSS P19246 ST (1039-1069) 294 Neurofilament light YSQSSQVFGRSAYSG 1/1/1 P08551 M23 (Oxidation) 2.09 2 3918.73 −129.67 1959.87 83.77 polypeptide (Nefl) LQSSSYLmSARSFPA P08551 YYTSH (413-447) 295 Secretogranin-2 (Scg) IPVGSLKNEDTPN 1/1/1 Q03517 3.07 2 1385.27 537.32 693.14 24.77 Q03517 (569-581) 296 Spectrin alpha chain, LIERGAcAGSEDAVK 1/5/1 A3KGU5 C7 2.07 3 4046.98 −149.39 1349.67 63.35 non-erythrocytic 1 ARLAALADQWQFLV (Carbamidomethyl) (Sptan1) A3KGU5 QKSAEKSQ (601- 1637) 297 Spectrin beta chain, TLEGAEAAIKKQEDF 1/2/1 Q62261-2 M19 (Oxidation) 2.11 3 3914.52 39.15 1305.51 67.94 non-erythrocytic 1 MTTmDANEEKINAV (isoform 2)(Sptbn1) VETGRR (1187-1221) Q62261 298 Synapsin-2 (isoform MTDLQRPEPQQPPPA 1/2/1 Q64332-2 2.15 3 3511.49 −104.38 1171.17 90.86 IIb)(Syn)Q64332-2 PGPGAATASAATSAA SPGPER (23-58) 299 Synaptotagmin-2 YDKLGKNEAIGKI 1/1/1 P46097 2.19 3 1449.18 −354.60 483.73 22.23 (Syt2) P46097 (364-377) 300 Tubulin beta-4A chain KNmmAAcDPRHGRY 1/1/1 Q9D6F9 M3 (Oxidation); M4 2.13 3 4253.07 24.02 1418.36 73.26 (Tubb4a) Q9D6F9 LTVAAVFRGRmSmK (Oxidation); C7 EVDEQMLS (297-332) Carbamidomethyl); M25 (Oxidation); M27 (Oxidation) 301 Tubulin beta-4B chain AmFRRKAFLHWYTG 1/6/2 P68372; M2 (Oxidation); (Tubb4b) P68372 EGmDEmEFTEAES Q9ERD7 M17 (Oxidation); (387-418) M20 (Oxidation) 2.13 2 3320.40 213.45 1660.70 90.45 302 Vimentin P20152-1 VSSSSYRRMFGGSGT 1/1/1 P20152 M9 (Oxidation) 2.16 3 2553.19 330.04 851.06 15.11 SSRPSSNRS (06-27)
Example 13
Identification of Neurogranin Peptide
[0170]
TABLE-US-00020 TABLE 16 MS/MS Data for FIG. 14A. SEQ ID #1 b.sup.+ b.sup.2+ b.sup.3+ b.sup.4+ b.sup.5+ b.sup.6+ NO:304 y.sup.+ y.sup.2+ y.sup.3+ y.sup.4+ y.sup.5+ y.sup.6+ #2 1 114.09 57.55 38.70 29.28 23.62 19.85 I 49 2 227.18 114.09 76.40 57.55 46.24 38.70 L 4874.51 2437.76 1625.51 1219.38 975.71 813.26 48 3 342.20 171.60 114.74 86.31 69.25 57.87 D 4761.43 2381.22 1587.81 1191.11 953.09 794.41 47 4 455.29 228.15 152.43 114.58 91.86 76.72 I 4646.40 2323.70 1549.47 1162.36 930.09 775.24 46 5 552.34 276.67 184.78 138.84 111.27 92.90 P 4533.32 2267.16 1511.78 1134.08 907.47 756.39 45 6 665.42 333.22 222.48 167.11 133.89 111.74 L 4436.26 2218.64 1479.43 1109.82 888.06 740.22 44 7 780.45 390.73 260.82 195.87 156.90 130.91 D 4323.18 2162.09 1441.73 1081.55 865.44 721.37 43 8 895.48 448.24 299.16 224.62 179.90 150.09 D 4208.15 2104.58 1403.39 1052.79 842.44 702.20 42 9 992.53 496.77 331.51 248.89 199.31 166.26 P 4093.13 2047.07 1365.05 1024.04 819.43 683.03 41 10 1049.55 525.28 350.52 263.14 210.72 175.76 G 3996.07 1998.54 1332.70 999.77 800.02 666.85 40 11 1120.59 560.80 374.20 280.90 224.92 187.60 A 3939.05 1970.03 1313.69 985.52 788.62 657.35 39 12 1234.63 617.82 412.22 309.41 247.73 206.61 N 3868.01 1934.51 1290.01 967.76 774.41 645.51 38 13 1305.67 653.34 435.89 327.17 261.94 218.45 A 3753.97 1877.49 1252.00 939.25 751.60 626.50 37 14 1376.71 688.86 459.57 344.93 276.15 230.29 A 3682.93 1841.97 1228.32 921.49 737.39 614.66 36 15 1447.74 724.38 483.25 362.69 290.35 242.13 A 3611.90 1806.45 1204.64 903.73 723.19 602.82 35 16 1518.78 759.89 506.93 380.45 304.56 253.97 A 3540.86 1770.93 1180.96 885.97 708.98 590.98 34 17 1646.87 823.94 549.63 412.47 330.18 275.32 K 3469.82 1735.41 1157.28 868.21 694.77 579.14 33 18 1759.96 880.48 587.32 440.75 352.80 294.17 I 3341.73 1671.37 1114.58 836.19 669.15 557.79 32 19 1888.02 944.51 630.01 472.76 378.41 315.51 Q 3228.64 1614.83 1076.89 807.92 646.53 538.95 31 20 1959.05 980.03 653.69 490.52 392.62 327.35 A 3100.58 1550.80 1034.20 775.90 620.92 517.60 30 21 2126.05 1063.53 709.36 532.27 426.02 355.18 S (p) 3029.55 1515.28 1010.52 758.14 606.72 505.76 29 22 2273.12 1137.06 758.38 569.04 455.43 379.69 F 2862.55 1431.78 954.85 716.39 573.32 477.93 28 23 2429.22 1215.11 810.41 608.06 486.65 405.71 R 2715.48 1358.24 905.83 679.63 543.90 453.42 27 24 2486.24 1243.63 829.42 622.32 498.05 415.21 G 2559.38 1280.19 853.80 640.60 512.68 427.40 26 25 2623.30 1312.16 875.11 656.58 525.47 438.06 H 2502.36 1251.68 834.79 626.35 501.28 417.90 25 26 2770.34 1385.67 924.12 693.34 554.87 462.56 M (ox) 2365.30 1183.15 789.10 592.08 473.87 395.06 24 27 2841.38 1421.19 947.80 711.10 569.08 474.40 A 2218.26 1109.64 740.09 555.32 444.46 370.55 23 28 2997.48 1499.24 999.83 750.12 600.30 500.42 R 2147.23 1074.12 716.41 537.56 430.25 358.71 22 29 3125.57 1563.29 1042.53 782.15 625.92 521.77 K 1991.13 996.07 664.38 498.54 399.03 332.69 21 30 3253.67 1627.34 1085.23 814.17 651.54 543.12 K 1863.03 932.02 621.68 466.51 373.41 311.34 20 31 3366.75 1683.88 1122.92 842.44 674.16 561.96 I 1734.94 867.97 578.98 434.49 347.79 290.00 19 32 3494.85 1747.93 1165.62 874.47 699.77 583.31 K 1621.85 811.43 541.29 406.22 325.18 271.15 18 33 3581.88 1791.44 1194.63 896.22 717.18 597.82 S 1493.76 747.38 498.59 374.19 299.56 249.80 17 34 3638.90 1819.95 1213.64 910.48 728.59 607.32 G 1406.72 703.87 469.58 352.44 282.15 235.29 16 35 3767.94 1884.47 1256.65 942.74 754.39 628.83 E 1349.70 675.36 450.57 338.18 270.75 225.79 15 36 3924.04 1962.52 1308.69 981.77 785.61 654.85 R 1220.66 610.83 407.56 305.92 244.94 204.28 14 37 3981.06 1991.04 1327.69 996.02 797.02 664.35 G 1064.56 532.78 355.52 266.90 213.72 178.27 13 38 4137.17 2069.09 1379.73 1035.05 828.24 690.37 R 1007.54 504.27 336.52 252.64 202.31 168.76 12 39 4265.26 2133.13 1422.42 1067.07 853.86 711.72 K 851.44 426.22 284.48 213.61 171.09 142.75 11 40 4322.28 2161.64 1441.43 1081.33 865.26 721.22 G 723.34 362.17 241.79 181.59 145.47 121.40 10 41 4419.33 2210.17 1473.78 1105.59 884.67 737.40 P 666.32 333.66 222.78 167.34 134.07 111.89 9 42 4476.36 2238.68 1492.79 1119.84 896.08 746.90 G 569.27 285.14 190.43 143.07 114.66 95.72 8 43 4573.41 2287.21 1525.14 1144.11 915.49 763.07 P 512.25 256.63 171.42 128.82 103.26 86.21 7 44 4630.43 2315.72 1544.15 1158.36 926.89 772.58 G 415.19 208.10 139.07 104.55 83.84 70.04 6 45 4687.45 2344.23 1563.16 1172.62 938.30 782.08 G 358.17 179.59 120.06 90.30 72.44 60.53 5 46 4784.50 2392.76 1595.51 1196.88 957.71 798.26 P 301.15 151.08 101.06 76.04 61.04 51.03 4 47 4841.53 2421.27 1614.51 1211.14 969.11 807.76 G 204.10 102.55 68.70 51.78 41.63 34.86 3 48 4898.55 2449.78 1633.52 1225.39 980.52 817.26 G 147.08 74.04 49.70 37.52 30.22 25.35 2 49 A 90.05 45.53 30.69 23.27 18.82 15.85 1
[0171] The NGRN PFs included those listed in Table 17, below. The full sequence of NRGN (78 amino acids) is
TABLE-US-00021 SEQ ID NO: 305 MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKI KSGERGRKGPGPGGPGGAGVARGGAGGGPSGD.
[0172] Underlined residues show the area in the sequence where PFs are produced.
[0173]
[0174] Table 17 is a representation showing the NRGN-derived PFs generated and released into CSF from human TBI subjects. Duplicate PFs found are not shown. None of the PFs shown was found in non-injured control CSF samples.
TABLE-US-00022 TABLE 17 Neurogranin-Derived Peptide Fragments Released after TBI in Human Subjects. Amino Acid SEQ Residues of ID Name Sequence Neurogranin NO Neurogranin ILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRK 18-64 306 Peptide 1 GPGPGGPGGA Neurogranin ILDIPLDDPGANAAAAKIQAS(p)FRGHMARKKIKSGERGR 18-64 307 Peptide 2 KGPGPGGPGGA Neurogranin DDDILDIPLDDPGANAAAAKIQASFR 13-38 308 Peptide 3 Neurogranin DDDILDIPLDDPGANAAAAKIQAS(p)FR 13-38 309 Peptide 4 Neurogranin PGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGG 24-65 310 Peptide 5 Neurogranin PGANAAAAKIQAS(p)FRGHMARKKIKSGERGRKGPGPGG 24-65 311 Peptide 6
[0175]
[0176]
Example 14
Vimentin Peptide Fragments and Vimentin-PBP in CSF from Human TBI Subjects
[0177] VIM PFs Identified from human TBI subjects also were characterized.
TABLE-US-00023 TABLE 18 MS/MS Data for FIG. 15A. SEQ ID #1 b.sup.+ b.sup.2+ NO:313 y.sup.+ y.sup.2+ #2 1 115.05 58.03 N 12 2 214.12 107.56 V 1283.63 642.32 11 3 342.21 171.61 K 1184.56 592.79 10 4 473.25 237.13 M 1056.47 528.74 9 5 544.29 272.65 A 925.43 463.22 8 6 657.38 329.19 L 854.39 427.70 7 7 772.40 386.70 D 741.31 371.16 6 8 885.49 443.25 I 626.28 313.64 5 9 1014.53 507.77 E 513.20 257.10 4 10 1127.61 564.31 I 384.15 192.58 3 11 1198.65 599.83 A 271.07 136.04 2 12 T (p) 200.03 100.52 1
[0178]
TABLE-US-00024 TABLE 19 MS/MS Data for FIG. 15B. SEQ ID #1 b.sup.+ b.sup.2+ b.sup.3+ b.sup.4+ NO:315 y.sup.+ y.sup.2+ y.sup.3+ y.sup.4+ #2 1 114.09134 57.54931 38.70196 29.27829 L 22 2 227.17540 114.09134 76.39665 57.54931 L 2531.19426 1266.10077 844.40294 633.55402 21 3 356.21800 178.61264 119.41085 89.80996 E 2418.11020 1209.55874 806.70825 605.28301 20 4 413.23946 207.12337 138.41800 104.06532 G 2289.06760 1145.03744 763.69405 573.02236 19 5 542.28025 271.64467 181.43220 136.32597 E 2232.04614 1116.52671 744.68690 558.76699 18 6 671.32465 336.16596 224.44640 168.58662 E 2103.00355 1052.00541 701.67270 526.50634 17 7 758.35668 379.68198 253.45708 190.34463 S 1973.96095 987.48412 658.65850 494.24570 16 8 914.45779 457.73253 305.49078 229.36990 R 1886.92893 943.96810 629.64783 472.48769 15 9 1027.54185 514.27456 343.18547 257.64092 I 1730.82782 865.91755 577.61412 433.46241 14 10 1194.54021 597.77374 398.85159 299.39051 S (p) 1617.74375 809.37551 539.91943 405.19140 13 11 1307.62427 654.31578 436.54628 327.66153 L 1450.74539 725.87633 484.25332 363.44181 12 12 1404.67704 702.84216 468.89720 351.92472 P 1337.66133 669.33430 446.55863 335.17079 11 13 1517.76110 759.38419 506.59188 380.19573 L 1240.60856 620.80792 414.20771 310.90760 10 14 1614.81387 807.91057 538.94281 404.45892 P 1127.52450 564.26589 376.51302 282.63658 9 15 1728.85679 864.93203 576.95712 432.96966 N 1030.47174 515.73951 344.16210 258.37339 8 16 1875.92521 938.46624 625.97992 469.73676 F 916.42881 458.71804 306.14779 229.86266 7 17 2042.92357 1021.96542 681.64604 511.48635 S (p) 769.36040 385.18384 257.12498 193.09556 6 18 2129.95559 1065.48144 710.65672 533.24436 S 602.36204 301.68466 201.45886 151.34597 5 19 2243.03966 1122.02347 748.35140 561.51537 L 515.33001 258.16864 172.44819 129.58796 4 20 2357.08259 1179.04493 786.36571 590.02610 N 402.24594 201.62661 134.75350 101.31694 3 21 2470.16665 1235.58696 824.06040 618.29712 L 288.20302 144.60515 96.73919 72.80621 2 22 R 175.11895 88.06311 59.04450 44.53520 1
[0179] The amino acid sequence of human VIM (accession #P08670) is:
TABLE-US-00025 SEQ ID NO: 316 MSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRP STSRSLYASSPGGVYATRSSAVRLRSSVPGVRLLQDSVDFSLADAI NTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQL KGQGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMR LREKLQEEMLQREEAENTLQSFRQDVDNASLARLDLERKVESLQEE IAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQY ESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQ VQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDE IQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLP LPNFSSLNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQ HHDDLE.
[0180] Residues underlined and in bold show the areas which the VIM PFs are released.
[0181]
[0182] Preferred PFs according to the invention include those listed in Table 20 below and in
TABLE-US-00026 TABLE 20 Vimentin-Derived Peptide Fragments Released after TBI in Human Subjects. Amino Acid SEQ Residues of ID Name Sequence Vimentin NO “Vimentin NVKMALDIEIAT 388-399 317 C-terminal Peptide 1” ”Vimentin LLEGEESRISLPLPNFSSLNLR 403-424 318 C-terminal Peptide 2” “Vimentin NVKMALDIEIATYRKLLEGEESRISLPLPNFSSLNLRE 388-456 319 C-terminal TNLDSLPLVDTHSKRTLLIKTVETRDGQVIN Peptide 3” “Vimentin MSTRSVSSSS YRRMFGGPGT ASRPSSSRSY 1-75 320 N-terminal VTTSTRTYSL GSALRPSTSR SLYASSPGGV Peptide 1” YATRSSAVRL RSSVP “Vimentin STRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTY 2-47 321 N-terminal SLGSALR Peptide 2”
[0183]
[0184]
Example 15
Classic MBP Breakdown Products and their Identification in Human CSF
[0185] MBP PFs were identified.
TABLE-US-00027 TABLE 21 MS/MS Data for FIG. 16A. SEQ ID b.sup.+ b.sup.2+ NO: 323 y.sup.+ y.sup.2+ 1 102.11 51.56 T 10 2 230.24 115.63 Q 1085.16 543.08 9 3 345.33 173.17 D 957.03 479.02 8 4 474.45 237.73 E 841.94 421.48 7 5 588.55 294.78 N 712.83 356.92 6 6 685.67 343.34 P 598.72 299.87 5 7 784.80 392.90 V 501.61 251.31 4 8 883.93 442.47 V 402.47 201.74 3 9 1021.08 511.04 H 303.34 152.17 2 10 F 166.20 83.60 1
[0186] The full sequence of human MBP isoform 1 (classic MBP, 21 kDa, 197 amino acids, (NP_001020252.1) is:
TABLE-US-00028 SEQ ID NO: 324 MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFF GGDRGAPKRGSGKVPWLKPGRSPLPSHARSQPGLCNMYKDSHHPAR TAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSL SRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLG GRDSRSGSPMARR.
[0187] Underlined and bold residues show the areas where PFs originate.
[0188]
[0189]
TABLE-US-00029 TABLE 22 Additional Data for FIG. 17. SEQ ID b.sup.+ b.sup.2+ NO:326 y.sup.+ y.sup.2+ 1 138.15 69.58 H 13 2 195.20 98.10 G 1245.40 623.20 12 3 282.28 141.64 S 1188.35 594.68 11 4 410.45 205.73 K 1101.27 551.14 10 5 573.63 287.32 Y 973.09 487.05 9 6 686.79 343.90 L 809.92 405.46 8 7 757.87 379.44 A 696.76 348.88 7 8 858.97 429.99 T 625.68 313.34 6 9 930.05 465.53 A 524.57 262.79 5 10 1017.13 509.07 S 453.49 227.25 4 11 1118.24 559.62 T 366.42 183.71 3 12 1249.43 625.22 M 265.31 133.16 2 13 D 134.11 67.56 1
[0190] The location of the peptide within the N-terminal region of human MBP Isoform 3 (197 aa) accession #167P02686-3 is shown in the sequence (underlined and bold):
TABLE-US-00030 SEQ ID NO: 327 MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFF GGDRGAPKRGSGKVPWLKPGRSPLPSHARSQPGLCNMYKDSHHPAR TAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSL SRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLG GRDSRSGSPMARR.
[0191] Additional sequences within this MBP isoform include PRHRDTGILDSIGR; SEQ ID NO:328, GRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRF; SEQ ID NO:329, and HKGFKGVDAQGTLS; SEQ ID NO:330.
[0192]
TABLE-US-00031 TABLE 23 MS/MS data for FIG. 18. SEQ ID #1 b.sup.+ b.sup.2+ b.sup.3+ b.sup.4+ b.sup.5+ NO:332 y.sup.+ y.sup.2+ y.sup.3+ y.sup.4+ y.sup.5+ #2 1 138.07 69.54 46.69 35.27 28.42 H 36 2 209.10 105.06 70.37 53.03 42.63 A 4101.88 2051.44 1367.96 1026.22 821.18 35 3 266.12 133.57 89.38 67.29 54.03 G 4030.84 2015.92 1344.28 1008.46 806.97 34 4 394.22 197.61 132.08 99.31 79.65 K 3973.82 1987.41 1325.28 994.21 795.57 33 5 550.32 275.66 184.11 138.34 110.87 R 3845.72 1923.36 1282.58 962.19 769.95 32 6 679.36 340.19 227.13 170.60 136.68 E 3689.62 1845.31 1230.55 923.16 738.73 31 7 792.45 396.73 264.82 198.87 159.30 L 3560.58 1780.79 1187.53 890.90 712.92 30 8 906.49 453.75 302.83 227.38 182.10 N 3447.49 1724.25 1149.84 862.63 690.30 29 9 977.53 489.27 326.51 245.14 196.31 A 3333.45 1667.23 1111.82 834.12 667.50 28 10 1106.57 553.79 369.53 277.40 222.12 E 3262.41 1631.71 1088.14 816.36 653.29 27 11 1234.67 617.84 412.23 309.42 247.74 K 3133.37 1567.19 1045.13 784.10 627.48 26 12 1305.70 653.35 435.91 327.18 261.95 A 3005.28 1503.14 1002.43 752.07 601.86 25 13 1392.73 696.87 464.92 348.94 279.35 S 2934.24 1467.62 978.75 734.32 587.65 24 14 1493.78 747.39 498.60 374.20 299.56 T 2847.21 1424.11 949.74 712.56 570.25 23 15 1607.82 804.42 536.61 402.71 322.37 N 2746.16 1373.58 916.06 687.30 550.04 22 16 1694.86 847.93 565.62 424.47 339.78 S 2632.12 1316.56 878.04 658.78 527.23 21 17 1823.90 912.45 608.64 456.73 365.59 E 2545.08 1273.05 849.03 637.03 509.82 20 18 2004.91 1002.96 668.98 501.98 401.79 T (p) 2416.04 1208.52 806.02 604.77 484.01 19 19 2118.96 1059.98 706.99 530.49 424.60 N 2235.03 1118.02 745.68 559.51 447.81 18 20 2275.06 1138.03 759.02 569.52 455.82 R 2120.98 1061.00 707.67 531.00 425.00 17 21 2332.08 1166.54 778.03 583.78 467.22 G 1964.88 982.95 655.63 491.98 393.78 16 22 2461.12 1231.06 821.05 616.04 493.03 E 1907.86 954.43 636.63 477.72 382.38 15 23 2548.15 1274.58 850.06 637.79 510.44 S 1778.82 889.91 593.61 445.46 356.57 14 24 2677.20 1339.10 893.07 670.05 536.25 E 1691.79 846.40 564.60 423.70 339.16 13 25 2805.29 1403.15 935.77 702.08 561.86 K 1562.75 781.88 521.59 391.44 313.35 12 26 2933.39 1467.20 978.47 734.10 587.48 K 1434.65 717.83 478.89 359.42 287.74 11 27 3089.49 1545.25 1030.50 773.13 618.70 R 1306.56 653.78 436.19 327.39 262.12 10 28 3203.53 1602.27 1068.51 801.64 641.51 N 1150.45 575.73 384.16 288.37 230.90 9 29 3316.61 1658.81 1106.21 829.91 664.13 L 1036.41 518.71 346.14 259.86 208.09 8 30 3373.64 1687.32 1125.22 844.16 675.53 G 923.33 462.17 308.45 231.59 185.47 7 31 3502.68 1751.84 1168.23 876.43 701.34 E 866.31 433.66 289.44 217.33 174.07 6 32 3615.76 1808.38 1205.93 904.70 723.96 L 737.26 369.14 246.43 185.07 148.26 5 33 3702.79 1851.90 1234.94 926.45 741.36 S 624.18 312.59 208.73 156.80 125.64 4 34 3858.90 1929.95 1286.97 965.48 772.58 R 537.15 269.08 179.72 135.04 108.24 3 35 4039.91 2020.46 1347.31 1010.73 808.79 T (p) 381.05 191.03 127.69 96.02 77.01 2 36 T (p) 200.03 100.52 67.35 50.76 40.81 1
[0193] The full sequence of human Golli-MBP1, accession #P02686 (304 aa; 34 kDa), is:
TABLE-US-00032 SEQ ID NO: 333 MGN HAGKREL NAEKASTNSE TNRGESEKKR NLGELSRTTS EDNEVFGEAD ANQNNGTSSQ DTAVTDSKRT ADPK NAWQDA HPADPGSRPH LIRLFSRDAP GREDNTFKDR PSESDELQTI QEDSAATSES LDV MASQKRP SQR HGSKYLA TASTMDHARH GFLPRHRDTG ILDSIGRFFG GDRGAPKRGS GKDSHHPART AHYGSLPQKS H GRTQDENPV VHFFKNIVTP RTPPPSQGKG RGLSLSRFSW GAEGQRPGFG YGGRASDYKS A HKGFKGVDA QGTLSKIFKL GGRDSRSGSP MARR.
[0194] The italic sequence in Golli-MBP isoform 1 above is identical to that of human MBP isoform 5 (#P02686-5, 171 aa).
[0195] Golli-MBP isoform 1 PFs found in human TBI CSF ultrafiltrate samples are of the following sequences: residues 4-34 of this Golli-MBP isoform 1 sequence as HAGKRELNAEKASTNSETNRGESEKKRNLGE (SEQ ID NO:334); residues 75-116 of this sequence as NAWQDAHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDE (SEQ ID NO:335). These two peptide unique fragments are derived from the N-terminal region of Golli-MBP isoform 1, and are not found in classical MBP isoform 5. Additional Golli-MBP isoform 1 PFs found in human TBI CSF ultrafiltrate samples are of the following sequences: residues 144-157 of this sequence of Golli-MBP1, accession #P02686 (304 aa) as HGSKYLATASTMDH (SEQ ID NO:336); residues 164-177 as PRHRDTGILDSIGR (SEQ ID NO:337; residues 212-248 as GRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRF (SEQ ID NO:338); and residues 272-285 as HKGFKGVDAQGTLS (SEQ ID NO:339). These sequences are found in both the Golli-MBP isoform and classical MBP isoform 5. These PF sequences in the Golli-MBP isoform 1 sequence are shown as underlined (see above SEQ ID NO:340aa).
[0196] The full sequence of human MBP isoform 5; #P02686-5; 171 aa; 18.5 kDa) is:
TABLE-US-00033 (SEQ ID NO: 341bb) MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDR GAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTP PPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGT LSKIFKLGGRDSRSGSPMARR.
[0197] Underlined sequences are MBP PFs identified in human TBI CSF ultrafiltrate samples as shown above.
[0198] Table 23, below, summarizes MBP PFs found in human TBI CSF that are derived from both human Golli-MBP1 (304 aa, #P02686-1) and MBP Isoform 3 ((171 aa; #P02686-5). The sequences of human Golli-MBP1 (SEQ ID NO:342aa) and classic MBP Isoform 3 (SEQ ID NO:343bb) are shown. The common regions of both isoforms are in italics. PFs derived from a distinct N-terminal region identified in Golli-MBP1 (SEQ ID NO:344aa) are shown in italics. This example further shows that biofluid-based monitoring of classic MBP (e.g., MBP3, MBP5) and Golli-MBP1 fragments or peptides can be used to monitor oligodendrocyte/myelin damage/white matter injury.
[0199] Table 23 presents selected PFs detected in human CSF samples from TBI subjects. See Table 24, below.
TABLE-US-00034 TABLE 24 Select MBP Biomarker Peptides. amino acid SEQ ID Name Sequence residues NO “Classic MBP isoform 5 HGSKYLATASTMD 11-24 345 (P02686-5) N-terminal peptide 1” “Classic MBP isoform 5 HGSKYLATASTMDHAR 11-43 346 (P02686-5) N-terminal HGFLPRHRDTGILDSIGR peptide 2” “Classic MBP isoform 5 GRTQDENPVVHFFKNIV 79-115 347 (P02686-5) center TPRTPPPSQGKGRGLSLS peptide” RF “Classic MBP isoform 5 HKGFKGVDAQGTLS 139-152 348 (P02686-5) C-terminal peptide” “Classic MBP (P02686-5) TQDENPVVHF 81-90 322 C-terminal peptide” “Golli-MBP isoform HAGKRELNAEKASTNSE 4-34 350 (P02686-1)-specific N- TNRGESETNRGESEKKR terminal peptide” NLGE “Golli-MBP isoform NAWQDAHPADPGSRPH 75-116 351 (P02686-1)-specific LIRLFSRDAPGREDNTFK center peptide” DRPSESDE
Example 16
Glial Fibrillary Acid Protein Protein Breakdown Products and Peptide Fragments
[0200]
[0201]
TABLE-US-00035 TABLE 25 MS/MS Data for FIG. 19A. SEQ ID #1 b.sup.+ b.sup.2+ b.sup.3+ NO:357 y.sup.+ y.sup.2+ y.sup.3+ #2 1 114.09134 57.54931 38.70196 I 38 2 215.13902 108.07315 72.38452 T 4101.90990 2051.45859 1367.97482 37 3 302.17105 151.58916 101.39520 S 4000.86222 2000.93475 1334.29226 36 4 373.20816 187.10772 125.07424 A 3913.83019 1957.41874 1305.28158 35 5 444.24527 222.62628 148.75328 A 3842.79308 1921.90018 1281.60254 34 6 600.34639 300.67683 200.78698 R 3771.75597 1886.38162 1257.92351 33 7 756.44750 378.72739 252.82068 R 3615.65486 1808.33107 1205.88980 32 8 843.47953 422.24340 281.83136 S 3459.55374 1730.28051 1153.85610 31 9 1006.54285 503.77507 336.18580 Y 3372.52172 1686.76450 1124.84542 30 10 1105.61127 553.30927 369.20861 V 3209.45839 1605.23283 1070.49098 29 11 1272.60963 636.80845 424.87473 S (p) 3110.38997 1555.69863 1037.46818 28 12 1439.60799 720.30763 480.54085 S (p) 2943.39161 1472.19945 981.80206 27 13 1496.62945 748.81836 499.54800 G 2776.39326 1388.70027 926.13594 26 14 1625.67204 813.33966 542.56220 E 2719.37179 1360.18953 907.12878 25 15 1772.70744 886.85736 591.57400 M (ox) 2590.32920 1295.66824 864.11458 24 16 1903.74793 952.37760 635.25416 M 2443.29380 1222.15054 815.10278 23 17 2002.81634 1001.91181 668.27696 V 2312.25331 1156.63030 771.42262 22 18 2059.83780 1030.42254 687.28412 G 2213.18490 1107.09609 738.39982 21 19 2116.85927 1058.93327 706.29127 G 2156.16344 1078.58536 719.39266 20 20 2229.94333 1115.47530 743.98596 L 2099.14197 1050.07462 700.38551 19 21 2300.98045 1150.99386 767.66500 A 1986.05791 993.53259 662.69082 18 22 2398.03321 1199.52024 800.01592 P 1915.02080 958.01404 639.01178 17 23 2455.05467 1228.03098 819.02308 G 1817.96803 909.48765 606.66086 16 24 2611.15578 1306.08153 871.05678 R 1760.94657 880.97692 587.65371 15 25 2767.25690 1384.13209 923.09048 R 1604.84546 802.92637 535.62000 14 26 2880.34096 1440.67412 960.78517 L 1448.74435 724.87581 483.58630 13 27 2937.36242 1469.18485 979.79233 G 1335.66028 668.33378 445.89161 12 28 3034.41519 1517.71123 1012.14325 P 1278.63882 639.82305 426.88446 11 29 3091.43665 1546.22196 1031.15040 G 1181.58605 591.29667 394.53354 10 30 3192.48433 1596.74580 1064.83296 T 1124.56459 562.78593 375.52638 9 31 3348.58544 1674.79636 1116.86666 R 1023.51691 512.26209 341.84382 8 32 3461.66950 1731.33839 1154.56135 L 867.41580 434.21154 289.81012 7 33 3628.66786 1814.83757 1210.22747 S (p) 754.33174 377.66951 252.11543 6 34 3741.75193 1871.37960 1247.92216 L 587.33338 294.17033 196.44931 5 35 3812.78904 1906.89816 1271.60120 A 474.24931 237.62830 158.75462 4 36 3968.89015 1984.94871 1323.63490 R 403.21220 202.10974 135.07558 3 37 4099.93064 2050.46896 1367.31506 M 247.11109 124.05918 83.04188 2 38 P 116.07061 58.53894 39.36172 1
TABLE-US-00036 TABLE 26 MS/MS Data for FIG. 19B. SEQ ID #1 b.sup.+ b.sup.2+ b.sup.3+ b.sup.4+ NO:358 y.sup.+ y.sup.2+ y.sup.3+ y.sup.4+ #2 1 164.07061 82.53894 55.36172 41.77311 Y 25 2 263.13902 132.07315 88.38452 66.54021 V 2481.21019 1241.10873 827.74158 621.05800 24 3 430.13738 215.57233 144.05064 108.28980 S (p) 2382.14177 1191.57453 794.71878 596.29090 23 4 517.16941 259.08834 173.06132 130.04781 S 2215.14342 1108.07535 739.05266 554.54131 22 5 574.19087 287.59907 192.06847 144.30318 G 2128.11139 1064.55933 710.04198 532.78330 21 6 703.23346 352.12037 235.08267 176.56382 E 2071.08992 1036.04860 691.03483 518.52794 20 7 850.26886 425.63807 284.09447 213.32267 M (ox) 1942.04733 971.52730 648.02063 486.26729 19 8 981.30935 491.15831 327.77463 246.08279 M 1795.01193 898.00960 599.00883 449.50844 18 9 1080.37776 540.69252 360.79744 270.84990 V 1663.97145 832.48936 555.32867 416.74832 17 10 1137.39923 569.20325 379.80459 285.10526 G 1564.90303 782.95515 522.30586 391.98122 16 11 1194.42069 597.71398 398.81175 299.36063 G 1507.88157 754.44442 503.29871 377.72585 15 12 1307.50475 654.25601 436.50644 327.63165 L 1450.86011 725.93369 484.29155 363.47048 14 13 1378.54187 689.77457 460.18547 345.39092 A 1337.77604 669.39166 446.59686 335.19947 13 14 1475.59463 738.30095 492.53639 369.65412 P 1266.73893 633.87310 422.91783 317.44019 12 15 1532.61609 766.81169 511.54355 383.90948 G 1169.68616 585.34672 390.56691 293.17700 11 16 1688.71720 844.86224 563.57725 422.93476 R 1112.66470 556.83599 371.55975 278.92163 10 17 1844.81832 922.91280 615.61096 461.96004 R 956.56359 478.78543 319.52605 239.89635 9 18 1957.90238 979.45483 653.30564 490.23105 L 800.46248 400.73488 267.49234 200.87108 8 19 2014.92384 1007.96556 672.31280 504.48642 G 687.37841 344.19285 229.79766 172.60006 7 20 2111.97661 1056.49194 704.66372 528.74961 P 630.35695 315.68211 210.79050 158.34470 6 21 2168.99807 1085.00267 723.67087 543.00498 G 533.30419 267.15573 178.43958 134.08150 5 22 2270.04575 1135.52651 757.35343 568.26689 T 476.28272 238.64500 159.43243 119.82614 4 23 2426.14686 1213.57707 809.38714 607.29217 R 375.23504 188.12116 125.74987 94.56422 3 24 2539.23092 1270.11910 847.08183 635.56319 L 219.13393 110.07061 73.71616 55.53894 2 25 S 106.04987 53.52857 36.02147 27.26792 1
TABLE-US-00037 TABLE 27 MS/MS Data for FIG. 19C. SEQ ID #1 b.sup.+ b.sup.2+ NO:359 y.sup.+ y.sup.2+ #2 1 116.03422 58.52075 D 8 2 173.05568 87.03148 G 761.40396 381.20562 7 3 302.09828 151.55278 E 704.38250 352.69489 6 4 401.16669 201.08698 V 575.33990 288.17359 5 5 514.25075 257.62902 I 476.27149 238.63938 4 6 642.34572 321.67650 K 363.18743 182.09735 3 7 771.38831 386.19779 E 235.09246 118.04987 2 8 S 106.04987 53.52857 1
TABLE-US-00038 TABLE 28 MS/MS Data for Table 19D. SEQ ID #1 b.sup.+ b.sup.2+ NO: 360 y.sup.+ y.sup.2+ #2 1 116.03422 58.52075 D 7 2 173.05568 87.03148 G 674.37193 337.68960 6 3 302.09828 151.55278 E 617.35047 309.17887 5 4 401.16669 201.08698 V 488.30788 244.65758 4 5 514.25075 257.62902 I 389.23946 195.12337 3 6 642.34572 321.67650 K 276.15540 138.58134 2 7 E 148.06043 74.53386 1
TABLE-US-00039 TABLE 29 MS/MS Data for Table 19E. SEQ ID #1 b.sup.+ b.sup.2+ b.sup.3+ b.sup.4+ NO: 361 y.sup.+ y.sup.2+ Y.sup.3+ y.sup.4+ #2 1 58.02874 29.51801 20.01443 15.26264 G 28 2 187.07133 94.03930 63.02863 47.52329 E 3118.63788 1559.82258 1040.21748 780.41493 27 3 316.11393 158.56060 106.04283 79.78394 E 2989.59529 1495.30128 997.20328 748.15428 26 4 430.15685 215.58207 144.05714 108.29467 N 2860.55270 1430.77999 954.18908 715.89363 25 5 586.25796 293.63262 196.09084 147.31995 R 2746.50977 1373.75852 916.17477 687.38290 24 6 699.34203 350.17465 233.78553 175.59096 I 2590.40866 1295.70797 864.14107 648.35762 23 7 800.38971 400.69849 267.46809 200.85288 T 2477.32459 1239.16593 826.44638 620.08661 22 8 913.47377 457.24052 305.16277 229.12390 I 2376.27691 1188.64210 792.76382 594.82469 21 9 1010.52653 505.76691 337.51370 253.38709 P 2263.19285 1132.10006 755.06913 566.55367 20 10 1109.59495 555.30111 370.53650 278.15419 V 2166.14009 1083.57368 722.71821 542.29048 19 11 1237.65353 619.33040 413.22269 310.16884 Q 2067.07167 1034.03947 689.69541 517.52338 18 12 1338.70120 669.85424 446.90525 335.43076 T 1939.01310 970.01019 647.00922 485.50873 17 13 1485.76962 743.38845 495.92806 372.19786 F 1837.96542 919.48635 613.32666 460.24681 16 14 1572.80165 786.90446 524.93873 393.95587 S 1690.89700 845.95214 564.30385 423.47971 15 15 1686.84457 843.92593 562.95304 422.46660 N 1603.86498 802.43613 535.29318 401.72170 14 16 1799.92864 900.46796 600.64773 450.73762 L 1489.82205 745.41466 497.27887 373.21097 13 17 1927.98722 964.49725 643.33392 482.75226 Q 1376.73798 688.87263 459.58418 344.93995 12 18 2041.07128 1021.03928 681.02861 511.02328 I 1248.67941 624.84334 416.89799 312.92531 11 19 2197.17239 1099.08983 733.06231 550.04856 R 1135.59534 568.30131 379.20330 284.65429 10 20 2326.21498 1163.61113 776.07651 582.30920 E 979.49423 490.25075 327.16959 245.62902 9 21 2427.26266 1214.13497 809.75907 607.57112 T 850.45164 425.72946 284.15540 213.36837 8 22 2514.29469 1257.65098 838.76975 629.32913 S 749.40396 375.20562 250.47284 188.10645 7 23 2627.37875 1314.19302 876.46444 657.60015 L 662.37193 331.68960 221.46216 166.34844 6 24 2742.40570 1371.70649 914.80675 686.35688 D 549.28787 275.14757 183.76747 138.07742 5 25 2843.45338 1422.23033 948.48931 711.61880 T 434.26092 217.63410 145.42516 109.32069 4 26 2971.54834 1486.27781 991.18763 743.64254 K 333.21325 167.11026 111.74260 84.05877 3 27 3058.58037 1529.79382 1020.19831 765.40055 S 205.11828 103.06278 69.04428 52.03503 2 28 V 118.08626 59.54677 40.03360 30.27702 1
[0202] Overall, these data indicate that a number of GFAP PFs in the GFAP alpha isoform (#P14136; 432 aa) are found in TBI CSF samples and can serve as biomarkers for TBI or traumatic injury to the CNS. This example also shows that human biofluid-based monitoring of PFs of GFAP can be used to monitor astroglia injury. See Table 30, below for a list of selected peptides.
[0203] The full sequence of glial fibrillary acidic protein (human) alpha isoform (#P14136; GI:251802 (with the regions where the PFs occur shown in bold) is:
TABLE-US-00040 SEQ ID NO: 362 MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRV DFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAE LNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLAT VRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFL RKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRTQYEAMASSNM HEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLR GTNESLERQMREQEERHVREAASYQEALALEEEGQSLKDEMARHLQEYQD LLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSE GHLKRNIVVKTVEMRDGEVIKESKQEHKDVM.
TABLE-US-00041 TABLE 30 Select GFAP Peptide Breakdown Products. amino acid SEQ ID Name Sequence residues NO “GFAP N-terminal ITSAARRSYVSSGEMMVGGLAPGR 6-43 363 peptide 1” RLGPGTRLSLARMP “GFAP N-terminal YVSSGEMMVGGLAPGRRLGPGTRLS 14-38 364 peptide 2” “GFAP N-terminal RSYVSSGEMMVGGLAPGRRLGP 12-33 365 peptide 3” “GFAP N-terminal AARRSYVSSGEMMVGGLAPGRRL 9-49 366 peptide 4” GPGTRLSLARMPPPLPTR “GFAP C-terminal GEENRITIPVQTFSNLQIRETSLDTK 372-399 367 peptide 1” SV “GFAP C-terminal QTFSNLQIRETSLDTKSVSEGHLKR 382-416 368 peptide 2” NIVVKTVEMR “GFAP C-terminal DGEVIKES 417-423 369 peptide 3” “GFAP C-terminal DGEVIKE 417-422 370 peptide 4” “GFAP C-terminal DGEVIKESKQEHKDVM 417-332 371 peptide 5”
Example 17
Tau Protein Breakdown Products and Peptide Fragments from Human TBI CSF Ultrafiltrate Samples
[0204]
[0205]
[0206]
TABLE-US-00042 TABLE 31 Additional Data for FIG. 20 (P10636-8 peptides). XCorr by Position No. search in Protein of Theo. engine: A8 Sequence Protein Modification Modification PSM MH+ (Da) Sequest HT AEPRQEFEVMEDHAGTYG 2-30 1xOxidation 3xPhospho 1 3512.3539 2.19 LGDRKDQGGYT [M10]; 3xPhospho [Y29(99.6); (SEQ ID NO: 373) [Y28(99.6); T30(99.6); Y/T] T29(99.6); Y/T] KTPPSSG 180-186 3xPhospho 3xPhospho 1 913.25052 1.32 (SEQ ID NO: 374) [T2(100); S5(100); [T181(100); S6(100)] S184(100); S185(100)] PGSRSRTPSLPTPP 206-219 3xPhospho 3xPhospho 1 1689.67984 1.36 (SEQ ID NO: 375) [S9(98.6); [S214(98.6); T12(99.9); T/S] T217(99.9); S/T] PVVSGDTSPRHLSNVSS 397-413 3xPhospho 3xPhospho 1 1978.77084 2.15 (SEQ ID NO: 376) [S4(77.2); S/T] [S400(77.2); S/T] VKSEKLDFKDRVQSKIGSL 339-357 3xPhospho 3xPhospho 1 2417.12784 2.29 (SEQ ID NO: 377) [S3(100); [S341(100); S14(100); S352(100); S18(100)] S356(100) YKPVDLSKVTSKCGSL 310-325 1xOxidation 1xOxidation 1 1980.81904 2.34 (SEQ ID NO: 378) [C13]; 3xPhospho [C322]; [Y1(97.7); 3xPhospho S15(95.8); T/S] [Y310(97.7); S324(95.8); T/S]
[0207] Table 32, below provides a list of PFs showing an isoform specific peptide for the high molecular weight Tau-758 (identifier: P10636-19; 776aa). These PFs can be detected in TBI CSF samples, but in not control CSF.
TABLE-US-00043 TABLE 32 Tau-758 and Tau-441 Peptide Fragments Found in Human TBI CSF Ultrafiltrate Samples. Position in SEQ ID Sequence Protein NO TAU-758 (P10636-9) PQLKARMVSKSKDGTGSDDKKAKTSTRSSA 372-401 379 PPSSPKYVSSVTSRTGSSGAKEMKLKGADGKTKIATPRGAA 435-475 380 LKARMVSKSKDGTGSDDKKAKTSTRSSAKTLKNRPCLSPKHPTPGS 374-419 381 SVTSRTGSSGAKEMKLKGADGK 444-465 382 EDRDVDESSPQDSPPSKASPAQDGRPPQTAAREATSIPGFPAEGAIP 220-266 383 SPKHPTPGSSDPLIQPSSPAVCPEPPSSPKYVSSVTSRTGSSGAKEM 411-457 384 PQLKARMVSKSKDGTGSDDKKAKTSTRSSA 372-401 385 PPSSPKYVSSVTSRTGSSGAKEMKLKGADGKTKIATPRGAA 435-486 387 SVTSRTGSSGAKEMKLKGADGK 444-465 388 TAU-441 (P10636-8) SPQLATLADEVSASLAK 421-438 474 EIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSA 391-434 389 KHVPGGGSVQIVYKPVDLS 298-316 390 KNVKSKIGSTENL 254-266 391 PLQTPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHT 47-95 392 SKCGSKD 289-295 393
[0208] The following tables show the sequences of Tau-441 and Tau-758. The isoform unique sequences are underlined. The Tau-758 PFs found in human TBI CSF ultrafiltrate are shown in bold. See Table 33 and Table 34, below.
TABLE-US-00044 TABLE 33 Human Isoform Tau-F (Tau-441) of Microtubule- associated protein tau (identifier: P10636-8). MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQT PTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEG TTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTK IATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSP GSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPM PDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHV PGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRV QSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVS GDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL. SEQ ID NO: 394 N- and C-terminal regions PFs are originated are shown in bold and underlined. Other PF regions in the central are shown in bold.
TABLE-US-00045 TABLE 34 Human Isoform Tau-G (Tau-758) of Microtubule- associated protein tau (identifier: P10636-1). MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQT PTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEG TTAEEAGIGDTPSLEDEAAGHVTQ[EPESGKVVQEGFLREPGPPGLSHQL MSGMPGAPLLPEGPREATRQPSGTGPEDTEGGRHAPELLKHQLLGDLHQE GPPLKGAGGKERPGSKEEVDEDRDVDESSPQDSPPSKASPAQDGRPPQTA AREATSIPGFPAEGAIPLPVDFLSKVSTEIPASEPDGPSVGRAKGQDAPL EFTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEA DLPEPSEKQPAAAPRGKPVSRVPQLKARMVSKSKDGTGSDDKKAKTSTRS SAKTLKNRPCLSPKHPTPGSSDPLIQPSSPAVCPEPPSSPKYVSSVTSRT GSSGAKEMKL]KGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKT PPSSATKQVQRRPPPAGPRSERGEPPKSGDRSGYSSPGSPGTPGSRSRTP SLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGST ENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPV DLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHV PGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSS TGSIDMVDSPQLATLADEVSASLAKQGL. SEQ ID NO: 395 Central region that is unique to Tau-G, not present in Tau-F form are in square brackets. Central regions PFs are originated are shown in bold and underlined.
[0209] Table 35, below, provides a summary of MS/MS results on PFs identified from Tau protein isoforms Tau-758 and Tau-441 in human TBI CSF ultrafiltrate samples.
TABLE-US-00046 TABLE 35 Peptide Fragments Identified from Tau Protein Isoforms. Peptide SEQ ID Sequence Tau Isoforms Position Modifications NO PQLKARMVSKSKDGTGSDDKKAKTS Tau-776, Tau-758 372-401 1xOxidation [M7]; 396 TRSSA 372-401 2xPhospho [T/S] PPSSPKYVSSVTSRTGSSGAKEMKLK Tau-776, Tau-758 435-475 1xPhospho [S/Y/T] 397 GADGKTKIATPRGAA 435-475 LKARMVSKSKDGTGSDDKKAKTSTR Tau-776, Tau-758 374-419 1xOxidation [M5]; 398 SSAKTLKNRPCLSPKHPTPGS 379-419 1xPhospho [T/S] SVTSRTGSSGAKEMKLKGADGK Tau-776, Tau-758 444-465 1xPhospho [S/T] 399 444-465 EDRDVDESSPQDSPPSKASPAQDGRPP Tau-776, Tau-758 220-266 2xPhospho 400 QTAAREATSIPGFPAEGAIP 220-266 [S19(84); S/T] SPKHPTPGSSDPLIQPSSPAVCPEPPSSP Tau-776 Tau-758 411-457 3xPhospho [S34; 401 KYVSSVTSRTGSSGAKEM 411-457 S37; S41] EIVYKSPVVSGDTSPRHLSNVSSTGSI Tau-441, 726-769 2xPhospho [Y/S/T] 402 DMVDSPQLATLADEVSA Tau-776, Tau-758 391-434 708-751 KHVPGGGSVQIVYKPVDLS Tau-441, 633-651 3xPhospho 403 Tau-776, Tau-758 298-316 [S8(100); Y13(100); 615-633 S19(100)] KNVKSKIGSTENL Tau-441, 589-601 1xPhospho [T/S] 404 Tau-776, Tau-758 254-266 571-583 PLQTPTEDGSEEPGSETSDAKSTPTAE Tau-441 47-95 405 DVTAPLVDEGAPGKQAAAQPHT Tau-776 Tau-758 47-95 47-95
[0210] This example shows that human biofluid-based monitoring of Tau-F (Tau-441) and Tau-G (766 aa) and its PBPs or PFs can be used to monitor axonal injury or neurodegeneration.
Example 18
CAMSAP1 Protein Breakdown Products
[0211]
TABLE-US-00047 TABLE 36 MS/MS Data for FIG. 21. SEQ ID #1 b.sup.+ b.sup.2+ b.sup.3+ NO: 407 Y.sup.+ y.sup.2+ Y.sup.3+ #2 1 88.08539 44.54639 30.03339 S 19 2 216.21630 108.61185 72.74370 Q 1944.19980 972.60360 648.73819 18 3 353.35770 177.18255 118.45750 H 1816.06889 908.53814 606.02789 17 4 410.40940 205.70840 137.47473 G 1678.92749 839.96744 560.31409 16 5 538.58390 269.79565 180.19956 K 1621.87579 811.44159 541.29686 15 6 653.67240 327.33990 218.56240 D 1493.70129 747.35434 498.57202 14 7 750.78920 375.89830 250.93466 P 1378.61279 689.81009 460.20919 13 8 821.86790 411.43765 274.62756 A 1281.49599 641.25169 427.83692 12 9 908.94590 454.97665 303.65356 S 1210.41729 605.71234 404.14402 11 10 1022.10570 511.55655 341.37350 L 1123.33929 562.17334 375.11802 10 11 1135.26550 568.13645 379.09343 L 1010.17949 505.59344 337.39809 9 12 1206.34420 603.67580 402.78633 A 897.01969 449.01354 299.67816 8 13 1293.42220 647.21480 431.81233 S 825.94099 413.47419 275.98526 7 14 1422.53780 711.77260 474.85086 E 738.86299 369.93519 246.95926 6 15 1535.69760 768.35250 512.57080 L 609.74739 305.37739 203.92072 5 16 1634.83040 817.91890 545.61506 V 496.58759 248.79749 166.20079 4 17 1762.96131 881.98435 588.32537 Q 397.45479 199.23109 133.15652 3 18 1876.12111 938.56425 626.04530 L 269.32388 135.16564 90.44622 2 19 H 156.16408 78.58574 52.72629 1
[0212]
[0213] In addition,
[0214] The presence of proteolytic breakdown products of CAMSAP3 in TBI CSF implies that CAMSAP1 protein and its higher molecular weight breakdown products are present and in higher in biofluids (CSF) from TBI subjects than in controls. This example therefore shows that human biofluid-based monitoring of CAMSAP1 and CAMSAP3 PBPs or PFs can be used to monitor axonal damage.
TABLE-US-00048 TABLE 37 MS/MS Data for FIG. 23. SEQ ID #1 b.sup.+ b.sup.2+ NO: 409 Y.sup.+ y.sup.2+ #2 1 114.16719 57.58729 L 11 2 242.29810 121.65275 Q 1162.19921 581.60330 10 3 371.41370 186.21055 E 1034.06830 517.53785 9 4 499.58820 250.29780 K 904.95270 452.98005 8 5 600.69330 300.85035 T 776.77820 388.89280 7 6 729.80890 365.40815 E 675.67310 338.34025 6 7 857.93981 429.47360 Q 546.55750 273.78245 5 8 987.05541 494.03140 E 418.42659 209.71699 4 9 1058.13411 529.57075 A 289.31099 145.15919 3 10 1129.21281 565.11010 A 218.23229 109.61984 2 11 Q 147.15359 74.08049 1
Example 19
GAD1 Protein Breakdown Products
[0215]
TABLE-US-00049 TABLE 38 Additional Data for FIG. 24. SEQ ID #1 b.sup.+ b.sup.2+ b.sup.3+ NO: 411 y.sup.+ y.sup.2+ y.sup.3+ #2 1 138.14879 69.57809 46.72119 H 19 2 235.26559 118.13649 79.09346 P 1920.22109 960.61424 640.74529 18 3 391.45359 196.23049 131.15613 R 1823.10429 912.05584 608.37302 17 4 538.63079 269.81909 180.21519 F 1666.91629 833.96184 556.31036 16 5 685.80799 343.40769 229.27426 F 1519.73909 760.37324 507.25129 15 6 799.91189 400.45964 267.30889 N 1372.56189 686.78464 458.19222 14 7 928.04280 464.52510 310.01920 Q 1258.45799 629.73269 420.15759 13 8 1041.20260 521.10500 347.73913 L 1130.32708 565.66724 377.44729 12 9 1128.28060 564.64400 376.76513 S 1017.16728 509.08734 339.72735 11 10 1229.38570 615.19655 410.46683 T 930.08928 465.54834 310.70135 10 11 1286.43740 643.72240 429.48406 G 828.98418 414.99579 276.99965 9 12 1399.59720 700.30230 467.20400 L 771.93248 386.46994 257.98242 8 13 1514.68570 757.84655 505.56683 D 658.77268 329.89004 220.26249 7 14 1627.84550 814.42645 543.28676 I 543.68418 272.34579 181.89965 6 15 1741.00530 871.00635 581.00670 I 430.52438 215.76589 144.17972 5 16 1798.05700 899.53220 600.02393 G 317.36458 159.18599 106.45979 4 17 1911.21680 956.11210 637.74386 L 260.31288 130.66014 87.44255 3 18 1982.29550 991.65145 661.43676 A 147.15308 74.08024 49.72262 2 19 G 76.07438 38.54089 26.02972 1
Example 20
Synapsin Protein Breakdown Products and Peptide Fragments
[0216]
TABLE-US-00050 TABLE 39 MS/MS Data for FIG. 25. SEQ ID #1 b.sup.+ b.sup.2+ NO: 413 y.sup.+ y.sup.2+ #2 1 29.13830 65.07285 Q 11 2 244.22680 122.61710 D 1148.25928 574.63334 10 3 373.34240 187.17490 E 1033.17078 517.08909 9 4 472.47520 236.74130 V 904.05518 452.53129 8 5 600.64970 300.82855 K 804.92238 402.96489 7 6 671.72840 336.36790 A 676.74788 338.87764 6 7 800.84400 400.92570 E 605.66918 303.33829 5 8 901.94910 451.47825 T 476.55358 238.78049 4 9 1015.10890 508.05815 I 375.44848 188.22794 3 10 1171.29690 586.15215 R 262.28868 131.64804 2 11 S 106.10068 53.55404 1
[0217]
TABLE-US-00051 TABLE 40 MS/MS Data for FIG. 26. SEQ ID #1 b.sup.+ b.sup.2+ b.sup.3+ NO: 415 y.sup.+ y.sup.2+ y.sup.3+ #2 1 88.08539 44.54639 30.03339 S 18 2 216.21630 108.61185 72.74370 Q 1943.08149 972.04444 648.36542 17 3 303.29430 152.15085 101.76970 S 1814.95058 907.97899 605.65512 16 4 416.45410 208.73075 139.48963 L 1727.87258 864.43999 576.62912 15 5 517.55920 259.28330 173.19133 T 1614.71278 807.86009 538.90919 14 6 631.66310 316.33525 211.22596 N 1513.60768 757.30754 505.20749 13 7 702.74180 351.87460 234.91886 A 1399.50378 700.25559 467.17285 12 8 849.91900 425.46320 283.97793 F 1328.42508 664.71624 443.47995 11 9 936.99700 469.00220 313.00393 S 1181.24788 591.12764 394.42089 10 10 1084.17420 542.59080 362.06300 F 1094.16988 547.58864 365.39489 9 11 1171.25220 586.12980 391.08900 5 946.99268 474.00004 316.33582 8 12 1300.36780 650.68760 434.12753 E 859.91468 430.46104 287.30982 7 13 1387.44580 694.22660 463.15353 S 730.79908 365.90324 244.27129 6 14 1474.52380 737.76560 492.17953 S 643.72108 322.36424 215.24529 5 15 1621.70100 811.35420 541.23860 F 556.64308 278.82524 186.21929 4 16 1768.87820 884.94280 590.29766 F 409.46588 205.23664 137.16022 3 17 1925.06620 963.03680 642.36033 R 262.28868 131.64804 88.10115 2 18 S 106.10068 53.55404 36.03849
[0218]
TABLE-US-00052 TABLE 41 MS/MS Data for FIG. 27. SEQ ID #1 b.sup.+ b.sup.2+ b.sup.3+ NO: 417 y.sup.+ y.sup.2+ y.sup.3+ #2 1 116.09589 58.55164 39.37023 D 19 2 302.30999 151.65869 101.44159 W 2191.54519 1096.27629 731.18666 18 3 389.38799 195.19769 130.46759 S 2005.33109 1003.16924 669.11529 17 4 517.56249 259.28494 173.19243 K 1918.25309 959.63024 640.08929 16 5 680.73910 340.87325 227.58463 Y 1790.07859 895.54299 597.36446 15 6 827.91630 414.46185 276.64370 F 1626.90198 813.95469 542.97225 14 7 965.05770 483.03255 322.35750 H 1479.72478 740.36609 493.91319 13 8 1022.10940 511.55840 341.37473 G 1342.58338 671.79539 448.19939 12 9 1150.28390 575.64565 384.09956 K 1285.53168 643.26954 429.18215 11 10 1278.45840 639.73290 426.82440 K 1157.35718 579.18229 386.45732 10 11 1377.59120 689.29930 459.86866 V 1029.18268 515.09504 343.73249 9 12 1491.69510 746.35125 497.90330 N 930.04988 465.52864 310.68822 8 13 1548.74680 774.87710 516.92053 G 815.94598 408.47669 272.65359 7 14 1677.86240 839.43490 559.95906 E 758.89428 379.95084 253.63635 6 15 1791.02220 896.01480 597.67900 I 629.77868 315.39304 210.59782 5 16 1920.13780 960.57260 640.71753 E 516.61888 258.81314 172.87789 4 17 2033.29760 1017.15250 678.43746 I 387.50328 194.25534 129.83935 3 18 2189.48560 1095.24650 730.50013 R 274.34348 137.67544 92.11942 2 19 V 118.15548 59.58144 40.05675 1
Example 21
Striatin Protein Breakdown Products and Peptide Fragments
[0219]
TABLE-US-00053 TABLE 42 MS/MS Data for FIG. 28. SEQ ID #1 b.sup.+ b.sup.2+ NO: 419 y.sup.+ y.sup.2+ #2 1 72.08609 36.54674 A 15 2 129.13779 65.07259 G 1469.54549 735.27644 14 3 242.29759 121.65249 L 1412.49379 706.75059 13 4 343.40269 172.20504 T 1299.33399 650.17069 12 5 442.53549 221.77144 V 1198.22889 599.61814 11 6 513.61419 257.31079 A 1099.09609 550.05174 10 7 627.71809 314.36274 N 1028.01739 514.51239 9 8 756.83369 378.92054 E 913.91349 457.46044 8 9 827.91239 414.45989 A 784.79789 392.90264 7 10 943.00089 472.00414 D 713.71919 357.36329 6 11 1030.07889 515.54314 S 598.63069 299.81904 5 12 1143.23869 572.12304 L 511.55269 256.28004 4 13 1244.34379 622.67559 T 398.39289 199.70014 3 14 1407.52040 704.26390 Y 297.28779 149.14759 2 15 D 134.11118 67.55929 1
Example 22
GAP43 Protein Breakdown Products and Peptide Fragments
[0220]
TABLE-US-00054 TABLE 43 MS/MS Data for FIG. 29. SEQ ID #1 b.sup.+ b.sup.2+ b.sup.3+ NO: 421 y.sup.+ y.sup.2+ y.sup.3+ #2 1 72.08609 36.54674 24.70029 A 22 2 201.20169 101.10454 67.73883 E 2127.13628 1064.07184 709.71702 21 3 302.30679 151.65709 101.44053 T 1998.02068 999.51404 666.67849 20 4 431.42239 216.21489 144.47906 E 1896.91558 948.96149 632.97679 19 5 518.50039 259.75389 173.50506 S 1767.79998 884.40369 589.93825 18 6 589.57909 295.29324 197.19796 A 1680.72198 840.86469 560.91225 17 7 690.68419 345.84579 230.89966 T 1609.64328 805.32534 537.21935 16 8 818.85869 409.93304 273.62449 K 1508.53818 754.77279 503.51765 15 9 889.93739 445.47239 297.31739 A 1380.36368 690.68554 460.79282 14 10 977.01539 489.01139 326.34339 S 1309.28498 655.14619 437.09992 13 11 1078.12049 539.56394 360.04509 T 1222.20698 611.60719 408.07392 12 12 1193.20899 597.10819 398.40793 D 1121.10188 561.05464 374.37222 11 13 1307.31289 654.16014 436.44256 N 1006.01338 503.51039 336.00939 10 14 1394.39089 697.69914 465.46856 S 891.90948 446.45844 297.97475 9 15 1491.50769 746.25754 497.84083 P 804.83148 402.91944 268.94875 8 16 1578.58569 789.79654 526.86683 S 707.71468 354.36104 236.57649 7 17 1665.66369 833.33554 555.89283 S 620.63668 310.82204 207.55049 6 18 1793.83819 897.42279 598.61766 K 533.55868 267.28304 178.52449 5 19 1864.91689 932.96214 622.31056 A 405.38418 203.19579 135.79965 4 20 1994.03249 997.51994 665.34909 E 334.30548 167.65644 112.10675 3 21 2109.12099 1055.06419 703.71193 D 205.18988 103.09864 69.06822 2 22 A 90.10138 45.55439 30.70539 1
Example 23
Microtubule-associated Protein 6 Protein Breakdown Products and Peptide Fragments
[0221]
TABLE-US-00055 TABLE 44 MS/MS Data for FIG. 30A. SEQ ID #1 b.sup.+ b.sup.2+ b.sup.3+ NO: 423 y.sup.+ y.sup.2+ y.sup.3+ #2 1 102.05 51.53 34.69 T 21 2 230.15 115.58 77.39 K 2156.04 1078.52 719.35 20 3 393.21 197.11 131.74 Y 2027.95 1014.48 676.65 19 4 480.25 240.63 160.75 S 1864.88 932.94 622.3 18 5 609.29 305.15 203.77 E 1777.85 889.43 593.29 17 6 680.32 340.67 227.45 A 1648.81 824.91 550.27 16 7 781.37 391.19 261.13 T 1577.77 789.39 526.6 15 8 910.42 455.71 304.14 E 1476.72 738.87 492.91 14 9 1047.47 524.24 349.83 H 1347.68 674.34 449.9 13 10 1144.53 572.77 382.18 P 1210.62 605.81 404.21 12 11 1201.55 601.28 401.19 G 1113.57 557.29 371.86 11 12 1272.59 636.8 424.87 A 1056.55 528.78 352.85 10 13 1369.64 685.32 457.22 P 985.51 493.26 329.17 9 14 1466.69 733.85 489.57 P 888.46 444.73 296.82 8 15 1594.75 797.88 532.25 Q 791.4 396.21 264.47 7 16 1691.8 846.4 564.61 P 663.35 332.18 221.79 6 17 1788.86 894.93 596.96 P 566.29 283.65 189.44 5 18 1885.91 943.46 629.31 P 469.24 235.12 157.09 4 19 1982.96 991.98 661.66 P 372.19 186.6 124.73 3 20 2111.02 1056.01 704.34 Q 275.14 138.07 92.38 2 21 Q 147.08 74.04 49.7 1
[0222]
TABLE-US-00056 TABLE 45 MS/MS Data for FIG. 30B. SEQ ID #1 b.sup.+ b.sup.2+ b.sup.3+ NO: 425 y.sup.+ y.sup.2+ y.sup.3+ #2 1 129.07 65.04 43.69 Q 25 2 242.15 121.58 81.39 L 2715.35 1358.18 905.79 24 3 339.2 170.1 113.74 P 2602.26 1301.63 868.09 23 4 440.25 220.63 147.42 T 2505.21 1253.11 835.74 22 5 539.32 270.16 180.44 V 2404.16 1202.58 802.06 21 6 626.35 313.68 209.46 S 2305.09 1153.05 769.04 20 7 723.4 362.21 241.81 P 2218.06 1109.53 740.03 19 8 836.49 418.75 279.5 L 2121.01 1061.01 707.67 18 9 933.54 467.27 311.85 P 2007.92 1004.47 669.98 17 10 1089.64 545.32 363.89 R 1910.87 955.94 637.63 16 11 1188.71 594.86 396.91 V 1754.77 877.89 585.6 15 12 1319.75 660.38 440.59 M 1655.7 828.35 552.57 14 13 1432.83 716.92 478.28 I 1524.66 762.83 508.89 13 14 1529.89 765.45 510.63 P 1411.58 706.29 471.2 12 15 1630.93 815.97 544.32 T 1314.52 657.77 438.85 11 16 1701.97 851.49 568 A 1213.48 607.24 405.16 10 17 1799.02 900.02 600.35 P 1142.44 571.72 381.48 9 18 1936.08 968.55 646.03 H 1045.39 523.2 349.13 8 19 2117.1 1059.05 706.37 T (p) 908.33 454.67 303.45 7 20 2246.14 1123.57 749.38 E 727.31 364.16 243.11 6 21 2409.2 1205.11 803.74 Y 598.27 299.64 200.1 5 22 2522.29 1261.65 841.43 I 435.21 218.11 145.74 4 23 2651.33 1326.17 884.45 E 322.12 161.57 108.05 3 24 2738.36 1369.68 913.46 S 193.08 97.04 65.03 2 25 S 106.05 53.53 36.02 1
[0223] The presence of PFs of MAP6 in TBI CSF indicates that MAP6 protein and its higher molecular weight breakdown products are present and higher in biofluids (CSF) from TBI subjects than in controls. This example shows that human biofluid-based monitoring of MAP6 PFs can be used to monitor dendritic injury.
[0224] The sequence of microtubule-associated protein 6 (human) (Q96JE9-1) is:
TABLE-US-00057 SEQ ID NO: 426 MAWPCITRACCIARFWNQLDKADIAVPLVFTKYSEATEHPGAPPQPPPPQ QQAQPALAPPSARAVAIETQPAQGELDAVARATGPAPGPTGEREPAAGPG RSGPGPGLGSGSTSGPADSVMRQDYRAWKVQRPEPSCRPRSEYQPSDAPF ERETQYQKDFRAWPLPRRGDHPWIPKPVQISAASQASAPILGAPKRRPQS QERWPVQAAAEAREQEAAPGGAGGLAAGKASGADERDTRRKAGPAWIVRR AEGLGHEQTPLPAAQAQVQATGPEAGRGRAAADALNRQIREEVASAVSSS YRNEFRAWTDIKPVKPIKAKPQYKPPDDKMVHETSYSAQFKGEASKPTTA DNKVIDRRRIRSLYSEPFKEPPKVEKPSVQSSKPKKTSASHKPTRKAKDK QAVSGQAAKKKSAEGPSTTKPDDKEQSKEMNNKLAEAKESLAQPVSDSSK TQGPVATEPDKDQGSVVPGLLKGQGPMVQEPLKKQGSVVPGPPKDLGPMI PLPVKDQDHTVPEPLKNESPVISAPVKDQGPSVPVPPKNQSPMVPAKVKD QGSVVPESLKDQGPRIPEPVKNQAPMVPAPVKDEGPMVSASVKDQGPMVS APVKDQGPIVPAPVKGEGPIVPAPVKDEGPMVSAPIKDQDPMVPEHPKDE SAMATAPIKNQGSMVSEPVKNQGLVVSGPVKDQDVVVPEHAKVHDSAVVA PVKNQGPVVPESVKNQDPILPVLVKDQGPTVLQPPKNQGRIVPEPLKNQV PIVPVPLKDQDPLVPVPAKDQGPAVPEPLKTQGPRDPQLPTVSPLPRVMI PTAPHTEYIESSP.
[0225] Regions in bold are MAP6 PFs found in human TBI CSF ultrafiltrate samples.
Example 24
Nesprin-1 Protein Breakdown Products and Peptide Fragments
[0226]
TABLE-US-00058 TABLE 46 Additional Data for FIG. 31. SEQ ID #1 b.sup.+ b.sup.2+ b.sup.3+ NO: 428 y.sup.+ y.sup.2+ y.sup.3+ #2 1 138.14879 69.57809 46.72119 H 9 2 225.22679 113.11709 75.74719 S 970.07428 485.54084 324.02969 8 3 296.30549 148.65644 99.44009 A 882.99628 442.00184 295.00369 7 4 424.47999 212.74369 142.16493 K 811.91758 406.46249 271.31079 6 5 553.59559 277.30149 185.20346 E 683.74308 342.37524 228.58595 5 6 682.71119 341.85929 228.24199 E 554.62748 277.81744 185.54742 4 7 795.87099 398.43919 265.96193 L 425.51188 213.25964 142.50889 3 8 933.01239 467.00989 311.67573 H 312.35208 156.67974 104.78895 2 9 R 175.21068 88.10904 59.07515 1
Example 25
Neurexin-3 Protein Breakdown Products and Peptide Fragments
[0227]
TABLE-US-00059 TABLE 47 MS/MS Data for FIG. 32. SEQ ID #1 b.sup.+ b.sup.2+ b.sup.3+ NO: 430 y.sup.+ y.sup.2+ y.sup.3+ #2 1 114.16719 57.58729 38.72733 I 10 2 213.29999 107.15369 71.77159 V 987.22889 494.11814 329.74789 9 3 326.45979 163.73359 109.49153 L 888.09609 444.55174 296.70362 8 4 439.61959 220.31349 147.21146 L 774.93629 387.97184 258.98369 7 5 536.73639 268.87189 179.58373 P 661.77649 331.39194 221.26376 6 6 649.89619 325.45179 217.30366 L 564.65969 282.83354 188.89149 5 7 747.01299 374.01019 249.67593 P 451.49989 226.25364 151.17156 4 8 848.11809 424.56274 283.37763 T 354.38309 177.69524 118.79929 3 9 919.19679 460. 10209 307.07053 A 253.27799 127.14269 85.09759 2 10 Y 182.19929 91.60334 61.40469 1
Example 26
Chondroitin Sulfate Proteoglycan 4 Protein Breakdown Products and Peptide Fragments
[0228]
TABLE-US-00060 TABLE 48 MS/MS Data for FIG. 33. SEQ ID #1 b.sup.+ b.sup.2+ b.sup.3+ NO: 432 y.sup.+ y.sup.2+ y.sup.3+ #2 1 164.18400 82.59570 55.39960 Y 15 2 293.29960 147.15350 98.43813 E 1751.87618 876.44179 584.63032 14 3 430.44100 215.72420 144.15193 H 1622.76058 811.88399 541.59179 13 4 559.55660 280.28200 187.19046 E 1485.61918 743.31329 495.87799 12 5 690.75600 345.88170 230.92360 M 1356.50358 678.75549 452.83945 11 6 787.87280 394.44010 263.29586 P 1225.30418 613.15579 409.10632 10 7 884.98960 442.99850 295.66813 P 1128.18738 564.59739 376.73405 9 8 1014.10520 507.55630 338.70666 E 1031.07058 516.03899 344.36179 8 9 1111.22200 556.11470 371.07893 P 901.95498 451.48119 301.32325 7 10 1258.39920 629.70330 420.13800 F 804.83818 402.92279 268.95099 6 11 1444.61330 722.81035 482.20936 W 657.66098 329.33419 219.89192 5 12 1573.72890 787.36815 525.24790 E 471.44688 236.22714 157.82055 4 13 1644.80760 822.90750 548.94080 A 342.33128 171.66934 114.78202 3 14 1781.94900 891.47820 594.65460 H 271.25258 136.12999 91.08912 2 15 D 134.11118 67.55929 45.37532 1
Example 27
[0229] Complment protein Breakdown Products and Peptide Fragments. As shown in Table 48A, Complement protein Clqb, C3, C5, Cls, and CR1 peptides were identified in only human CSF samples, not control CSF samples.
TABLE-US-00061 TABLE 48A Complement protein C1q, C3, C5, C1s and CR1 peptides identified in human CSF samples Complement C1q subcomponent subunit B D6R934 Peptide: HGEFGEKGDPGIPG Microglia activation SEQ ID NO: 701 Complement C3 P01024 Peptide: HWESASLL Microglia activation SEQ ID NO: 702 Peptide: VKVFSLAVNLIAI Microglia activation SEQ ID NO: 703 Complement receptor type 1 CR1 E9PDY4 Peptide: KTPEQFPFAS Microglia activation SEQ ID NO: 704 Complement C5 P01031 Peptide: VTcTNAELVKGRQ Microglia activation SEQ ID NO: 705 Complement C1s P09871 Peptide: IISGDTEEGRLcGQ Microglia activation SEQ ID NO: 706 RSSNNPHSPIVE
Example 27
Summary Information
[0230] Table 49, below, is a spreadsheet showing additional representative PFs from brain proteins uniquely identified from human CSF ultrafiltrate samples. Table 50, below, shows combined evidence of PFs from brain proteins (peptidome) found in brain ultrafiltrate in the mouse model of TBI and/or in CSF samples from human TBI subjects. This summarizes the results showing that human biofluid-based monitoring of additional brain protein derived PFs can be used to monitor central nervous system injury such as TBI.
TABLE-US-00062 TABLE 49 Representative Peptide Fragments Uniquely Identified from Human CSF Ultrafiltrate Samples. Protein Human length SEQ Protein (accession Gene (Peptide MH+ ΔM m/z ID number) Name location) Sequence ΔCn XCorr Charge (Da) (ppm) (Da) NO Brevican Core BCAN 911 YENWNPGQPDSYFLSGE 1.224 2.03 3 3474.66 −20.18 1158.89 433 Protein (765-793) NcVVmVWHDQGQ.sup.1 (Q96GW7) Calmodulin- CAMSAP1 1613 NSLTRVDGQPRGAAIA 1.008 2.54 3 1910.64 256.93 637.55 434 regulated Spectrin- (456-473) WP associated Protein 1 (Q5T5Y3-3) Calmodulin- CAMSAP3 1249 ASSPAATNSEVKmTSFA 0.185 2.26 3 2257.03 −223.61 753.01 435 regulated Spectrin- (551-572) ERKK.sup.2 associated Protein 3 (Q9P1Y5) Calmodulin- CAMK2B 666 FGFAGTPGYLSPEVLRK 0.238 2.64 3 2482.71 −635.85 828.24 436 dependent Protein (172-194) EAYGKP Kinase IIB (Q13554) Chondroitin CSPG4 2322 PEPFWEAHDT 0.325 2.31 2 1229.24 −44.05 615.12 437 Sulfate (1664- Proteoglycan 1673) (Q6UVK1) Disks Large DLG4 721 LGFSIAGGTDN 0.161 2.51 3 1052.26 127.36 351.43 438 (postsynaptic (72-82) density protein95, PSD-95) (P78352-3) Fructose- ALDOC 364 EEFIKRAEVNGLAA 1.183 2.27 2 1547.30 −293.99 37.02 439 bisphosphate (325-339) aldolase C (P09972) Glial fibrillary GFAP 432 DGEVIKESKQEHKDVM 0.154 2.67 2 1873.82 383.80 937.41 440 acidic protein (417-432) (P14136) Huntingtin HTT 3142 YITAAcEmVAEmVESLQ 0.170 2.05 3 2163.96 −241.51 721.99 441 (P42858) (2355- SV.sup.3 2373) Macrophage MRC1 1456 GQASLEcLRMGSSLVSIE 0.000 1.78 3 3462.39 −144.43 1154.80 442 mannose receptor (1257- SAAESSFLSYRVEP.sup.4 1; MRC1, CD208 1288) (P22897) Microtubule- MAP2 1823 TYEQALAKDLSI 0.293 2.08 2 1352.50 −20.10 676.75 443 associated protein (991-1002) 2; isoform 3 (P11137) Microtubule- MAP6 813 TKYSEATEHPGAPPQPP 0.145 3.65 3 2258.48 12.70 753.50 444 associated protein (31-51) PPQQ 6 (Q96JE9) Golli-MBP, MBPA1 304 NAWQDAHPADPGSRPH 0.235 2.16 3 1982.92 −117.80 661.65 445 isoform 3; myelin (75-92) LI A1; HOG7 (P02686-1) Myelin basic MBP 197 IVTPRTPPPSQG 0.238 2.25 2 1250.09 −277.39 625.55 446 protein, isoform 4 (120-131) (P02686-3) Myelin expression MYEF2 600 LGSAmIGGFAGRIGSSN 0.206 2.04 3 2803.90 260.88 935.31 447 factor 2 (435-465) MGPVGSGISGGmGS.sup.5 (Q9P2K5) Myelin MYT1 1121 IKQLNQEIRDLNESNSEm 0.150 2.04 3 2378.06 −219.52 793.36 448 transcription factor (1004- EA.sup.6 1 (Q01538) 1023) Neurocan core NCAN 1321 GHLTSVHSPEEHSFINSF 1.187 3.07 3 3632.11 44.04 1211.38 449 protein; CSPG3 (1121- GHENTWIGLNDRIV (O14594) 1152) Neurogranin NRGN 78 GPGGPGGAGVARGGA 0.594 2.77 2 1407.27 546.06 704.14 450 (Q92686) (57-75) GGGP Nesprin-1 SYNE1 8797 HSAKEELHR 0.123 2.15 3 1106.67 −494.70 369.56 451 (Q8NF91) (2856- 2865) Neurexin-1 alpha NRXN1 1547 VDFFAIEmLDGHLYLLL 0.136 2.17 3 3841.27 164.67 1281.09 452 (Q9ULB1-3) (578-610) DmGSGTIKIKALLKKVN.sup.7 Neurofilament NEFM 877 KEEEPEAEEEEVAAKKS 0.162 2.85 3 2128.81 −222.20 710.28 453 medium (495-513) PV polypeptide (E7ESP9) Neurofilament NEFL 543 AMQDTINKLENELRTTK 0.123 2.57 3 2424.94 73.55 808.99 454 light polypeptide (346-366) SEMA (P07196) Spectrin alpha SPTAN1 2477 KMKGLNGKVSDLEKA 0.110 2.05 2 1619.36 259.70 810.18 455 chain, (1955- nonerythrocytic 1 1969) (A6NG51; Q13813-2) Spectrin, beta, SPTBN1 2155 AQQYYFDAAEAEAWM 0.154 2.19 3 3610.48 −126.72 1204.17 456 nonerythrocytic 1 (1581- SEQELYmMSEEKAKD.sup.8 (Q01082) 1610) Spectrin beta SPTBN2 2390 GQYSDINNRWDLPDSD 0.136 2.22 2 2082.75 288.29 1041.88 457 nonerythrocytic 2 (17-33) W (O15020) Spectrin, beta, SPTBN4 2564 EHAEIARWGQTL 1.177 2.03 2 1410.77 −558.29 705.89 458 nonerythrocytic 4 (2527- (Q9H254) 2539) Striatin STRN 780 DPYDSYDPSVLRGPL 0.165 2.57 3 1695.15 182.57 565.72 459 (O43815) (551-565) Synapsin I SYN1 705 QASQAGPVPRTGPPTTQ 0.181 2.04 3 2074.61 −329.93 692.21 460 (P17600-2) (603-622) QPR Synapsin III SYN3 580 GRDYIIEVmDSSmPLIGE 0.176 2.25 3 3796.92 −94.71 1266.31 461 (P07437) (359-391) HVEEDRQLmADLVVS.sup.9 Synaptojanin-1 SYNJ1 1350 SHSLPSEASSQPQQEQPS 1.103 3.36 2 1982.57 275.16 991.79 462 (C9JFZ1) (1332- G 1350) Tubulin beta 5 TUBB 444 GSQQYRALTVPELTQQV 0.117 2.32 3 2898.60 −250.19 966.87 463 (P07437) (277-301) FDAKNMMAA Vimentin VIM 466 TLLIKTVETRDGQVIN 1.000 2.11 2 1798.96 −591.29 899.98 464 (P08670) (441-456) .sup.1Modification: C19(Carbamidomethyl); M22(Oxidation). .sup.2Modification: M13(Oxidation). .sup.3Modification: C6(Carbamidomethyl); M8(Oxidation); M12(Oxidation) .sup.4Modification: C7(Carbamidomethyl) .sup.5Modification: M5(Oxidation); M29(Oxidation) .sup.6Modification: M18(Oxidation) .sup.7Modification: M8(Oxidation); M19(Oxidation) .sup.8Modification: M22(Oxidation) .sup.9Modification: M9(Oxidation); M13(Oxidation); M27(Oxidation)
TABLE-US-00063 TABLE 50 Summary of Peptide Fragments from Brain Proteins Found in Brain Ultrafiltrate Samples (Mouse Model of TBI and/or CSF Samples from Human TBI Subjects). in vivo Mouse Gene name (based Brain Lysate Human CSF Protein Name on human) CCI TBI Amyloid beta A4 precursor protein-binding family B APBB1 + + member 1-interacting protein Brain soluble acidic protein 1 BASP1 Brevican core protein (CSPG7) BCAN + + Calmodulin regulated spectrin-associated protein 1 CAMSAP1 + Calmodulin regulated spectrin-associated protein 2 CAMSAP2 + Calmodulin regulated spectrin-associated protein 3 CAMSAP3 + + Chondroitin sulfate proteoglycan 4 CSPG4 + + Cortexin-1 + Creatine kinase B-type CKB + Disks large homolog 4, PSD95 DLG4 + Disks large homolog 2, PSD98 DLG2 + Fructose-bisphosphate aldolase C ALDOC + Glial fibrillary acidic protein GFAP + Glutamate decarboxylase 1 GAD1 + Glutamate decarboxylase 2 GAD2 + Huntingtin HTT + + Macrophage mannose receptor 1 (CD208) MRC1 + + Microtubule-associated protein 1A MAP1A + Microtubule-associated protein 1B MAP1B + Microtubule-associated protein 2 MAP2 + + Microtubule-associated protein 6 MAP6 + + Microtubule-associated serine/threonine-protein MAST1 + kinase 1 Myelin basic protein, isoform 4 (21.5K) MBP (4) + + Golli-MBP (Myelin basic protein-A1) MBP (A1) + + Myelin transcription factor 1 MYT1 + Myelin expression factor 2 MYEF2 + Myelin regulatory factor MYRF + Nesprin-1 SYNE1 + Neurexin-1 NRXN1 + + Neurexin-3 NRXN3 + Neurocan NCAN + + Neurochondrin NCDN + Neurofascin NFASC + Neurofilament heavy polypeptide NEFH + Neurofilament light polypeptide NEFL + + Neurofilament medium polypeptide NEFM + Neurogranin NRGN + + Secretogranin-2 SCG2 + Striatin STRN + Synapsin I SYN1 + Synapsin II SYN2 + Synapsin III SYN3 + Synaptotagmin-2 SYT2 + Synaptojanin-1 SYNJ1 + Synuclein, beta SNCB + Tau MAPT + + Tubulin beta-4A chain TUBB4A + Tubulin beta-4B chain TUBB4B + Tubulin beta 5 TBB5 + Vimentin VIM + +
[0231] Additional key novel TBI PBP biomarkers identified were derived from Synapsin-I, II, III (SYN1, SYN2, SYN3), Cortexin-1,2,3 (CTXN1, CTXN2, CTXN3), Striatin (STRN), NRGN, Golli-MBP1, Tau-758, VIM, Brain acidic soluble protein (BASP1, BASP2 (GAP33)), Nesprin-1, Glutamate Decarboxylase-1, 2 (GAD1, GAD2), Neurexin-1, 2, 3 (NRXN1, NRXN2, NRXN3) Calmodulin-binding spectrin associated proteins-1, 2, 3 (CAMSAP1, 2, 3), and Chondroitin sulfate proteoglycans (CSPG4, Neurocan (CSPG3, brevican), and Neurochondrin. These proteins are listed in Table 48, with supporting data in Table 15. This example shows that human biofluid-based monitoring of additional these brain protein derived PBPs and/or PFs can be used to monitor brain injury such as TBI.
Example 28
Diagnosis of Trauma to the Central Nervous System
[0232] For diagnosis, prognosis or monitoring of trauma to the central nervous system the biofluid levels of protein, PBPs and PFs, or a battery of proteins, PBPs and/or PFs are measured. An initial subject fluid biological sample (such as blood, serum, plasma or CSF) is obtained within 24 or 72 hours after traumatic injury or suspected traumatic injury to the CNS (such as TBI), preferably within 24 hours after traumatic injury. The sample is subjected to ultrafiltration with a molecular cutoff of 10,000 Da, using a centrifugation-based ultrafiltration cell. The retentate is subjected to protein analysis. The filtrate is subjected to testing for PFs using an antibody-based immunoassay according to procedures well-known in the art, using antibodies that specifically recognize AEPRQEFEVMEDHAGTYGLG (SEQ ID NO:465), NVKMALDIEIAT (SEQ ID NO:466), DGEVIKES (SEQ ID NO:467), and GRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRF (SEQ ID NO:468). The signal indicating the amount of the peptide is compared to the signal from an equivalent control sample from a control, uninjured subject. An amount of one or more PFs that is two times the control amount, indicates an injury. Sample interpretations of results are shown in Table 51.
TABLE-US-00064 TABLE 51 Exemplary Sample Results. PF or PBP Result Specific Indication or Diagnosis Synapsin I PBP 4-fold higher in Traumatic injury to the CNS with levels in CNS severe synaptic damage injury subject's blood sample than average levels in normal control subjects GFAP (DGEVIKES; SEQ ID 2-3 fold higher in Traumatic injury to the CNS with NO: 469) levels in CNS moderate astroglia cell injury injury subject's blood sample than average levels in normal control subjects MAP6 4-fold higher in Traumatic injury to the CNS with (TKYSEATEHPGAPPQPPPPQQ; levels in CNS severe dendritic damage SEQ ID NO: 470) injury subject's blood sample than average levels in normal control subjects Striatin PBP 3-fold higher in Traumatic injury to the brain with levels in CNS moderate damage to the striatum injury subject's blood sample than average levels in normal control subjects Cortexin-1 PBP 6-fold higher in Traumatic injury to the brain with levels in CNS very severe damage to the cortex injury subject's blood sample than average levels in normal control subjects A Panel of the Synapsin I-PBP, with the above Traumatic injury to the CNS GFAP PF and MAP6 PF (above) indicated results (brain/spinal cord) with severe synaptic and dendritic damage, but moderate astroglia cell injury A Panel of Striatin PBP and with the above Traumatic injury to the brain with Cortexin-1 PBP indicated results very severe cortex injury, but moderate striatum injury
[0233] In order to determine the prognosis of the subject above, the following further tests should be performed on samples collected from the subject at the following times: 24 hours, 48 hours and 72 hours post injury. If the 72-hour results are less than ⅓ of the levels for the 24-hour results, the prognosis is good to excellent; if the 72-hour biomarker test levels are about the same as or higher than the levels seen in the sample taken at 24 hours, the prognosis is poor.
Example 29
[0234] For novel Golli-MBP protein,
[0235]
Example 29
Interpretation of Results
[0236] By comparing the signals yielded for specific proteins, PBPs and/or PFs to available standards (such as cranial/spinal computer tomography (CTO or Magnetic resonance imaging (MRI) detectable abnormality or Glasgow coma scale score, or Glasgow outcome scale score), their cutoff values can be assigned. Such cutoff values are compared to control samples or to a prepared chart of levels to determine the severity of the injury, or the prognosis of the subject, or monitoring of the patient injury progression or recovery. For example, higher biofluid levels of one or more protein, PBP or PF indicates the subject is more severely injured, more likely to develop post-trauma complications, or to prone to have poor patient outcome. For example, for blood levels of a protein, PBP or PF (e.g. as derived from synapsin) usually would have levels in control subjects of less than 10 pg/mL, while mild to moderate CNS injured subjects generally are expected to have a level between 10-50 pg/mL, and more severe CNS injury subjects generally are expected to have a level above 50 pg/mL
[0237] In another example, at least two measurements of these proteins, PBPs, and PFs as biomarkers are assayed in an initial and at least one subsequent sample. For example, first measurement within 24 hours of the incident, and a second or additional measurement after the first 24 hours. The values of these biomarker levels over time provide the ability to monitor the progression of the traumatic injury or the recovery of the CNS from the initial traumatic injury. For example, a CNS trauma subject that is on course for good recovery with no complications would have biomarker levels in the second or additional measurements that are lower than the biomarker levels of the same biomarker(s) at a prior measurement. On the other hand, a subject who has biomarker(s) levels in the second or additional measurements that are higher than the biomarker levels of the same biomarker(s) at a prior measurement could indicate there is a deterioration or evolution of the injury condition, development secondary injury or post-trauma neurodegeneration development. For this later group, once identified, more aggressive medical monitoring and/or medical intervention then can be administrated.
REFERENCES
[0238] References listed below and throughout the specification are hereby incorporated by reference in their entirety. [0239] 1. U.S. Pat. No. 7,291,710 to Hayes, et al. [0240] 2. U.S. Pat. No. 7,396,654 to Hayes, et al. [0241] 3. U.S. Pat. No. 7,456,027 to Hayes, et al. [0242] 4. U.S. Pat. No. 7,611,858 to Svetlov, et al. [0243] 5. International Patent Publication No. PCT/US2015/024880 to Wang. [0244] 6. Wang, Trends Neurosci. 23:59, 2000. [0245] 7. Yang et al., PLOS ONE 5, e15878, 2010. [0246] 8. Yang et al., J. Cerebral Blood Flow Metab. 34:1444-1452, 2014. [0247] 9. Wang et al., Expert Rev. Molec. Diagnostics E-pub PMID: 29338452, 2018