COMPOSITIONS AND METHODS FOR PREVENTING OR TREATING MACULAR DEGENERATION
20210275645 · 2021-09-09
Inventors
- Jae G. Pan (Sejong, KR)
- Eui J. Kim (Daejeon, KR)
- Jeong H. Kim (Seongnam-Si, KR)
- Do Y. Yum (Daejeon, KR)
Cpc classification
C07K16/22
CHEMISTRY; METALLURGY
International classification
A23L29/00
HUMAN NECESSITIES
A23L33/135
HUMAN NECESSITIES
Abstract
The present invention relates, in part, to methods of preventing or treating macular degeneration in a subject by administering a composition comprising a superoxide dismutase enzyme. The present invention also provides pharmaceutical and/or food compositions comprising a superoxide dismutase enzyme.
Claims
1. A method of treating or preventing macular degeneration, comprising administering to a subject in need thereof a composition comprising a superoxide dismutase (SOD) enzyme; or a method of decreasing or inhibiting choroidal neovascularization (CNV) by contacting a retina with a composition comprising a SOD enzyme.
2.-3. (canceled)
4. The method of claim 1, wherein the SOD enzyme comprises: (a) the amino acid sequence with at least or about 85% identity to the sequence set forth in SEQ ID NO: 1 or SEQ ID NO: 38; (b) the amino acid sequence set forth in SEQ ID NO: 1 or SEQ ID NO: 38, wherein the amino acid residue Asn74 and/or Asn137 is deleted or substituted; (c) the amino acid sequence set forth in SEQ ID NO: 1 or SEQ ID NO: 38, wherein the amino acid residue Asn74 and/or Asn137 is substituted with Asp74 and/or Asp137; or (d) the amino acid sequence set forth in SEQ ID NO: 1 or SEQ ID NO: 38.
5. The method of claim 1, wherein the SOD enzyme (i) is an isolated enzyme, (ii) binds manganese, and/or (iii) is coated with shellac.
6. The method of claim 1, wherein the composition is administered orally, intravenously, intraocularly, or intramuscularly, optionally wherein the composition is administered orally.
7. (canceled)
8. The method of claim 1, wherein the SOD enzyme is from a microorganism, preferably a bacterium, preferably a bacterium generally regarded as safe (GRAS) for use as food, more preferably a Bacillus species bacterium.
9. The method of claim 8, wherein the SOD enzyme is from Bacillus amyloliquefaciens GF423 strain (KCTC 13222BP).
10. The method of claim 1, wherein the composition (i) decreases choroidal neovascularization (CNV); (ii) decreases cell death in the retina; (iii) decreases inflammation in the retina; (iv) decreases the expression of vascular endothelial growth factor (VEGF) in the retina; (v) decreased the expression of Hypoxia-inducible factor 1-alpha (HIF-1-alpha) in the retina; and/or (vi) increases the retinal function.
11. The method of claim 1, wherein the macular degeneration is an age-related macular degeneration (AMD), preferably wherein the AMD is a wet AMD or a neovascular AMD.
12. The method of claim 1, wherein the composition is a pharmaceutical composition or a nutraceutical food.
13. The method of claim 1, further comprising administering at least one additional agent that treats macular degeneration; or decreases or inhibits CNV, optionally wherein the at least one additional agent is ranibizumab or aflibercept.
14. (canceled)
15. The method of claim 1, wherein the subject is a mammal, preferably wherein the mammal is a human, a dog, a cat, a mouse, or a rat, optionally wherein the subject is a human.
16.-26. (canceled)
27. An engineered polypeptide, a pharmaceutical composition, or a medical or nutraceutical food comprising a superoxide dismutase (SOD) enzyme.
28-30. (canceled)
31. The engineered polypeptide, the pharmaceutical composition, or the medical or nutraceutical food of claim 27, wherein the SOD enzyme comprises: (a) the amino acid sequence with at least or about 85% identity to the sequence set forth in SEQ ID NO: 1 or SEQ ID NO: 38; (b) the amino acid sequence set forth in SEQ ID NO: 1 or SEQ ID NO: 38, wherein the amino acid residue Asn74 and/or Asn137 is deleted or substituted; (c) the amino acid sequence set forth in SEQ ID NO: 1 or SEQ ID NO: 38, wherein the amino acid residue Asn74 and/or Asn137 is substituted with Asp74 and/or Asp137; or (d) the amino acid sequence set forth in SEQ ID NO: 1 or SEQ ID NO: 38.
32. The engineered polypeptide, the pharmaceutical composition, or the medical or nutraceutical food of claim 27, wherein the SOD enzyme (i) is an isolated enzyme, (ii) binds manganese, and/or (iii) is coated with shellac.
33. The engineered polypeptide, the pharmaceutical composition, or the medical or nutraceutical food of claim 27, wherein the pharmaceutical composition is an oral composition.
34. The engineered polypeptide, the pharmaceutical composition, or the medical or nutraceutical food of claim 27, wherein the SOD enzyme is from a microorganism, preferably a bacterium, preferably a bacterium generally regarded as safe (GRAS) for use as food, more preferably a Bacillus species bacterium.
35. The engineered polypeptide, the pharmaceutical composition, or the medical or nutraceutical food of claim 34, wherein the SOD enzyme is from Bacillus amyloliquefaciens GF423 strain (KCTC 13222BP).
36. The engineered polypeptide, the pharmaceutical composition, or the medical or nutraceutical food of claim 27, wherein the engineered polypeptide, pharmaceutical composition, or medical or nutraceutical food (i) decreases choroidal neovascularization (CNV); (ii) decreases cell death in the retina; (iii) decreases inflammation in the retina; (iv) decreases the expression of vascular endothelial growth factor (VEGF) in the retina; (v) decreased the expression of Hypoxia-inducible factor 1-alpha (HIF-1-alpha) in the retina; and/or (v) increases the retinal function.
37. The engineered polypeptide, the pharmaceutical composition, or the medical or nutraceutical food of claim 27, further comprising at least one additional agent that decreases or inhibits CNV in the retina, optionally wherein the at least one additional agent is ranibizumab or aflibercept.
38.-49. (canceled)
50. A kit comprising the engineered polypeptide, the pharmaceutical composition, or the medical or nutraceutical food of claim 27.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
DETAILED DESCRIPTION
[0037] The present invention relates, in part, to compositions and methods for preventing and treating macular disorder (e.g., AMD, wet AMD). It is discovered herein that an oral composition comprising SOD is effective in inhibiting choroidal neovascularization (CNV) associated with wet AMD.
[0038] In certain aspects, provided herein are methods of treating or preventing macular degeneration by administering to a subject in need thereof an effective amount of a composition comprising a SOD enzyme. Also provided herein are methods of decreasing or inhibiting choroidal neovascularization (CNV) by contacting a retina with a composition comprising a SOD enzyme.
[0039] The methods may comprise the SOD enzyme that is isolated or purified. In some embodiments, the SOD enzyme is from a microorganism. In some such embodiments, the SOD enzyme is from a bacterium. In some embodiments, the SOD enzyme is from a bacterium generally regarded as safe (GRAS) for use as food. In some embodiments, the SOD enzyme is from a Bacillus species bacterium. In some such embodiments, the SOD enzyme is from the Bacillus amyloliquefaciens GF423 strain (KCTC 13222BP).
[0040] The methods may comprise various routes of administration. In some embodiments, the methods comprise administering orally the composition comprising the SOD enzyme. In some embodiments, the SOD enzyme is coated with shellac. In some embodiments, the methods comprise administering a pharmaceutical composition comprising the SOD enzyme.
[0041] The methods may result in a number of biological changes. For example, the methods may (i) decrease choroidal neovascularization (CNV); (ii) decrease cell death in the retina; (iii) decrease inflammation in the retina; (iv) decrease the expression of vascular endothelial growth factor (VEGF) in the retina; and/or (v) increase the retinal function.
[0042] The methods may treat various types and symptoms of macular degeneration. For example, the methods may treat an age-related macular degeneration (AMD). In addition, the methods may treat a wet AMD or a neovascular AMD.
[0043] The methods may comprise administering to a subject at least one additional agent that treats macular degeneration. In some embodiments, the at least one additional agent is ranibizumab or aflibercept.
[0044] The methods may treat various subjects. In some embodiments, the subject is a mammal, preferably a human, a dog, a cat, a mouse, or a rat. In preferred embodiments, the subject is a human.
[0045] In certain aspects, provided herein are pharmaceutical compositions comprising a SOD enzyme. Also provided herein are engineered polypeptides comprising a SOD enzyme. Further provided herein are medical or nutraceutical foods comprising a SOD enzyme.
[0046] The engineered polypeptides may comprise a mutation, e.g., deletion, insertion, or substitution of one or more amino acids that may or may not affect various aspects of the polypeptide, e.g., stability (in vitro, ex vivo, or in vivo), homogeneity, and/or structural conformation changes. In some embodiments, the engineered polypeptides may comprise a truncation. In some embodiments, the engineered polypeptides may comprise a heterologous nucleic acid (e.g., HIS tag, HA tag, myc tag, other tags that are well known in the art, GFP, and/or Fc domain of an antibody) that may be useful, e.g., in purification, detection (in vitro, ex vivo, or in vivo), or extension of in vivo stability of said polypeptides.
[0047] The compositions or food may comprise the SOD enzyme that is isolated or purified. In some embodiments, the SOD enzyme is from a microorganism. In some such embodiments, the SOD enzyme is from a bacterium. In some embodiments, the SOD enzyme is from a bacterium generally regarded as safe (GRAS) for use as food. In some embodiments, the SOD enzyme is from a Bacillus species bacterium. In some such embodiments, the SOD enzyme is from the Bacillus amyloliquefaciens GF423 strain (KCTC 13222BP).
[0048] The compositions or food may comprise various forms. In some embodiments, the composition is an oral composition. In some embodiments, the food is ingested orally. In some embodiments, the SOD enzyme is coated with shellac.
[0049] The compositions or food may result in a number of biological changes. For example, the compositions or food may (i) decrease choroidal neovascularization (CNV); (ii) decrease cell death in the retina; (iii) decrease inflammation in the retina; (iv) decrease the expression of vascular endothelial growth factor (VEGF) in the retina; (v) decreased the expression of Hypoxia-inducible factor 1-alpha (HIF-1-alpha) in the retina; and/or (vi) increase the retinal function.
[0050] The compositions or food may comprise at least one additional agent that treats macular degeneration or inhibits CNV. In some embodiments, the at least one additional agent is ranibizumab or aflibercept.
[0051] In some embodiments, the SOD enzyme of the engineered polypeptides, compositions (e.g., pharmaceutical composition, oral composition), or medical or nutraceutical foods of the present disclosure, or the SOD enzyme used in the methods described herein, may comprise the amino acid sequence with at least or about 30%, 35%, 40%, 45%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.1%, 99.2%, 99.3%, 99.4%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% identity to the sequence set forth in SEQ ID NO: 1.
[0052] In some embodiments, the SOD enzyme of the engineered polypeptides, compositions (e.g., pharmaceutical composition, oral composition), or medical or nutraceutical foods of the present disclosure, or the SOD enzyme used in the methods described herein, may comprise the amino acid sequence set forth in SEQ ID NO: 1, wherein the amino acid residue Asn74 and/or Asn137 is deleted or substituted.
[0053] In some embodiments, the SOD enzyme of the engineered polypeptides, compositions (e.g., pharmaceutical composition, oral composition), or medical or nutraceutical foods of the present disclosure, or the SOD enzyme used in the methods described herein, may comprise the amino acid sequence set forth in SEQ ID NO: 1, wherein the amino acid residue Asn74 and/or Asn137 is substituted with Asp74 and/or Asp137.
[0054] In some embodiments, the SOD enzyme of the engineered polypeptides, compositions (e.g., pharmaceutical composition, oral composition), or medical or nutraceutical foods of the present disclosure, or the SOD enzyme used in the methods described herein, may comprise the amino acid sequence set forth in SEQ ID NO: 1.
[0055] In some embodiments, the engineered polypeptides, compositions (e.g., pharmaceutical composition, oral composition), or medical or nutraceutical foods of the present disclosure may be administered orally, intravenously, intraocularly, or intramuscularly.
[0056] In preferred embodiments, the engineered polypeptides, compositions (e.g., pharmaceutical composition, oral composition), or medical or nutraceutical foods of the present disclosure may be administered orally.
[0057] In certain aspects, provided herein are kits comprising the engineered polypeptides, the pharmaceutical compositions, or the medical or nutraceutical foods of the present disclosure.
Definitions
[0058] The articles “a” and “an” are used herein to refer to one or to more than one (i.e. to at least one) of the grammatical object of the article. By way of example, “an element” means one element or more than one element.
[0059] The term “administering” is intended to include routes of administration which allow therapy to perform its intended function. Examples of routes of administration include oral administration, sublingual administration, and intravitreal administration. As used herein, the term “age-related macular degeneration” or “AMD” includes early, intermediate, and advanced AMD, and also includes both dry macular degeneration, geographic atrophy, and wet macular degeneration, also known as neovascular or exudative AMD.
[0060] The terms “conjoint therapy” and “combination therapy,” as used herein, refer to the administration of two or more therapeutic substances. The different agents comprising the combination therapy may be administered concomitant with, prior to, or following the administration of one or more therapeutic agents.
[0061] As used herein, the terms “prevent,” “preventing,” and “prevention” are art-recognized, and when used in relation to a medical condition such as a loss of vision, or a disease such as macular degeneration, is well understood in the art, and include administration of a composition which reduces the frequency of, or delays the onset of, symptoms of a medical condition (e.g., blurry vision or a loss of vision) in a subject relative to a subject which does not receive the composition.
[0062] The term “subject” or “patient” refers to any healthy or diseased animal, mammal or human, or any animal, mammal or human. In some embodiments, the subject is afflicted with macular degeneration (e.g., neovascular macular degeneration). In various embodiments of the methods of the present invention, the subject has not undergone treatment. In other embodiments, the subject has undergone treatment.
[0063] As used herein, the term “therapeutically effective amount” of the composition or agent refers to an amount of an agent which provides the desired effect, such as reducing, preventing or slowing the progression of physical changes associated with macular degeneration in the eye, or reducing, preventing or slowing the progression of symptoms (e.g., accumulation of drusen, abnormal blood vessel growth in the eye, abnormal fluid in the eye, blood and protein leakage, etc.) resulting from them. The exact amount of agent required may vary from subject to subject depending on the species, age and general condition of the subject, mode of administration, and the like. However, an appropriate “effective amount” in any individual case may be determined by one of ordinary skill in the art using routine experimentation.
[0064] The term “treating” includes prophylactic and/or therapeutic treatments. The term “prophylactic or therapeutic” treatment is art-recognized and includes administration to the host of one or more of the subject compositions. If it is administered prior to clinical manifestation of the unwanted condition (e.g., disease or other unwanted state of the host animal), then the treatment is prophylactic (i.e., it protects the host against developing the unwanted condition); whereas, if it is administered after manifestation of the unwanted condition, the treatment is therapeutic (i.e., it is intended to diminish, ameliorate, or stabilize the existing unwanted condition or side effects thereof).
Macular Degeneration
[0065] The pathogenesis of AMD is still incompletely understood due to various factors. Aging of retinal pigment epithelial layer (RPE) cells and Bruch's membrane, impaired blood flow in the vascular membrane of the eye, retinal exposure to ultraviolet light and blue light, and genetic predisposition are believed to play an important role in the development of AMD.
[0066] The loss of RPE cells, which appears in the early stage of AMD, is mainly due to oxidative stress, which results from weakening of the antioxidant cell defense system or increased concentration of reactive oxygen species, and thus effective removal of reactive oxygen species may be essential for prevention and treatment of AMD.
[0067] From 1% to 5% of the total oxygen consumption in the body is converted into reactive oxygen species (ROS), which are the major source of oxidative stress. An imbalance between routine production and detoxification of reactive oxygen species (“ROS”) such as peroxides and free radicals can result in oxidative damage to cellular structures and machinery. The human retina consumes a large amount of oxygen, and in particular, retinal pigment epithelial cells produce a large amount of reactive oxygen species because these cells phagocytose the visual cell outer segment. In addition, intracellular reactive oxygen species are also produced through the mitochondrial electron transport system. Oxidative stress-induced retinal pigment epithelial cells undergo induced apoptosis or show changes such as mitochondrial DNA damage, increased vascular endothelial growth factor (VEGF), decreased antioxidant enzymes, and increased inflammatory responses.
Superoxide Dismutase (SOD)
[0068] Superoxide dismutase (SOD) is an enzyme that alternately catalyzes the dismutation of the superoxide (O.sub.2—) radical into either ordinary molecular oxygen (O.sub.2) or hydrogen peroxide (H.sub.2O.sub.2). Thus, SODs play a key role in decreasing oxidative stress by removing reactive oxygen species. SODs are widely distributed in prokaryotic and eukaryotic cells and have been classified into four families based on their different types of metal centers [copper/zinc, nickel, manganese, and iron]. Manganese-containing SODs [Mn-SODs] are widely present in many bacteria, chloroplasts, mitochondria, and cytosol of eukaryotic cells. The SOD enzyme derived from B. amyloliquefaciens GF423 strain (KCTC 13222BP) is a Mn-SOD and has the amino acid sequence of SEQ ID NO: 1.
Isolation/Purification of SOD
[0069] An “isolated” or “purified” SOD or biologically active portion thereof is substantially free of cellular material or other contaminating proteins from the cell or tissue source from which the enzyme is derived. The language “substantially free of cellular material” includes preparations of a polypeptide, in which the protein is separated from cellular components of the cells from which it is isolated or recombinantly produced. In some embodiments, the language “substantially free of cellular material” includes preparations of protein, having less than about 30% (by dry weight) of non-desired protein, more preferably less than about 20% of non-desired protein, still more preferably less than about 10% of non-desired protein, and most preferably less than about 5% non-desired protein.
[0070] SOD can be isolated or purified from various sources, including natural or recombinant hosts. For example, SOD having an activity of preventing or treating macular degeneration disease can be extracted from the culture supernatant of the B. amyloliquefaciens GF423 strain. First, a culture can be obtained by culturing the B. amyloliquefaciens GF423 strain in various types of media. In some embodiments, a complex medium (pH 6.0 to 7.0) is used to grow the bacteria at 25 to 42° C. for 1 to 4 days. Other suitable media for culturing the B. amyloliquefaciens GF423 strain include LB (Luria-Bertani) medium, ISP (International Streptomyces Project) medium, NA (nutrient agar) medium, BHI (brain heart infusion agar) medium, SDA (sabouraud dextrose agar) medium, PDA (potato dextrose agar) medium, NB (nutrient broth) medium, and the like. In preferred embodiments, LB medium, ISP medium, BHI medium, SDA medium, or NB medium may be used.
[0071] SOD may also be sourced from other natural or recombinant hosts using the information provided in databases such as PubMed or BRENDA (world wide web at brenda-enzymes.org).
[0072] The SOD is preferably purified by the following purification method but is not limited thereto. A culture obtained by culturing the B. amyloliquefaciens GF423 strain is centrifuged to collect the culture supernatant. The supernatant fraction is pretreated by solid-phase extraction and then isolated and purified by chromatography. Various modes of chromatography may be used to purify SOD. In preferred embodiments, a hydrophobic interaction chromatography is used.
Pharmaceutical Compositions
[0073] The composition of the present invention may further comprise a conventional pharmaceutically acceptable carrier or excipient. In addition, the SOD enzyme derived from the B. amyloliquefaciens GF423 strain may be formulated with various additives, such as a binder, a coating agent and the like, which are pharmaceutically commonly used.
[0074] The pharmaceutical composition containing the SOD according to the present invention may contain a pharmaceutically acceptable carrier. For oral administration, the pharmaceutically acceptable carrier may include a binder, a lubricant, a disintegrant, an excipient, a solubilizer, a dispersing agent, a stabilizer, a suspending agent, a coloring agent, a flavoring agent, and the like. For topical administration, the pharmaceutically acceptable carrier may include a base, an excipient, a lubricant, a preservative, and the like. The pharmaceutical composition of the present invention may be formulated into a variety of dosage forms in combination with the aforementioned pharmaceutically acceptable carriers. For example, for oral administration, the pharmaceutical composition may be formulated in solid or liquid dosage forms such as tablets, troches, capsules, elixirs, suspensions, syrups, wafers, or the like. In addition, the pharmaceutical composition may be formulated into solutions, suspensions, tablets, capsules, sustained-release preparations, or the like.
[0075] Meanwhile, examples of the carrier, excipient, and diluent suitable for formulation may include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, acacia gum, alginate, gelatin, calcium phosphate, calcium silicate, cellulose, methyl cellulose, microcrystalline cellulose, polyvinyl pyrrolidone, water, methylhydroxy benzoate, propylhydroxy benzoate, talc, magnesium stearate, mineral oil, or the like. In addition, the pharmaceutical composition may further contain a filler, an anti-agglutinating agent, a lubricating agent, a wetting agent, a flavoring agent, an emulsifying agent, a preservative, or the like.
[0076] In the method of the present invention, the SOD enzyme may be coated with shellac. When the SOD is administered orally, a problem may arise in that the activity of the SOD is reduced rapidly in the gastrointestinal tract, leading to a decrease in the bioavailability and efficiency thereof. This problem is further exacerbated by the difficulty of delivering the SOD to the particular cell location where the SOD is most effective. Thus, in the method of the present invention, the SOD enzyme may be coated in a solution. Specifically, a purified solution and a shellac-containing solution are mixed with each other, and then freeze-dried. This freeze-dried sample may be powdered and stored at about 4° C. until use. Examples of coatings suitable for use in the present invention include shellac, ethyl cellulose, hydroxypropyl methylcellulose, hydroxypropyl methylcellulose phthalate, zein, Eudragit, and combinations thereof.
Dose
[0077] The dose of the pharmaceutical composition of the present invention, which contains the SOD produced from the B. amyloliquefaciens GF423 strain, may be suitably determined in consideration of the purpose of treatment or prevention, the type of patient to be prevented or treated, the patient's condition, weight, age or sex, etc. For example, the composition of the present invention may contain, as an active ingredient, the SOD produced by the B. amyloliquefaciens GF423 strain in a therapeutically effective amount or at a nutritionally effective concentration. Preferably, the composition may contain the SOD in an amount of 2 to 300 U/mg, based on the total weight of the composition.
A Medical or Nutraceutical Food
[0078] Still another aspect of the present invention provides a food, particularly a nutraceutical food, or medical food, for preventing or ameliorating macular degeneration and a degenerative decline in eye function, the food containing a SOD derived from the B. amyloliquefaciens GF423 strain. The SOD has the amino acid sequence of SEQ ID NO: 1.
[0079] As used herein, the term “nutraceutical food” or “medical food” means a food prepared with such a raw material or a component that is likely to be beneficial for function of the human body, which is defined by Ministry of Food and Drug Safety as the food to maintain or improve health by maintaining the normal function or by activating the physiological function of the human body, but not always limited thereto and does not exclude any conventional health food in its meaning.
[0080] The nutraceutical or medical food of the present invention may be prepared and processed in the form of tablets, capsules, powders, granules, liquids, pills, or the like, for the purpose of preventing or ameliorating macular degeneration. Conventional additives include, for example, chemical synthetic additives, such as ketones, glycine, calcium citrate, nicotinic acid, cinnamic acid, and the like; natural additives, such as persimmon color, licorice extract, crystalline cellulose, kaoline pigment, guar gum, and the like; and mixed formulations, such as L-sodium glutamate formulations, alkali additives for noodles, preservative formulations, tar color formulations, and the like. For example, a nutraceutical food in the form of a tablet may be prepared by granulating a mixture of the active ingredient SOD of the present invention with an excipient, a binder, a disintegrating agent and other additives by a conventional method, and then adding a lubricant, or the like thereto, followed by compression molding, or directly compression-molding the mixture. In addition, the nutraceutical food in the form of a tablet may contain a corrigent, or the like, if necessary.
[0081] Among nutraceutical foods in the form of a capsule, a hard capsule formulation may be prepared by filling a hard capsule with a mixture of the active ingredient SOD or bacterial strain powder of the present invention with an additive, such as an excipient. A soft capsule formulation may be prepared by filling a mixture of the SOD or the strain powder with an additive, such as an excipient, into a capsule such as a gelatin capsule. The soft capsule formulation may, if necessary, contain a plasticizer, such as glycerin or sorbitol, a coloring agent, a preservative, or the like.
[0082] A nutraceutical food in the form of a pill may be prepared by molding a mixture of the active ingredient SOD of the present invention with an excipient, a binder, a disintegrant, and the like by a known method. The pill formulation may, if necessary, be coated with white sugar or other coating agent or may also be surface-coated with a substance such as starch or talc.
Conjoint or Combination Therapy
[0083] The methods and compositions provided herein may contain a single such molecule or agent (e.g., SOD) or any combination of the agents that are useful in treating macular degeneration. A single active agent described herein can be combined with one or more other pharmacologically active compounds known in the art according to the methods and compositions provided herein. It is believed that certain combinations work synergistically in the treatment of macular degeneration (e.g., wet AMD) or in the inhibition of CNV. Second active agents can be large molecules (e.g., proteins) or small molecules (e.g., synthetic inorganic, organometallic, or organic molecules).
[0084] In some embodiments, at least one additional therapy that may be combined with SOD is an agent that can treat macular degeneration. In some embodiments, the agent is approved by the U.S. Food and Drug Administration. In some such embodiments, the agent is afilbercept, an inhibitor of VEGF. In other such embodiments, the agent is ranibizumab, another inhibitor of VEGF. In some embodiments, the compositions provided herein are used as a primary treatment. In other embodiments, the compositions are used as adjuvant therapy. In some such embodiments, the compositions may be administered to a subject before, concurrently, or after the administration of the primary treatment.
Kits
[0085] The present invention also encompasses kits. For example, the kit can comprise an engineered polypeptide of the present disclosure, a pharmaceutical composition as described herein, medical or nutraceutical food as described herein, a combination therapy including e.g., at least one additional agent that treats macular degeneration or decreases or inhibits CNV, for example, ranibizumab or aflibercept, or any combination thereof, packaged in a suitable container and can further comprise instructions for using such reagents. The kit may also contain other components, such as administration tools packaged in a separate container.
EXAMPLES
Example 1. Strain Isolation and Identification
[0086] 1) 16S rRNA Analysis
[0087] From Bacillus polyfermenticus purchased from Bi-Nex Co., Ltd., a strain was isolated (“the Strain”), and the Strain was identified and characterized as described below.
[0088] To characterize the Strain, a morphological and biochemical examination was performed. The morphological examination of the Gram stained bacteria indicated that the Strain was a Gram-positive bacillus. In addition, observation under a phase contrast microscope showed that the Strain formed endospores.
[0089] To determine the identity of the Strain, 16s rRNA sequencing was performed as follows. The genome of the Strain was purified (Sambrook, J. et al.: “Molecular Cloning. A Laboratory Manual, 3rd ed.,” 2001, Cold Spring Harbor Press), and sequenced using Illumina HiSeq PE100. Nine copies of the 16S rRNA gene (SEQ ID NOs: 2 to 10) were found. Among the 16S rRNA genes, BPJGP_r00130 (SEQ ID NO: 7) and BPJGP_r00160 (SEQ ID NO: 8) showed the same nucleotide sequence, but other 16S rRNA genes showed different nucleotide sequences. Thus, the Strain had eight 16S rRNA genes with distinct nucleotide sequences.
[0090] With 9 copies of the 16S rRNA gene, analysis for the genus identification was performed using the following database and softwares: The Ribosomal Database Project's Classifier (Wang, Q. et al., Appl Environ Microbiol., 73:5261-5267 (2007)), Living Tree Project's Aligner (Pruesse, E. et al., Bioinformatics, 28:1823-1829 (2012)), and EzTaxon database's Identity (Kim, O. S. et al., Int J Syst Evol Microbiol., 62:716721 (2012)). The Strain was identified to be a member of the genus Bacillus according to all the softwares listed above, with a confidence interval of 95% or more.
[0091] Species level identification of the isolated strain was performed using the EzTaxon database's Identity (Kim, O. S. et al., Int J Syst Evol Microbiol., 62:716721 (2012)). Although there is currently no international standard for the identity threshold of 16S rRNA for species level identification, 99% is the highest value of the most widely accepted thresholds (Yarza, P. et al., Nature Rev. Microbiol., 12: 635645 (2014)). Accordingly, the 99% threshold was used as a search standard. In addition, since the Strain had eight distinct 16S rRNA genes, a search was performed for each of the 16S rRNA genes. Among the found reference strains, the commonly found reference strains were selected. The search identified 80 different reference strains belonging to different species. This result is consistent with previous studies indicating that species belonging to the genus Bacillus cannot be distinguished using only the homology of 16S rRNA genes (Janda J. M. & Abbott S. L., J Clin Microbiol., 45:2761-2764 (2007); Maughan H. & Van der Auwera G., Infect Genet Evol., 11:789-797 (2011)).
[0092] Thus, in order to determine the identity of the Strain, a genome-based classification was performed. The homology between the Strain and the 80 strains identified above was analyzed using the in silico DNA-DNA Hybridization (DDH; Auch A. F. et al., Stand Genomic Sci., 28:117-234(2010)), and the reference strains showing a homology of greater than 70% were selected. Two reference strains were found in the analysis (see Table 1 below), and their ANI (the average nucleotide identity) and AAI (the average amino acid identity) at the genomic level with respect to the Strain were verified (Rodriguez-R L. M. & Konstantinidis K. T., https://doi.org/10.7287/peerj.preprints.1900v1 (2016)).
[0093] Table 1 below shows the analysis of the 16S rRNA gene, DDH, ANI and AAI of three strains, which showed the highest homology with the Strain in the DDH analysis.
TABLE-US-00001 TABLE 1 Bacillus Bacillus Bacillus Criteria for amyloliquefaciens amyloliquefaciens subtilis species plantarum amyloliquefaciens spizizenii classification Reference FZB42 DSM7 NRRLB-23049 strain 16S 99.67 to 99.73% 99.46 to 99.66% 99.18 to 99.39% 98.65% rRNA DDH 92.10% 78.60% 32.70% 70% ANI 98.65% 93.59% 80.04% 95% AAI 98.79% 95.09% 79.88% 95%
[0094] Comparison of the 16S rRNA genes described above identified the Strain as a microorganism belonging to B. amyloliquefaciens. The Strain was named Bacillus amyloliquefaciens GF423 and deposited with the Korean Collection for Type Cultures (KCTC), a patent strain depository authority, on Mar. 6, 2017, under accession number KCTC 13222BP.
Example 2. Isolation/Purification of Superoxide Dismutase (SOD) from Bacillus amyloliquefaciens GF423
[0095] 2.1 Culturing of Bacillus amyloliquefaciens GF423 Strain
[0096] For culturing of the Bacillus amyloliquefaciens GF423 strain, a single colony formed in LB agar medium (Luria-Bertani (LB) agar; 10 g/L tryptophan, 5 g/L yeast extract, 10 g/L NaCl, 15 g/L agar) was inoculated into 30 mL of LB medium and cultured at 37° C. for 12 hours. The seed culture was inoculated again into 3 L of LB medium containing 1 mM manganese sulfate (MnSO.sub.4) and was cultured at 37° C. for 20 hours. Then, a portion of the culture was used for the separation of SOD. The remaining portion was diluted at 10.sup.11 CFU/mL in phosphate buffered saline (PBS, 10 mM sodium phosphate, 130 mM sodium chloride, pH 7.4) and sonicated, and then the supernatant was collected by centrifugation, filtered through a filter having a pore size of 0.45 μm, freeze-dried, and then stored at −20° C. until use in an in vivo experiment.
[0097] 2.2 Isolation and Purification of Superoxide Dismutase
[0098] The culture of the B. amyloliquefaciens GF423 strain was centrifuged at 3,578×g at 4° C. for 20 minutes and the supernatant was collected and concentrated 10-fold by ultrafiltration (MWCO 10,000). Ammonium sulfate was added to 300 mL of the concentrated supernatant to a saturation degree of 60% with stirring at 4° C., followed by stirring for 30 minutes. Then, the supernatant was collected by centrifugation at 3,578×g for 30 minutes, and loaded onto a HiPrep™ Phenyl HP 16/10 column equilibrated with 50 mM potassium phosphate (pH 7.5) containing 2 M ammonium sulfate. Next, elution was performed using 50 mM potassium phosphate (pH 7.5) containing 2 M to 0.1 M ammonium sulfate. The SOD-containing fraction was collected, concentrated by UF (MWCO 10,000), and desalted by dialysis with 50 mM potassium phosphate (pH 7.5). The activity of the SOD was analyzed using a SOD assay kit (Cayman Chemical, Michigan, USA). One unit of SOD activity is defined as the amount of enzyme that inhibits superoxide radicals by 50%. The activity of the purified SOD enzyme was 2231.12±269 U/mg, and the molecular weight of the SDS was about 22,000 Dalton. The SOD derived from the B. amyloliquefaciens GF423 strain was designated as GF-101.
[0099] The SOD derived from the B. amyloliquefaciens GF423 (hereinafter GF-101) was coated with the natural coating agent shellac. Shellac was dissolved in 50 mM potassium phosphate (pH 7.0) buffer, mixed with a purified solution of the SOD, and freeze-dried. The freeze-dried sample was in a powder form and stored at 4° C.
Example 3. A Variant SOD, GF-103
[0100] Deamidation of some populations of Asn74 and Asn137 residues in the purified GF-101 was found by peptide mapping with trypsin digest (
TABLE-US-00002 TABLE 2 Theoretical Mass (T) GF103_190 11 Frag.sup.# Res.sup.# Modification m/z Charge m/z RT Sequencing T1 1-3 381.21 1 381.21 1.8 AYK T2 4-20 662.01 3 662.00 41.0 LPELPYAYDALEPHIDK T3 21-29 549.27 2 549.27 6.8 ETMTIHHTK T2-3 4-29 Miss-cleavage 613.31 5 613.31 3
.3 LPELPYAYDALEPHIDKETMTIHHTK T2-3(F) 4-23 Fragment, Miss-cleavage 782.38 3 782.38 4
.1 LPELPYAYDALEPHIDKETM T1-3 1-29 856.94 4 856.98 38.6 AYKLPELPYAYDALEPHIDKETMTIHHTK T4 30-40 447.56 3 447.56 12.7 HHNTYVTNLNK T5 41-50 494.77 2 494.77 14.5 AIEGSALAEK T6 51-67 927.98 2 927.97 44.4 SVDELVADLNAVPEDIR T7 68-71 446.27 1 446.27 1.9 TAVR T8 72-104 851.91 4 851.90 47.7 NDGGHANHSLFWTLLSPNGGGEPTGELAEEIK T9 105-114 582.27 7 582.27 31.0 STFGSFDQFK T10 115-116 276.16 1 N.D N.D EK T9-10 105-116 Miss-cleavage 474.23 3 474.23 27.6 STFGSFDQFKFK T11 117-124 367.70 2 367.70 10.7 FAAAAAGR T12 125-138 768.39 2 767.38 46.2 FGSGWAWLVVNDGK T13 139-155 908.45 2 908.45 24.2 LEITSTPNQDSPLSEGK T12-13 125-155 Miss-cleavage 1111.55 3 1111.54 50.6 FGSGWAWLVVNDGKLEITSTPNQDSPLSEGK T14 156-175 817.74 3 817.74 47.3 TPVLGLDVWEHAYYLNYQNR T15 176-194 779.72 3 779.71 5
.3 RPDVISAFWNVVNWDEVAR T16 195-200 355.69 2 355.69 6.4 LYSEAK
indicates data missing or illegible when filed
Table 2 discloses SEQ ID Nos 11-29, respectively, in order of appearance.
Example 4. Evaluation of Choroidal Neovascular Inhibitory Effect of Superoxide Dismutase (SOD) Derived from Bacillus amyloliquefaciens GF423
[0101] 4.1. Experimental Animals and Construction of Choroidal Neovascular (CNV) Models
[0102] Animal experiments were performed in accordance with the Animal Use and Care Protocol of the Institutional Animal Care and Use Committee (IACUC). C57BL/6 mice were purchased from Koatech Co., Ltd., and acclimated for 14 days. Then, the mice were raised for 17 days at an average temperature of 19° C. to 25° C., a humidity of 40% to 60% and an average illuminance of 150 to 300 lux with a 12-hr light/12-hr dark cycle. The mice were given feed and water ad libitum daily.
[0103] 7-week-old C57BL/6 mice were anesthetized with a mixture of ketamine hydrochloride (40 mg/kg) and xylazine hydrochloride (10 mg/kg), and then the Bruch's membrane of the mouse eye was irradiated with a diode green laser (532 nm, 150 mW, 0.1 sec, 50 μM), thereby inducing choroidal neovascularization.
[0104] 4.2. Administration of Test Substances
[0105] Experimental animals, grouped as described below, were irradiated with a laser. One day after laser photocoagulation, 100 μl of each of GF-101 (10 U) and GF-101 (20 U) dissolved in PBS, was administered thereto orally daily for 12 days. A positive control aflibercept (AF) (20 μg) was administered once by intravitreal injection on day 1 (
[0113] 4.3. Animal Tests
[0114] Fundus Fluorescein Angiography (FFA)
[0115] Fluorescein leakage from choroidal neovascularization was measured using fundus fluorescein angiography (FFA). Fundus fluorescent angiography was performed using a micron IV imaging system. 2% fluorescein was injected intraperitoneally into the mice of each test group under anesthesia, and after waiting for 3 to 5 minutes, the pupils were dilated, fundus fluorescein angiography (FFA) imaging was performed, the background was corrected, and the CTF values were calculated. As shown in
[0116] After administration of the pharmaceutical composition of the present invention, the area of CNV in the eye of the mice, measured by fundus fluorescence angiography, was decreased compared to the CNV area before the start of treatment. The decreased retinal thickness is a decreased central retinal subfield thickness (CST), a decreased center point thickness (CPT), or a decreased central foveal thickness (CFT).
[0117] The CTF value of the group administered intraocularly with the positive control aflibercept (AF) (test group III) was 673,595±486,147, compared to that of the PBS-administered group (test group II) (1,279,587±1,094,827), and the CNV area was decreased by 52.6% compared to that of the PBS-administered group. The GF-101 (10 U)-administered group (test group V) (1,124,635±1,249,267) and the GF-101 (20 U)-administered group (test group VI) (645,099±557,005) showed CTF values that were decreased by 12.1% and 49.6%, respectively. Furthermore, it was observed that the CNV lesions in the test group administered with GF-101 (20 U) were significantly decreased compared to the CNV lesions in the PBS-administered group which was the control group (see
[0118] Optical Coherence Tomography (OCT)
[0119] As shown in
[0120] The eye retinal thickness of the mice, measured by optical coherence tomography (OCT), was decreased compared to the ocular retinal thickness measured before administration of the compositions of the present invention. Specifically, the size of the CNV lesions was 4,548,182±1,983,055 μm.sup.3 in the PBS-administered group (test group II) and was 2,674,277±1,064,973 μm.sup.3 in test group III (aflibercept-administered group), which decreased by 41.2% compared to that in the PBS-administered group (test group II). The GF-101 (20 U)-administered group (test group VI) (3,471,454±1,534,395 μm.sup.3) showed CNV lesions that decreased by 23.6%, indicating that the CNV lesions were significantly decreased by the administration of GF-101 (20 U).
[0121] Electroretinography (ERG)
[0122] To evaluate a retinal function, mice were dark-adapted for 24 hours and subjected to electroretinography in the dark on 13 days after laser irradiation. Electroretinography measures the electrical activity produced by photoreceptor cells in the retina when the eye is stimulated by a specific light source. These measurements are recorded through electrodes disposed on the front surface of the eye (e.g., the cornea) and on the skin near the eye, thereby producing a graph called an electroretinogram (ERG).
[0123] For electroretinography, both eyes of CNV mice were dilated and anesthetized, and then electroretinography was performed by bringing electrodes into contact with the skin, tail, and cornea, respectively. The retina was stimulated by a single white light with a flash intensity of 0.8 cd sec/m.sup.2 to obtain a response value. The amplitude was measured from the valley of the a-wave to the apex of the b-wave, and the results of the measurement are shown in
[0124] Referring to
[0125] Statistical Analysis
[0126] The percentage of laser spots with CNV at different doses of a SOD or its 100 kD fragment derived from the B. amyloliquefaciens GF423 strain was compared pair-wise by a chi-square test. The results were plotted against the dose of the SOD derived from the B. amyloliquefaciens GF423 strain to derive the best-fit curve, which was used to calculate the dose of SOD that reduces the fraction of laser spots with CNV by 50% (ED.sub.50). A confidence level of p<0.05 was considered statistically significant.
[0127] 4.4. Histological Analysis
[0128] In order to observe the change in tissue by a laser, the mouse eyes were enucleated and fixed with 10% formalin for 10 minutes, and then they were placed in disposable base molds, embedded in an OCT compound, and frozen rapidly in liquid nitrogen.
[0129] Hematoxylin & Eosin (H & E) Staining
[0130] The tissue samples treated by the above-described method were sectioned, attached to slides, and then dried for about 1 hour, followed by the construction of CNV models. Then, in order to observe the changes in mouse retinas by drug treatment, the samples were stained with hematoxylin & eosin (H & E) and washed. The samples were treated with HCl solution and stained with eosin solution for 30 seconds to 1 minute, and then washed again. The samples were treated with 80%, 85%, 90%, and 100% ethanol for 3 minutes for each treatment, and then reacted with carboxylene and xylene for 5 minutes for each reaction. Next, the embedded tissues were imaged with a virtual microscope (NanoZoomer 2.0 RS), and the images are shown in
[0131]
[0132] TUNEL Assay
[0133] A TUNEL assay was performed to observe dead cells in the mouse retina after drug treatment in CNV models. Staining was performed using a fluorescence detection TUNEL assay kit. The tissue sections were de-paraffinized with xylene, and then hydrated twice with 100% ethanol, once with 95% ethanol, and once with 85% ethanol in order, followed by washing once with PBS. The tissue surface was wiped clean, and the slides were incubated directly with proteinase K (20 μg/mL) at room temperature for 15 minutes, and then washed twice with PBS. The tissue surface was wiped clean and the slides were incubated directly with 75 μL of equilibration buffer at room temperature for 10 seconds. The tissue surface was wiped clean and the slides were incubated directly with 55 μL of working strength TdT enzyme 37° C. for 1 hour. The slides were washed by shaking with a working strength stop/wash buffer for 15 seconds and then incubated for 10 minutes at room temperature, followed by washing three times with PBS. The tissue surface was wiped clean, incubated directly with 65 μL of an anti-digoxigenin conjugate, and allowed to be left at room temperature for 30 minutes under light-shielded conditions. The slides were washed four times with PBS, stained with DAPI, and then observed with a fluorescence microscope (LEICA DM 2500).
[0134]
[0135] 4.5. Results
[0136] Blood vessels were stained with fluorescein and subjected to fundus fluorescein angiography. As a result, the GF-101 (20 U)-administered group (test group VI) showed significantly low CTF values.
[0137] The results of OCT showed a tendency to the results of fundus fluorescein angiography.
[0138] Electroretinography also showed the same tendency. In order to analyze the responsiveness of the retina to light, the mouse eyes were stimulated with different intensity lights at 0.8 log cds/m.sup.2, and the degree of response to the light was analyzed. It could be seen that the amplitude in the CNV-induced group (test group II) decreased by about 150 μV compared to that in the normal group (test group I), indicating that the retinal function of test group II was declined. The b-wave amplitude of the group administered with GF-101 (20 U) increased in responsiveness to light.
[0139] For histological analysis, CNV lesions were analyzed by H & E staining, and photoreceptor cell death in the CNV site was analyzed using TUNEL staining. Increasing CNV size affected the surrounding tissues, and cells damaged in this process were observed in the outer nuclear layer (ONL). However, fewer dead cells were observed in the GF-101 (20 U)-administered group (test group VI).
[0140] In summary, it is demonstrated herein that GF-101 (20 U) improved retinal function by effectively suppressing the choroidal neovascularization induced by laser irradiation. In addition, GF-101 (20 U) inhibited cell death, as demonstrated by histopathology and TUNEL assays.
[0141] As described above, the compositions of the present disclosure, comprising SOD derived from B. amyloliquefaciens GF423 strain, have excellent antioxidant activity, highly stable enzyme activity, and excellent in vivo stability, and thus can be advantageously used as a material for a pharmaceutical drug, a food, a medical food, etc. for preventing or treating macular degeneration, particularly age-related macular degeneration.
Example 5. Evaluation of Anti-Inflammatory Effect of Superoxide Dismutase (SOD) Derived from Bacillus amyloliquefaciens GF423
[0142] Immuno-Fluorescence (IF) Staining for Inflammation Markers
[0143] Inflammation is an important mechanism that promotes CNV formation and immune responses that are associated with its pathogenesis. Therefore, after manufacturing a CNV model, IF staining was performed to detect the presence of inflammatory factors. Animal, CNV induction, dosing regimen, and tissue manipulating methods were performed as described in example 4, except the following doses of GF-103 were used: 20, 40, 60, and 80 SOD units/mouse. Sections were permeabilized with a 0.5% Triton X-100 solution and washed 3 times with PBS for 5 minutes. The Sections were blocked for 1 hour with a blocking solution containing 5% normal serum of the secondary antibody species (goat or donkey), 3% BSA, and 0.5% Triton X-100. Then, the sections were incubated with primary antibodies (see Table 3) in PBS including 3% BSA and 0.5% Triton X-100 at 4° C. overnight.
TABLE-US-00003 TABLE 3 Primary Secondary antibody Host Dilution Specimen antibody ICAM-1 Rabbit 1:500 Cryo- Alexa Fluor 555 Donkey section anti-Rabbit IgG CD45 Rat Alexa Fluor 647 goat F4/80 Rat anti-Rat IgG
[0144] While ICAM-1 and CD45 (general leukocyte markers), and F4/80 (a marker of murine macrophage) were observed at the outer nuclear layer and CNV lesion in the PBS group (
Example 6. Dose-Response Relationship of SOD Treatment to Choroidal Neovascularization (CNV) Lesion, Retinal VEGF, and Hif-1-Alpha in the Retina
[0145] 6.1. Experimental Animals and Construction of Choroidal Neovascular (CNV) Models
[0146] Animal experiments were performed in accordance with the Animal Use and Care Protocol of the Institutional Animal Care and Use Committee (IACUC). Brown Norway (BN) rats were purchased from Central Lab Animal Inc. (5F Gun B/D, Baumoe-ro 7-gil, Seocho-gu, Seoul, 137-900 Korea), and acclimated for 5 days. Then, the rats were raised for 14 days at an average temperature of 21.0 to 24.2° C., the humidity of 53.5 to 67.1%, and an average illuminance of 150 to 300 lux with a 12-hr light/12-hr dark cycle. The rats were given feed and water ad libitum daily.
[0147] 8-week-old BN rats were anesthetized by the intraperitoneal injection of Alfaxan (Jurox, Australia, 3 mL/kg) and Rompun (Bayer Korea, 0.5 mL/kg). Under anesthesia, pupils were dilated using mydriatics, and three or four photocoagulation spots were created around the optic nerve head via a diode laser (Oculight Glx, Iridex Inc, CA, USA). The equipment set-up condition was as follows.
[0148] wavelength: 532 nm
[0149] diameter: 100 μm
[0150] power: 220 mW
[0151] duration: 0.1 sec.
The destruction of Bruch's membrane was confirmed by characteristic bubble formation.
[0152] 6.2. Administration of Test Substances
[0153] Experimental animals were grouped as described in Table 4. One day after laser irradiation, GF-103 suspended in PBS was administered orally daily for 14 days. Aflibercept was administered once on day 5 by Intraocular (vitreous body) injection. To a negative control group, PBS was administered as a placebo in the same way as the GF-101 treatment group (
TABLE-US-00004 TABLE 4 The number Experimental group Dose Route of animals G1 CNV (negative — PO 7 control group) G2 Aflibercept (positive 20 μg/eye IVT 7 control group) G3 GF-103 test group 50 SOD Units/kg PO 7 G4 GF-103 test group 100 SOD Units/kg PO 7 G5 GF-103 test group 250 SOD Units/kg PO 7 G6 GF-103 test group 500 SOD Units/kg PO 7 G7 GF-103 test group 1,000 SOD Units/kg PO 7
[0154] 6.3. Animal Test
[0155] CNV Formation Evaluation
[0156] After fluorescein retinal angiography, an autopsy was carried out on animals to evaluate the CNV formation. At autopsy, the eye was extracted, and the eyeball was incised at the area adjacent to the cornea and sclera under the microscope. The retina was detached from the back portion of the eyeball, and then conjunctival tissue including the subretina was separated.
[0157] Immunofluorescence staining was performed for the extracted tissue using isolectin B4 (Sigma-Aldrich, USA), which is an endothelial cell marker. Stained tissue was examined under the fluorescent microscope (BX51, Olympus, Japan), and the size of CNV was analyzed via Image J software (NIH, USA).
[0158] GF-103 administration resulted in a statistically significant decrease in CNV lesions (
[0159] ELISA Analysis (Hif-1-Alpha and VEGF)
[0160] The retina was extracted from the other side of the eyeball not used for CNV formation, and the presence of VEGF (vascular endothelial growth factor) and HIF-1-alpha (Hypoxia-inducible factors-1-alpha) was examined by ELISA. After eyeball extraction at autopsy, under a dissecting microscope, the retina was carefully separated from the eyeball, and then washed with PBS and stored at −70° C. until analysis. To extract proteins for the ELISA analysis, the retina was weighed. After adding 5 times the weight of lysis buffer (MyBiosource, San Diego, Calif., USA), it was homogenized by a bead homogenizer (BioPrep-24, Allsheng, Hangzhou City, cycles of 6 m/sec, 20 sec each). The homogenized tissue was spun down at 1000×g for 5 minutes at 4° C., and the supernatant was used for the protein analysis. The total protein amount for the sample was quantified by the Bradford (Bio-rad, USA) method. ELISA kit information is as follows.
[0161] VEGF: Rat VEGF ELISA kit, Abcam, Lot No.: GR3355645-1.
[0162] HIF-1: Rat hypoxia-inducible factor 1alpha ELISA kit, MyBioSource, Lot No.: W24141530.
[0163] GF-103 administration at a dose of 500 and 1000 unit/kg significantly reduced the level of Hif-1-alpha in retina tissue, compared to the PBS group (
[0164] GF-103 administration at a dose of 100 unit/kg or higher significantly reduced the level of VEGF in retina tissue, compared to the PBS group (
Example 7. Effect of the Combination of GF-103 and Aflibercept on Inhibition of Choroidal Neovascularization
[0165] 7.1. Experimental Animals and Construction of Choroidal Neovascular (CNV) Models
[0166] Animal experiments were performed as described in Example 6.
[0167] 7.2. Administration of Test Substances
[0168] Experimental animals were grouped as described below (Table 5). Aflibercept was administered once on day 5 by intraocular (vitreous body) injection (G2). For the combination group (G3), GF-103 suspended in PBS was administered orally daily from day −6 to day 12 for 19 days; and Aflibercept was administrated the same way as the G2 group. To a CNV-induced group (G1), PBS was administered as a placebo in the same way as GF-103.
TABLE-US-00005 TABLE 5 Experimental The number group Dose Route of animals G1 CNV (negative — PO 7 control group) G2 Aflibercept 20 μg/eye IVT 7 G3 GF-103 + 50 SOD Units/kg PO, IVT 7 Aflibercept
[0169] 7.3. Animal Test
[0170] Fluorescein Retinal Angiography
[0171] On the day of autopsy, the animals were intraperitoneally injected with Alfaxan (Jurox, Australia, 3 mL/kg) and Rompun (Bayer Korea, 0.5 mL/kg) to induce anesthesia, and then the pupils were dilated with 1% tropicamide eye drop. During anesthesia and pupil dilation, the amount of anesthetic and mydriasis was increased or decreased depending on the depth of anesthesia and pupil dilation. Under anesthesia, approximately 1 mL blood was collected from the caudal vena cava or jugular vein. Sodium fluorescein (Sigma, MO, USA) was dissolved in vehicle substance (PBS) at a concentration of 10%, and then 1 ml/kg was injected to the abdominal vena cava. After about 5 minutes, an image of the fundus oculi was taken with a fundus microscope (Fluorescence endoscope, Karl Storz, Tuttlingen, Germany). Fluorescein leakage intensity was analyzed using Image J software (NIH, USA).
[0172] As a result of fluorescein retinal angiography, the fluorescein leakage intensity of the aflibercept and combination group was significantly reduced. The leakage in the combination group was reduced more than the leakage in the aflibercept group, indicating that the combination therapy is more effective than monotherapy of aflibercept (
[0173] The description provided herein is illustrative of preferred embodiments and is not intended to limit the scope of the present invention. It will be obvious to those skilled in the art that various modifications and changes are possible without departing from the spirit and scope of the present invention.
Accession Numbers
[0174] Depository authority: the Korea Research Institute of Bioscience and Biotechnology
[0175] KCTC13222BP
[0176] Deposit date: Mar. 6, 2017