Enhanced delivery of drugs to the brain
11028155 · 2021-06-08
Assignee
Inventors
Cpc classification
A61P37/06
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
International classification
A61K47/68
HUMAN NECESSITIES
Abstract
Compositions and methods related to antibodies or antibody fragments which are capable of crossing the blood brain barrier are provided.
Claims
1. An antibody comprising a heavy chain and a light chain, wherein the heavy chain comprises a heavy chain acceptor framework of SEQ ID NO: 1; and wherein the light chain comprises a light chain acceptor framework of SEQ ID NO: 2, wherein the light chain CDR1, CDR2 and CDR3 at amino acids 28-34, 50-56, and 91-97 of SEQ ID NO:2, respectively, are replaced with the CDR1, CDR2 and CDR3 at amino acids 148-152, 170-172 and 208-216 of SEQ ID NO:4, respectively; and wherein the heavy chain CDR1, CDR2 and CDR3 at amino acids 31-35, 50-59, and 101-109 of SEQ ID NO:1, respectively, are replaced with the CDR1, CDR2 and CDR3 at amino acids 26-33, 51-58, and 97-110 of SEQ ID NO:4, respectively.
2. The antibody of claim 1, wherein the antibody is capable of crossing the blood brain barrier.
3. A composition comprising the antibody of claim 1 and a pharmaceutically acceptable carrier.
4. The composition of claim 3, wherein the composition is formulated for delivery to the brain.
5. The composition of claim 3, wherein the composition is capable of crossing the blood brain barrier.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
DETAILED DESCRIPTION
(6) Monoclonal antibodies (mAbs) are antibodies of a single antigen specificity produced by identical immune cells, i.e., clones of a common germ cell. They offer unprecedented opportunities for drug development because of their ability to target almost any cell surface or secreted molecule with remarkable specificity, efficacy, and safety.
(7) As is well known, complementarity determining region (CDR) segments are responsible for the ability of antibodies to bind to their target antigens. Differences between the variable domains are located on three loops known as hypervariable regions (HV-1, HV-2 and HV-3) or (CDR1, CDR2 and CDR3). CDRs are supported within the variable domains by conserved framework regions. The present disclosure relates to the use of the framework of a human natural monoclonal antibody (PRITUMUMAB) to graft hypervariable regions from other antibodies, such as, murine, chimerized, humanized, or human monoclonal antibodies (mAbs) to generate new antigen binding proteins that are able to cross the blood brain barrier.
(8) The CDRs will be exchanged (as a group or individually) between Abs of differing specificity and affinity. Swapping CDRs (also called CDR grafting) is a technique that has been utilized for the humanization of murine antibodies, and also for the construction of more stable conventional antibody fragments. As discussed herein, the framework of pritumumab is of human origin and provides a unique characteristic of being able to cross the BBB, and since the CDRs are both highly variable and selected for binding affinity rather than stability it is proposed that variation in CDRs on the framework of human IgG1 (pritumumab) is an innovative approach to enhance clinical utility of monoclonal antibodies that are highly target specific to treat various human disorders but are not used due to their inability to cross the BBB. As disclosed herein, we will construct a series of CDR-swap mutants with the goal of understanding the contribution of the pritumumab framework to deliver target specific monoclonal antibodies containing CDRs of medical and therapeutic importance across the BBB.
(9) Specifically, the present inventors have shown that pritumumab is a human antibody that readily crosses the BBB. By placing different specificities and/or payloads on the antibody then these specificities and/or payloads should be readily delivered to the brain. The pritumumab heavy chain serves as a carrier to cross the BBB and delivers the new specificity and/or payload. Thus, the present disclosure exploits a natural human antibody that readily crosses the BBB and uses this unique feature to deliver additional drugs.
Definitions
(10) It is to be understood that this invention is not limited to particular methods, reagents, compounds, compositions or biological systems, which can, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular aspects only, and is not intended to be limiting. As used in this specification and the appended claims, the singular forms “a”, “an” and “the” include plural references unless the content clearly dictates otherwise.
(11) The term “about” as used herein when referring to a measurable value such as an amount, a temporal duration, and the like, is meant to encompass variations of ±20% or ±10%, more preferably ±5%, even more preferably ±1%, and still more preferably ±0.1% from the specified value, as such variations are appropriate to perform the disclosed methods.
(12) Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the invention pertains. Although any methods and materials similar or equivalent to those described herein can be used in the practice for testing of the present invention, the preferred materials and methods are described herein.
(13) “Vertebrate,” “mammal,” “subject,” “mammalian subject,” or “patient” are used interchangeably and refer to mammals such as human patients and non-human primates, as well as experimental animals such as rabbits, rats, and mice, cows, horses, goats, and other animals. Animals include all vertebrates, e.g., mammals and non-mammals, such as mice, sheep, dogs, cows, avian species, ducks, geese, pigs, chickens, amphibians, and reptiles.
(14) “Treating” or “treatment” refers generally to either (i) the prevention of disease, e.g., prophylaxis, or (ii) the reduction or elimination of symptoms of a disease of interest, e.g., therapy. Thus, treatment can be prophylactic (to prevent or delay the onset of the disease, or to prevent the manifestation of clinical or subclinical symptoms thereof) or therapeutic suppression or alleviation of symptoms after the manifestation of the disease.
(15) “Preventing” or “prevention” refers to prophylactic administration with compositions of the invention.
(16) “Therapeutically-effective amount” or “an effective amount” refers to an amount of an antibody composition that is sufficient to prevent a disease or to alleviate (e.g., mitigate, decrease, reduce) at least one of the symptoms associated with a disease. It is not necessary that the administration of the composition totally eliminate the symptoms of the disease, as long as the benefits of administration of the composition outweigh the detriments. Likewise, the terms “treat” and “treating” in reference to a disease, as used herein, are not intended to mean that the subject is necessarily cured of the disease or that all clinical signs thereof are eliminated, only that some alleviation or improvement in the condition of the subject is effected by administration of the composition.
(17) Antibodies and Fragments
(18) As used herein, the term “antibody” refers to any immunoglobulin or intact molecule as well as to fragments thereof that bind to a specific epitope. Such antibodies include, but are not limited to polyclonal, monoclonal, chimeric, humanized, single chain, Fab, Fab′, F(ab)′ fragments and/or F(v) portions of the whole antibody and variants thereof. All isotypes are encompassed by this term, including IgA, IgD, IgE, IgG, and IgM.
(19) As used herein, the term “antibody fragment” refers specifically to an incomplete or isolated portion of the full sequence of the antibody which retains the antigen binding function of the parent antibody. Examples of antibody fragments include Fab, Fab′, F(ab′)2, and Fv fragments; diabodies; linear antibodies; single-chain antibody molecules; and multispecific antibodies formed from antibody fragments.
(20) An intact “antibody” comprises at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds. Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as HCVR or V.sub.H) and a heavy chain constant region. The heavy chain constant region is comprised of three domains, CH.sub.1, CH.sub.2 and CH.sub.3. Each light chain is comprised of a light chain variable region (abbreviated herein as LCVR or V.sub.L) and a light chain constant region. The light chain constant region is comprised of one domain, C.sub.L. The V.sub.H and V.sub.L regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR). Each V.sub.H and V.sub.L is composed of three CDRs and four FRs, arranged from amino-terminus to carboxyl-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The variable regions of the heavy and light chains contain a binding domain that interacts with an antigen. The constant regions of the antibodies can mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (C1q) of the classical complement system. The term antibody includes antigen-binding portions of an intact antibody that retain capacity to bind. Examples of binding include (i) a Fab fragment, a monovalent fragment consisting of the V.sub.L, V.sub.H, C.sub.L and CH1 domains; (ii) a F(ab′)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CH1 domains; (iv) a Fv fragment consisting of the V.sub.L and V.sub.H domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., Nature, 341:544-546 (1989)), which consists of a VH domain; and (vi) an isolated complementarity determining region (CDR).
(21) The term “antigen binding protein” refers to a molecule that contains all or a part of the antigen binding site of an antibody, e.g. all or part of the heavy and/or light chain variable domain, such that the antigen binding protein specifically recognizes a target antigen. Non-limiting examples of antigen binding proteins include full-length immunoglobulin molecules and scFvs, as well as antibody fragments, including but not limited to (i) a Fab fragment, a monovalent fragment consisting of the V.sub.L, V.sub.H, C.sub.L and C.sub.H1 domains; (ii) a F(ab′).sub.2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fab′ fragment, which is essentially a Fab with part of the hinge region (see, Fundamental Immunology (Paul ed., 3.sup.rd ed. 1993); (iv) a Fd fragment consisting of the V.sub.H and C.sub.H1 domains; (v) a Fv fragment consisting of the V.sub.L and V.sub.H domains of a single arm of an antibody, (vi) a single domain antibody such as a Dab fragment (Ward et al., (1989) Nature 341:544-546), which consists of a V.sub.H or V.sub.L domain, a Camelid (see Hamers-Casterman, et al., Nature 363:446-448 (1993), and Dumoulin, et al., Protein Science 11:500-515 (2002)) or a Shark antibody (e.g., shark Ig-NARs Nanobodies™; and (vii) a nanobody, a heavy chain variable region containing a single variable domain and two constant domains.
(22) The term “CDR” refers to one of the six hypervariable regions within the variable domains of an antibody that mainly contribute to antigen binding. One of the most commonly used definitions for the six CDRs was provided by Kabat E. A. et al., (1991) Sequences of proteins of immunological interest. NIH Publication 91-3242).
(23) The term “antibody framework” as used herein refers to the part of the variable domain, either VL or VH, which serves as a scaffold for the antigen binding loops (CDRs) of this variable domain. In essence it is the variable domain without the CDRs.
(24) As used herein, the term “single chain antibodies” or “single chain Fv (scFv)” refers to an antibody fusion molecule of the two domains of the Fv fragment, V.sub.L and V.sub.H. Although the two domains of the Fv fragment, V.sub.L and V.sub.H, are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the V.sub.L and V.sub.H regions pair to form monovalent molecules (known as single chain Fv (scFv); see, e.g., Bird et al., Science, 242:423-426 (1988); and Huston et al., Proc Natl Acad Sci USA, 85:5879-5883 (1988)). Such single chain antibodies are included by reference to the term “antibody” fragments and can be prepared by recombinant techniques or enzymatic or chemical cleavage of intact antibodies.
(25) As used herein, the term “human sequence antibody” includes antibodies having variable and constant regions (if present) derived from human germline immunoglobulin sequences. The human sequence antibodies of the invention can include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo). Such antibodies can be generated in non-human transgenic animals, e.g., as described in PCT App. Pub. Nos. WO 01/14424 and WO 00/37504. However, the term “human sequence antibody”, as used herein, is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences (e.g., humanized antibodies).
(26) Also, recombinant immunoglobulins can be produced. See, Cabilly, U.S. Pat. No. 4,816,567, incorporated herein by reference in its entirety and for all purposes; and Queen et al., Proc Natl Acad Sci USA, 86:10029-10033 (1989).
(27) As used herein, the term “monoclonal antibody” refers to a preparation of antibody molecules of single molecular composition. A monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope. Accordingly, the term “human monoclonal antibody” refers to antibodies displaying a single binding specificity which have variable and constant regions (if present) derived from human germline immunoglobulin sequences. In one aspect, the human monoclonal antibodies are produced by a hybridoma which includes a B cell obtained from a transgenic non-human animal, e.g., a transgenic mouse, having a genome comprising a human heavy chain transgene and a light chain transgene fused to an immortalized cell.
(28) As used herein, the term “antigen” refers to a substance that prompts the generation of antibodies and can cause an immune response. It can be used interchangeably in the present disclosure with the term “immunogen”. In the strict sense, immunogens are those substances that elicit a response from the immune system, whereas antigens are defined as substances that bind to specific antibodies. An antigen or fragment thereof can be a molecule (i.e., an epitope) that makes contact with a particular antibody. When a protein or a fragment of a protein is used to immunize a host animal, numerous regions of the protein can induce the production of antibodies (i.e., elicit the immune response), which bind specifically to the antigen (given regions or three-dimensional structures on the protein).
(29) As used herein, the term “humanized antibody,” refers to at least one antibody molecule in which the amino acid sequence in the non-antigen binding regions and/or the antigen-binding regions has been altered so that the antibody more closely resembles a human antibody, and still retains its original binding ability.
(30) In addition, techniques developed for the production of “chimeric antibodies” (Morrison, et al., Proc Natl Acad Sci, 81:6851-6855 (1984), incorporated herein by reference in their entirety) by splicing the genes from a mouse antibody molecule of appropriate antigen specificity together with genes from a human antibody molecule of appropriate biological activity can be used. For example, the genes from a mouse antibody molecule can be spliced together with genes from a human antibody molecule of appropriate biological activity. A chimeric antibody is a molecule in which different portions are derived from different animal species, such as those having a variable region derived from a murine mAb and a human immunoglobulin constant region.
(31) In addition, techniques have been developed for the production of humanized antibodies (see, e.g., U.S. Pat. Nos. 5,585,089 and 5,225,539, which are incorporated herein by reference in their entirety). An immunoglobulin light or heavy chain variable region consists of a “framework” region interrupted by three hypervariable regions, referred to as complementarity determining regions (CDRs). Briefly, humanized antibodies are antibody molecules from non-human species having one or more CDRs from the non-human species and a framework region from a human immunoglobulin molecule.
(32) Alternatively, techniques described for the production of single chain antibodies can be adapted to produce single chain antibodies against an immunogenic conjugate of the present disclosure. Single chain antibodies are formed by linking the heavy and light chain fragments of the Fv region via an amino acid bridge, resulting in a single chain polypeptide. Fab and F(ab′)2 portions of antibody molecules can be prepared by the proteolytic reaction of papain and pepsin, respectively, on substantially intact antibody molecules by methods that are well-known. See e.g., U.S. Pat. No. 4,342,566. Fab′ antibody molecule portions are also well-known and are produced from F(ab′)2 portions followed by reduction of the disulfide bonds linking the two heavy chain portions as with mercaptoethanol, and followed by alkylation of the resulting protein mercaptan with a reagent such as iodoacetamide.
(33) The amino acid positions can be indicated according to the AHo numbering scheme. The AHo numbering system is described further in Honegger, A. and Pluckthun, A. (2001) J. Mol. Biol. 309:657-670). Alternatively, the Kabat numbering system as described further in Kabat et al. (Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242) may be used. Conversion tables for the two different numbering systems used to identify amino acid residue positions in antibody heavy and light chain variable regions are provided in A. Honegger, J. Mol. Biol. 309 (2001) 657-670.
(34) In one aspect, the present disclosure provides a human acceptor framework sequence for the grafting of CDRs from a heterologous source. The human pritumumab framework was found to be an especially useful framework.
(35) Accordingly, the present invention provides an antigen binding protein acceptor framework comprising i) a variable heavy chain framework having at least 70% identity, preferably at least 75%, 80%, 85%, 90%, more preferably at least 95% identity, to SEQ ID No. 1; and/or (ii) a variable light chain framework having at least 70% identity, preferably at least 75%, 80%, 85%, 90%, more preferably at least 95% identity, to SEQ ID No. 2. These sequences are shown below:
(36) TABLE-US-00001 SEQ ID NO. 1: EVQLLESGGDLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSA ITPSGGSTNYADSVKGRFTISRDNSQNTLYLQMNSLRVEDTAVYICGRVP YRSTWYPLYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVK DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT YICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKP KDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQ VYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO: 2: DIQMTQSPSSLSASVGDRVTITCRASQDISNYLAWFQQKPGKAPKSLIYA ASSLHSKVPTQFSGSGSGTDFTLTISSLQPEDFATYYCLQYSTYPITFGG GTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG LSSPVTKSFNRGEC
(37) A general method for grafting CDRs into human acceptor frameworks has been disclosed by Winter in U.S. Pat. No. 5,225,539 and by Queen et al. in WO9007861A1, which are hereby incorporated by reference in their entirety.
(38) In exemplary embodiments of the methods of the invention, the amino acid sequence of the CDR donor antibody is first identified and the sequences aligned using conventional sequence alignment tools (e.g., Needleman-Wunsch algorithm and Blossum matrices). The introduction of gaps and nomenclature of residue positions may be done using a conventional antibody numbering system. For example, the AHo numbering system for immunoglobulin variable domains may be used. The Kabat numbering scheme may also be applied since it is the most widely adopted standard for numbering the residues in an antibody. Kabat numbering may, e.g., be assigned using the SUBIM program. This program analyses variable regions of an antibody sequence and numbers the sequence according to the system established by Kabat and co-workers (Deret et al. 1995). The definition of framework and CDR regions is generally done following the Kabat definition which is based on sequence variability and is the most commonly used. Conversion tables for the two different numbering systems used to identify amino acid residue positions in antibody heavy and light chain variable regions are provided in A. Honegger, J. Mol. Biol. 309 (2001) 657-670. The Kabat numbering system is described further in Kabat et al. (Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242). The AHo numbering system is described further in Honegger, A. and Pluckthun, A. (2001) J. Mol. Biol. 309:657-670).
(39) For example, the acceptor frameworks disclosed herein can be used to generate a human or humanized antibody which retains the binding properties of the antibody from which the CDRs are derived. Accordingly, in a preferred embodiment the invention encompasses an antigen binding protein acceptor framework as disclosed herein, further comprising heavy chain CDR1, CDR2, and CDR3 and/or light chain CDR1, CDR2, and CDR3 from a donor antigen binding protein. Thus, in one embodiment, the invention provides an antigen binding protein specific to a desired antigen comprising (i) variable heavy and light chain CDRs; (ii) a human variable heavy chain framework having at least 70%, preferably at least 75%, 80%, 85%, 90%, 95%, or 100% identity to SEQ ID NO. 1; (iii) a human variable light chain framework having at least 70%, preferably at least 75%, 80%, 85%, 90%, 95%, or 100% identity to SEQ ID NO. 2.
(40) Examples of antibodies with CDRs useful in the practice of the present disclosure include:
(41) TABLE-US-00002 TABLE 1 mAb Manufacturer Target/Antigen First Indication Rituximab Roche/ CD20 B-cell lymphoma Ibritumomab BiogenIDEC Tositumomab Celldex GSK Ofatumumab GSK/Genmab CD3 CLL Catumaxomab Trion CD3 and Ovarian cancer EPCAM ascites Gemtuzumab Pfizer CD33 Acute myeloid Leukemi Alemtuzumab Genzyme CD52 B-cell leukemia Eculizumab Alexion Complement Paroxysmal hemoglobinuria Ca5 nocturnal Cetuximab Eli Lilly EGFR Colorectal cancer Panitumumab Amgen Trastuzumab Roche HER2 Breast cancer Certoluzimab UCB VEGF Crohn's disease Bevacizumab Roche Colorectal cancer Ranibizumab Roche Macular degeneration Ipilimumab CD152 CTLA-4 Melanoma
(42) Shown below is an alignment of the variable domains from a number of monoclonal antibodies approved for cancer treatment, as taken from Magdelaine-Beuzelin C, Kaas Q, Wehbi V, Ohresser M, Jefferis R, Lefranc M-P, Watier H. Structure-function relationships of the variable domains of monoclonal antibodies approved for cancer treatment. Critical Reviews in Oncology/Hematology. 64:210-225, 2007. Cetuximab (SEQ ID NO:3) VH domain at amino acids 1-119 and V-kappa domain at amino acids 120 to 226, Rituximab (SEQ ID NO:4) VH domain at amino acids 1 to 121 and V-kappa domain at amino acids 122-226, Alemtuzmab (SEQ ID NO:5) VH domain at amino acids 1 to 121 and V-kappa domain at amino acids 122-228, Bevacizumab (SEQ ID NO:6) VH domain at amino acids 1 to 123 and V-kappa domain at amino acids 124-230, Trastuzumab (SEQ ID NO:7) VH domain at amino acids 1 to 119 and V-kappa domain at amino acids 120-225, Pertuzumab (SEQ ID NO:8) VH domain at amino acids 1 to 119 and V-kappa domain at amino acids 120-226, Panitumumab (SEQ ID NO:9) VH domain at amino acids 1 to 96 and V-kappa domain at amino acids 97-184.
(43) TABLE-US-00003 VH domain FR1-IMGT FR2-IMGT
certuximab SEQ QVQLKQSGP.GLVQPSQSLSITCT
VHWVRQSPGKGLEWL
ID NO: 3 (1-119) VS GV rituximab.sup.l SEQ QVQLQQPGA.ELVKPGASVKMS
MHWVKQTPGRGLEWI
ID NO: 4 (1-121) KAS GA alemtuzumab.sup.2 QVQLQESGP.GLVRPSQTLSLT
T
MNWVRQPPGRGLEWI
SEQ ID NO: 5 VS GF
(1-121) bevacizumab EVQLVESGG.GLVQPGGSLRLS
A
MNWVRQAPGKGLEW
SEQ ID NO: 6 AS VG
(1-123) trastuzumab.sup.3 EVQLVESGG.GLVQPGGSLRLS
A
IHWVRQAPGKGLEWV
SEQ ID NO: 7 AS A
(1-119) pertuzumab SEQ EVQLVESGG.GLVQPGGSLRLS
A
MDWVRQAPGKGLEW
ID NO: 8 (1-119) AS VAD panitumumab ..........VS
WTWIRQSPGKGLEWI
SEQ ID NO: 9 GH (1-96) VH domain FR3-IMGT
FR4IMGT certuximab SEQ DYNTPFT.SRLSINKDNSKSQVFFKMNSLQSNDTAIYY
WGQGTLVTVSA ID NO: 3 (1-119)
rituximab.sup.l SEQ SYNQKFX.GKATLTADKSSSTAYMQLSSLTSEDSAV
WGAGTTVTVSA ID NO: 4 (1-121) YY
alemtuzumab.sup.2 EYNPSVK.GRVTMLVDTSKNQFSLRLSSVTAADTAV
WGQGSLVTVSS SEQ ID NO: 5 YY
(1-121) bevacizumab TYAADFK.RRFTFSLDTSKSTAYLQMNSLRAEDTAV
WGQGTLVTVSS SEQ ID NO: 6 YY
(1-123) trastuzumab.sup.3 RYADSVK.GRFTISADTSKNTAYLQMNSLRAEDTAV
WCQGTLVTVSS SEQ ID NO: 7 YY
(1-119) pertuzumab SEQ IYNQRFK.GRFTLSVDRSKNTLYLQMNSLRAEDTAV
WGQGTLVTVSS ID NO: 8 (1-119) YY
panitumumab NYNPSLK.SRLTISIDTSKTQFSLKLSSVTAADTAIYY
WGQGTMVTVSS SEQ ID NO: 9
(1-96) V-kappa domain FR1-IMGT
FR2-IMGT
certuximab SEQ DILLTQSPVILSVSPGERVSFS
RA
IHWYQQRTNGSPRLLI
ID NO: 3 (120-226) S K rituximab SEQ ID QIVLSQSPAILSASPGEKVTMT
R
IHWFQQKPGSSPKPWI
NO: 4 (122-226) AS Y alemtuzumab DIQMTQSPSSLSASVGDRVTIT
K
LNWYQQKPGKAPKLLI
SEQ ID NO: 5 AS Y (122-228) bevacizumab DIQMTQSPSSLSASVGDRVTIT
S
LNWYQQKPGKAPKVLI
SEQ ID NO: 6 AS Y (124-230) trastuzumab DIQMTQSPSSLSASVGDRVTIT
R
VAWYQQKPGKAPKLLI
SEQ ID NO: 7 AS Y (120-225) pertuzumab SEQ DIQMTQSPSSLSASVGDRVTIT
K
VAWYQQKPGKAPKLLI
ID NO: 8 (120-226) AS Y panitumumab ........TIT
QAS
LNWYQQKPGKAPKLLI
SEQ ID NO: 9 Y (97-184) V-kappa domain FR3-IMGT
FR4IMGT certuximab SEQ ESISGIP.SRFSGSG..SGTDFTLSINSVESEDIADYY
FGAGTKLELK. ID NO: 3 (120-226) rituximab SEQ ID NLASGVP.VRFSGSG..SGTSYSLTISRVEAEDAATY
FGGGTKLEIK NO: 4 (122-226) Y
alemtuzumab NLQTGVP.SRFSGSG..SGTDFTFTISSLQPEDIATYY
FGQGTKVIEK. SEQ ID NO: 5
(122-228) bevacizumab SLHSGVP.SRFSGSG..SGTDFTLTISSLQPEDFATYY
FGQGTKVEIK. SEQ ID NO: 6
(124-230) trastuzumab FLYSGVP.SRFSGSR..SGTDFTLTISSLQPEDFATYY
FGQGTKVEIK. SEQ ID NO: 7
(120-225) pertuzumab SEQ YRYTGVP.SRFSGSG..SGTDFTLTISSLQPEDFATY
FGQGTKVEIK. ID NO: 8 (120-226) Y
panitumumab NLETGVP.SRFSGSG..SGTDFTFTISSLQPEDIATYF
FGGGTKVEIK. SEQ ID NO: 9
(97-184) .sup.1In WO9411026 PATENT, P15 > A15. .sup.2In U.S. Pat. No. 5,846,534, F28 > S28 and T35 > 835. .sup.3In U.S. Pat. No. 5,821,337, Y117 > V117. .sup.4In U.S. Pat. No. 5,821,337, Y68 > E68.
(44) The CDRs of ipilimumab are given in the US patent 2009/0074787 A1.
(45) Shown below is an alignment of the VH and V-kappa domains of bevacizumab (SEQ ID NO:10) VH domain at amino acids 1 to 123 and V-kappa domain at amino acids 124-230 and ranibizumab (SEQ ID NO:11) VH domain at amino acids 1 to 122 and V-kappa domain at amino acids 123-229.
(46) TABLE-US-00004 VH domain FR1-IMGT CDR1-IMGT FR2-IMGT CDR2-IMGT bevacizumab EVQLVESGG.GLVQPGGSLRLSCA GYTF...TNYG MNWVRQAPGKGLEW INTY...TGEP SEQ ID NO: 10 AS VGW (1-123) ranibizumab EVQLVESGG.GLVQPGGSLRLSCA GYDR...THYC MNWVRQAPGKGLEW INTY...TGEP SEQ ID NO: 11 AS VGW (1-122) VH domain FR3-IMGT CDR3-IMGT FR4IMGT bevacizumab TYAADFK.RRFTFSLDTSKSTAYLQMNSLRAEDTAVY AKYPHYYGSSHWYFD WGQGTLVTVSS SEQ ID NO: 10 YC V (1-123) ranibizumab TYAADFK.RRFTFSLDTSKSTAYLQMNSLRAEDTAVY AKYPYYYGTSHVVYFD WGQGTLVTVSS SEQ ID NO: 11 YC V (1-122) V-KAPPA domain FR1-IMGT CDR1-IMGT FR2-IMGT CDR2-IMGT bevacizumab DIQMTQSPSSLSASVGDRVTITCS QDI...SNY LNWYQQKPGKAPKVL IFT...S SEQ ID NO: 10 AS Y (124-230) ranibizumab DIQLTQSPSSLSASVGDRVTITCSA QDI...SNY LNWYQQKPGKAPKVL IFT...S SEQ ID NO: 11 S (123-229) V-KAPPA domain FR3-IMGT CDR3-IMGT FR4IMGT bevacizumab SLHSGVP.SRFSGSG..SGTDFILTISSLQPEDFATYYC QQYST...VPWT FGQGTKVEIK. SEQ ID NO: 10 (124-230) ranibizumab SLHSGVP.SRFSGSG..SGTDFILTISSLQPEDFATYYC QQYST...VPWT FGQGTKVEIK. SEQ ID NO: 11 (123-229)
(47) In another aspect, the present invention features the antibodies, or fragments thereof, disclosed herein conjugated to a therapeutic moiety, such as a cytotoxin, a drug (e.g., an immunosuppressant) or a radiotoxin. Such conjugates are referred to herein as “immunoconjugates”.
(48) The antibody conjugates of the invention can be used to modify a given biological response, and the drug moiety is not to be construed as limited to classical chemical therapeutic agents. For example, the drug moiety may be a protein or polypeptide possessing a desired biological activity. Such proteins may include, for example, an enzymatically active toxin, or active fragment thereof, such as abrin, ricin A, pseudomonas exotoxin, or diphtheria toxin; a protein such as tumor necrosis factor or interferon-γ; or, biological response modifiers such as, for example, lymphokines, interleukin-1 (“IL-1”), interleukin-2 (“IL-2”), interleukin-6 (“IL-6”), granulocyte macrophage colony stimulating factor (“GM-CSF”), granulocyte colony stimulating factor (“G-CSF”), or other growth factors.
(49) Since pritumumab can cross the blood brain barrier it can be used as a delivery vehicle for delivering other agents, e.g., imaging or therapeutic agents to the brain or other tumor tissues. Thus, provided are composition comprising an antibody comprising a heavy chain and a light chain, the heavy chain comprising a sequence that is at least 90% identical to SEQ ID NO:1 and the light chain comprising a sequence that is at least 90% identical to SEQ ID NO:2 and one or more agents, e.g., imaging or therapeutic agents. Optionally, the agents are conjugated to the antibody. Optionally, the therapeutic agent is a chemotherapeutic agent. Optionally, the conjugate comprises a recombinant antigen binding protein as described herein conjugated to one or more agents. Optionally, the composition is formulated for delivery to the brain. Optionally, the composition is capable of crossing the blood brain barrier. Optionally, the heavy chain of the antibody comprises SEQ ID NO:1 and the light chain comprises SEQ ID NO:2. Optionally, the antibody is pritumumab.
(50) Techniques for conjugating such therapeutic moieties to antibodies are well known, see, e.g., Amon et al., “Monoclonal Antibodies For Immunotargeting Of Drugs In Cancer Therapy”, in Monoclonal Antibodies And Cancer Therapy, Reisfeld et al. (eds.), pp. 243-56 (Alan R. Liss, Inc. 1985); Hellstrom et al., “Antibodies For Drug Delivery”, in Controlled Drug Delivery (2nd Ed.), Robinson et al. (eds.), pp. 623-53 (Marcel Dekker, Inc. 1987); Thorpe, “Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review”, in Monoclonal Antibodies '84: Biological And Clinical Applications, Pinchera et al. (eds.), pp. 475-506 (1985); “Analysis, Results, And Future Prospective Of The Therapeutic Use Of Radiolabeled Antibody In Cancer Therapy”, in Monoclonal Antibodies For Cancer Detection And Therapy, Baldwin et al. (eds.), pp. 303-16 (Academic Press 1985), and Thorpe et al., “The Preparation And Cytotoxic Properties Of Antibody-Toxin Conjugates”, Immunol. Rev., 62:119-58 (1982).
(51) Also provided are methods of delivering an agent to the brain of a subject. The method includes administering to the subject a composition comprising an antibody comprising a heavy chain and a light chain, the heavy chain comprising a sequence that is at least 90% identical to SEQ ID NO:1 and the light chain comprising a sequence that is at least 90% identical to SEQ ID NO:2 and one or more agents, e.g., imaging or therapeutic agents. Optionally, the therapeutic agent is a chemotherapeutic agent. Optionally, the heavy chain comprises SEQ ID NO:1 and the light chain comprises SEQ ID NO:2. Optionally, the antibody is pritumumab. Optionally, the antibody specifically binds tumor cells but not normal cells.
(52) Suitable therapeutic agents for use in the provided compositions and methods, e.g., for conjugation to the provided antibodies include, but are not limited to, therapeutic agent is selected from the group consisting of analgesics, anesthetics, analeptics, corticosteroids, anticholinergic agents, anticholinesterases, anticonvulsants, antineoplastic agents, allosteric inhibitors, anabolic steroids, antirheumatic agents, psychotherapeutic agents, neural blocking agents, anti-inflammatory agents, antihelmintics, antibiotics, anticoagulants, antifungals, antihistamines, antimuscarinic agents, antimycobacterial agents, antiprotozoal agents, antiviral agents, dopaminergics, hematological agents, immunological agents, muscarinics, protease inhibitors, vitamins, growth factors, and hormones. The choice of agent and dosage can be determined readily by one of skill in the art based on the given disease being treated.
(53) As described herein, the antibodies can be linked or conjugated to an imaging agent. Imaging agents and their use are known. Optionally, the imaging agent is a “detectable moiety,” which is a composition detectable by spectroscopic, photochemical, biochemical, immunochemical, chemical, or other physical means. For example, useful labels include 32P, fluorescent dyes, electron-dense reagents, enzymes (e.g., as commonly used in an ELISA), biotin, digoxigenin, or haptens and proteins or other entities which can be made detectable, e.g., by incorporating a radiolabel into a peptide or antibody specifically reactive with a target peptide. Any method known in the art for conjugating an antibody to the label may be employed, e.g., using methods described in Hermanson, Bioconjugate Techniques 1996, Academic Press, Inc., San Diego. The detectable moiety can be selected from the group consisting of gamma-emitters, beta-emitters, and alpha-emitters, gamma-emitters, positron-emitters, X-ray-emitters and fluorescence-emitters. Suitable fluorescent compounds include fluorescein sodium, fluorescein isothiocyanate, phycoerythrin, and Texas Red sulfonyl chloride, Allophycocyanin (APC), Cy5-PE, CY7-APC, and Cascade yellow.
(54) Optionally the detectable moiety can be visualized using histochemical techniques, ELISA-like assays, confocal microscopy, fluorescent detection, cell sorting methods, nuclear magnetic resonance, radioimmunoscintigraphy, X-radiography, positron emission tomography, computerized axial tomography, magnetic resonance imaging, and ultrasonography.
(55) Antibody Assays
(56) A number of screening assays are known in the art for assaying antibodies of interest to confirm their specificity and affinity and to determine whether those antibodies cross-react with other proteins.
(57) The terms “specific binding” or “specifically binding” refer to the interaction between the antigen and their corresponding antibodies. The interaction is dependent upon the presence of a particular structure of the protein recognized by the binding molecule (i.e., the antigen or epitope). In order for binding to be specific, it should involve antibody binding of the epitope(s) of interest and not background antigens.
(58) Once antibodies are produced, they are assayed to confirm that they are specific for the antigen of interest and to determine whether they exhibit any cross reactivity with other antigens. One method of conducting such assays is a sera screen assay as described in U.S. App. Pub. No. 2004/0126829, the contents of which are hereby expressly incorporated herein by reference. However, other methods of assaying for quality control are within the skill of a person of ordinary skill in the art and therefore are also within the scope of the present disclosure.
(59) Antibodies, or antigen-binding fragments, variants or derivatives thereof of the present disclosure can also be described or specified in terms of their binding affinity to an antigen. The affinity of an antibody for an antigen can be determined experimentally using any suitable method. (See, e.g., Berzofsky et al., “Antibody-Antigen Interactions,” In Fundamental Immunology, Paul, W. E., Ed., Raven Press: New York, N.Y. (1984); Kuby, Janis Immunology, W. H. Freeman and Company: New York, N.Y. (1992); and methods described herein). The measured affinity of a particular antibody-antigen interaction can vary if measured under different conditions (e.g., salt concentration, pH). Thus, measurements of affinity and other antigen-binding parameters (e.g., K.sub.D, K.sub.a, K.sub.a) are preferably made with standardized solutions of antibody and antigen, and a standardized buffer.
(60) The affinity binding constant (K.sub.aff) can be determined using the following formula:
(61)
in which:
(62)
(63) [mAb] is the concentration of free antigen sites, and [mAg] is the concentration of free monoclonal binding sites as determined at two different antigen concentrations (i.e., [mAg].sub.t and [mAg].sub.t) (Beatty et al., J Imm Meth, 100:173-179 (1987)).
(64) Surface plasmon resonance (SPR) can be used for detection and measurement of antibody-antigen affinity and kinetics. (See, e.g., Hearty, S., et al., Methods Mol. Biol., 907:411-42 (2012); Malmqvist, M., Current Opinion in Immunology, 5: 282-286 (1993); Chatellier, J, et al., J. Molecular Recognition, 9: 39-51 (1996); Margulies, D. H., et al., Current Opinion in Immunology, 8: 262-270 (1996); Forbes, B. E., et al., Eur. J. Biochem., 269:961-968 (2002).)
(65) The term “high affinity” for an antibody refers to an equilibrium association constant (K.sub.aff) of at least about 1×10.sup.7 liters/mole, or at least about 1×10.sup.8 liters/mole, or at least about 1×10.sup.9 liters/mole, or at least about 1×10.sup.10 liters/mole, or at least about 1×10.sup.11 liters/mole, or at least about 1×10.sup.12 liters/mole, or at least about 1×10.sup.13 liters/mole, or at least about 1×10.sup.14 liters/mole or greater. “High affinity” binding can vary for antibody isotypes. K.sub.D, the equilibrium dissociation constant, is a term that is also used to describe antibody affinity and is the inverse of K.sub.aff.
(66) K.sub.D, the equilibrium dissociation constant, is a term that is also used to describe antibody affinity and is the inverse of K.sub.aff. If K.sub.D is used, the term “high affinity” for an antibody refers to an equilibrium dissociation constant (K.sub.D) of less than about 1×10.sup.−7 mole/liters, or less than about 1×10.sup.−8 mole/liters, or less than about 1×10.sup.−9 mole/liters, or less than about 1×10.sup.−10 mole/liters, or less than about 1×10.sup.−11 mole/liters, or less than about 1×10.sup.−12 mole/liters, or less than about 1×10.sup.−13 mole/liters, or less than about 1×10.sup.−14 mole/liters or lower.
(67) The production of antibodies according to the present disclosure provides for antibodies with the characteristics of those produced in the course of a physiological human immune response, i.e. antibody specificities that can only be selected by the human immune system. These antibodies can be used as prophylactic or therapeutic agents upon appropriate formulation.
(68) In relation to a particular agent, a “neutralizing antibody”, “broadly neutralizing antibody”, or “neutralizing monoclonal antibody”, all of which are used interchangeably herein, is one that can neutralize the ability of that agent to function in a host. In some embodiments, monoclonal antibodies produced in accordance with the present disclosure have neutralizing activity, where the antibody can neutralize at a concentration of 10.sup.−9M or lower (e.g., 10.sup.−10 M, 10.sup.−11 M, 10.sup.−12M or lower).
(69) The immunoglobulin molecules of the present invention can be of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2), or subclass of immunoglobulin molecule. In some embodiments, the antibodies are antigen-binding antibody fragments (e.g., human) and include, but are not limited to, Fab, Fab′ and F(ab′).sub.2, Fd, single-chain Fvs (scFv), single-chain antibodies, disulfide-linked Fvs (sdFv) and fragments comprising either a V.sub.L or V.sub.H domain. Antigen-binding antibody fragments, including single-chain antibodies, can comprise the variable region(s) alone or in combination with the entirety or a portion of the following: hinge region, CH1, CH2, and CH3 domains. Also included in the present disclosure are antigen-binding fragments comprising any combination of variable region(s) with a hinge region, CH1, CH2, and CH3 domains.
(70) Recombinant Expression
(71) The methods of the present disclosure also provide utilizing a nucleic acid to generate a host cell that can express an antibody of interest.
(72) In some embodiments, the nucleotide sequence encoding a desired antibody can be constructed and thereafter employed in a heterologous expression system, e.g., 293 cells or CHO cells. In some embodiments, an antibody can be recombinantly expressed by obtaining one or more nucleic acids (e.g. heavy and/or light chain genes) that encodes the antibody of interest and inserting the nucleic acid into a host cell in order to permit expression of the antibody of interest in that host.
(73) Production of antibodies using recombinant DNA methods is described, for example, in U.S. Pat. No. 4,816,567. For recombinant production of the antibody, the nucleic acid encoding it is isolated and inserted into a replicable vector for further cloning (amplification of the DNA) or for expression. DNA encoding a monoclonal antibody is readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody). Vectors that can be used generally include, but are not limited to, one or more of the following: a signal sequence, an origin of replication, one or more marker genes, an enhancer element, a promoter, and a transcription termination sequence. Examples of such expression system components are disclosed in, for example, U.S. Pat. No. 5,739,277. Suitable host cells for cloning or expressing the DNA in the vectors herein are the prokaryotic, yeast, or higher eukaryotic cells (see, e.g., U.S. Pat. No. 5,739,277).
(74) Pharmaceutical Compositions
(75) The presently disclosed subject matter provides pharmaceutical compositions comprising the antibodies and antigen binding proteins produced in accordance with the present disclosure. In some embodiments, a pharmaceutical composition can comprise one or more antibodies or antigen binding proteins produced in using the methods disclosed herein. In some embodiments, a panel of antibodies or antigen binding proteins produced according to the present disclosure can be included in a pharmaceutical composition. In some embodiments, the antibodies or antigen binding proteins produced according to the present disclosure can be included with one or more additional agents, for example, antiviral or anticancer drugs or analgesics.
(76) In some embodiments a pharmaceutical composition can also contain a pharmaceutically acceptable carrier or adjuvant for administration of the antibody or antigen binding protein. In some embodiments, the carrier is pharmaceutically acceptable for use in humans. The carrier or adjuvant should not itself induce the production of antibodies harmful to the individual receiving the composition and should not be toxic. Suitable carriers can be large, slowly metabolized macromolecules such as proteins, polypeptides, liposomes, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, ammo acid copolymers and inactive virus particles.
(77) Pharmaceutically acceptable salts can be used, for example mineral acid salts, such as hydrochlorides, hydrobromides, phosphates and sulphates, or salts of organic acids, such as acetates, propionates, malonate and benzoates.
(78) Pharmaceutically acceptable carriers in therapeutic compositions can additionally contain liquids such as water, saline, glycerol and ethanol. Additionally, auxiliary substances, such as wetting or emulsifying agents or pH buffering substances, can be present in such compositions. Such carriers enable the pharmaceutical compositions to be formulated as tablets, pills, dragees, capsules, liquids, gels, syrups, slurries and suspensions, for ingestion by the patient.
(79) The compositions of the presently disclosed subject matter can further comprise a carrier to facilitate composition preparation and administration. Any suitable delivery vehicle or carrier can be used, including but not limited to a microcapsule, for example a microsphere or a nanosphere (Manome et al. (1994) Cancer Res 54:5408-5413; Saltzman & Fung (1997) Adv Drug Deliv Rev 26:209-230), a glycosaminoglycan (U.S. Pat. No. 6,106,866), a fatty acid (U.S. Pat. No. 5,994,392), a fatty emulsion (U.S. Pat. No. 5,651,991), a lipid or lipid derivative (U.S. Pat. No. 5,786,387), collagen (U.S. Pat. No. 5,922,356), a polysaccharide or derivative thereof (U.S. Pat. No. 5,688,931), a nanosuspension (U.S. Pat. No. 5,858,410), a polymeric micelle or conjugate (Goldman et al. (1997) Cancer Res 57:1447-1451 and U.S. Pat. Nos. 4,551,482, 5,714,166, 5,510,103, 5,490,840, and 5,855,900), and a polysome (U.S. Pat. No. 5,922,545).
(80) Antibody sequences can be coupled to active agents or carriers using methods known in the art, including but not limited to carbodiimide conjugation, esterification, sodium periodate oxidation followed by reductive alkylation, and glutaraldehyde crosslinking (Goldman et al. (1997) Cancer Res. 57:1447-1451; Cheng (1996) Hum. Gene Ther. 7:275-282; Neri et al. (1997) Nat. Biotechnol. 15:1271-1275; Nabel (1997) Vectors for Gene Therapy. In Current Protocols in Human Genetics, John Wiley & Sons, New York; Park et al. (1997) Adv. Pharmacol. 40:399-435; Pasqualini et al. (1997) Nat. Biotechnol. 15:542-546; Bauminger & Wilchek (1980) Meth. Enzymol. 70:151-159; U.S. Pat. No. 6,071,890; and European Patent No. 0 439 095).
(81) A therapeutic composition of the present invention comprises in some embodiments a pharmaceutical composition that includes a pharmaceutically acceptable carrier. Suitable formulations include aqueous and non-aqueous sterile injection solutions which can contain anti-oxidants, buffers, bacteriostats, bactericidal antibiotics and solutes which render the formulation isotonic with the bodily fluids of the intended recipient; and aqueous and non-aqueous sterile suspensions which can include suspending agents and thickening agents. The formulations can be presented in unit-dose or multi-dose containers, for example sealed ampoules and vials, and can be stored in a frozen or freeze-dried (lyophilized) condition requiring only the addition of sterile liquid carrier, for example water for injections, immediately prior to use. Some exemplary ingredients are SDS in the range of in some embodiments 0.1 to 10 mg/ml, in some embodiments about 2.0 mg/ml; and/or mannitol or another sugar in the range of in some embodiments 10 to 100 mg/ml, in some embodiments about 30 mg/ml; and/or phosphate-buffered saline (PBS). Any other agents conventional in the art having regard to the type of formulation in question can be used. In some embodiments, the carrier is pharmaceutically acceptable. In some embodiments the carrier is pharmaceutically acceptable for use in humans.
(82) Pharmaceutical compositions of the present disclosure can have a pH between 5.5 and 8.5, preferably between 6 and 8, and more preferably about 7. The pH can be maintained by the use of a buffer. The composition can be sterile and/or pyrogen free. The composition can be isotonic with respect to humans. Pharmaceutical compositions of the presently disclosed subject matter can be supplied in hermetically-sealed containers.
(83) Pharmaceutical compositions can include an effective amount of one or more antibodies as described herein. In some embodiments, a pharmaceutical composition can comprise an amount that is sufficient to treat, ameliorate, or prevent a desired disease or condition, or to exhibit a detectable therapeutic effect. Therapeutic effects also include reduction in physical symptoms. The precise effective amount for any particular subject will depend upon their size and health, the nature and extent of the condition, and therapeutics or combination of therapeutics selected for administration. The effective amount for a given situation is determined by routine experimentation as practiced by one of ordinary skill in the art.
(84) Treatment Regimens: Pharmacokinetics
(85) The pharmaceutical compositions of the invention can be administered in a variety of unit dosage forms depending upon the method of administration. Dosages for typical antibody pharmaceutical compositions are well known to those of skill in the art. Such dosages are typically advisory in nature and are adjusted depending on the particular therapeutic context or patient tolerance. The amount antibody adequate to accomplish this is defined as a “therapeutically effective dose.” The dosage schedule and amounts effective for this use, i.e., the “dosing regimen,” will depend upon a variety of factors, including the stage of the disease or condition, the severity of the disease or condition, the general state of the patient's health, the patient's physical status, age, pharmaceutical formulation and concentration of active agent, and the like. In calculating the dosage regimen for a patient, the mode of administration also is taken into consideration. The dosage regimen must also take into consideration the pharmacokinetics, i.e., the pharmaceutical composition's rate of absorption, bioavailability, metabolism, clearance, and the like. See, e.g., the latest Remington's; Egleton, Peptides 18: 1431-1439, 1997; Langer, Science 249: 1527-1533, 1990.
(86) For purposes of the present invention, a therapeutically effective amount of a composition comprising an antibody, contains about 0.05 to 1500 μg protein, preferably about 10 to 1000 μg protein, more preferably about 30 to 500 μg and most preferably about 40 to 300 μg, or any integer between these values. For example, antibodies of the invention can be administered to a subject at a dose of about 0.1 μg to about 200 mg, e.g., from about 0.1 μg to about 5 μg, from about 5 μg to about 10 μg, from about 10 μg to about 25 μg, from about 25 μg to about 50 μg, from about 50 μg to about 100 from about 100 μg to about 500 from about 500 μg to about 1 mg, from about 1 mg to about 2 mg, with optional boosters given at, for example, 1 week, 2 weeks, 3 weeks, 4 weeks, two months, three months, 6 months and/or a year later. It is understood that the specific dose level for any particular patient depends upon a variety of factors including the activity of the specific antibody employed, the age, body weight, general health, sex, diet, time of administration, route of administration, and rate of excretion, drug combination and the severity of the particular disease undergoing therapy.
(87) Routes of administration include, but are not limited to, oral, topical, subcutaneous, intramuscular, intravenous, subcutaneous, intradermal, transdermal and subdermal. Depending on the route of administration, the volume per dose is preferably about 0.001 to 10 ml, more preferably about 0.01 to 5 ml, and most preferably about 0.1 to 3 ml. Compositions can be administered in a single dose treatment or in multiple dose treatments on a schedule and over a time period appropriate to the age, weight and condition of the subject, the particular antibody formulation used, and the route of administration.
(88) Kits
(89) The invention provides kits comprising antibodies produced in accordance with the present disclosure which can be used, for instance, for therapeutic applications described above. The article of manufacture comprises a container with a label. Suitable containers include, for example, bottles, vials, and test tubes. The containers can be formed from a variety of materials such as glass or plastic. The container holds a composition which includes an active agent that is effective for therapeutic applications, such as described above. The active agent in the composition can comprise the antibody. The label on the container indicates that the composition is used for a particular therapy or non-therapeutic application, and can also indicate directions for either in vivo or in vitro use, such as those described above.
(90) The following examples of specific aspects for carrying out the present invention are offered for illustrative purposes only, and are not intended to limit the scope of the present invention in any way.
EXAMPLES
Example 1. Pritumumab Penetrates the Blood Brain Barrier
(91) To demonstrate pritumumab crosses the blood brain barrier, human primary glioblastoma stem cells (GBM8 cells; 200K cells) were injected intracranially into NSG mouse brain. After 35 days, mouse was injected intraveneously (i.v.) via tail vein with 50 μg of Pritumumab-Alexa647 antibody. After 3.5 hours 20 μg fluorescein-labeled G. simplicifolia lectin that binds selectively to mouse endothelial cells (GSL I-BSL I; Vector Laboratories, Inc., Burlingame, Calif.) was injected i.v. The mouse was then euthanized, brain was removed, sliced, and various areas were imaged by confocal microscopy (Nikon eclipse Ti). The results are shown in
(92) The distribution of pritumumab was further studied in brain and other tissues. SCID mice of either sex and typically weighing between 20-25 g were housed in micro-isolator cages with autoclaved bedding and autoclaved food and water. A limitation of this model is that it involves the implantation of human glioma cells into athymic nu/nu or SCID mice.
(93) For intracranial implantation, aseptic surgical methods were followed in accordance with UCSD animal research guidelines. Target cells (both the U87 cell line and patient derived GBM8 glioma cells) were concentrated into a compact suspension (1-2 ul). Mice were anesthetized with ketamine/xylazine and the head was swabbed with Betadine. Body temperature was maintained with a circulating water pad. The tumor cell suspensions were injected stereotaxically into the right frontal cortex at 1 ul/min using a 5 ul Hamilton syringe. The syringe was left in place for 5 min before retraction to prevent reflux of the injected material.
(94) For imaging, MRI imaging of implanted tumors (both U87 and patient derived GBM8 glioma cells) was performed every week as tumors grew. After the appropriate scans the mice were sacrificed. The MRI protocol was as follows. Mice were anesthetized with a mixture of 1.5% isofluorane and 95% oxygen throughout imaging. MRI was performed on a 4.7T horizontal bore system interfaced with a commercial scanner console (Bruker BioSpin Corporation, MA) using a homogeneous quadrature birdcage head coil. Coronal T2-weighted images (T2WI) (TR/TEeff=2,000/72 ms) were acquired with a 2D fast spin echo sequence at 1 mm slice thickness with 80 um×130 um in-plane resolution. Magnevist Gd-DTPA was injected intraeritoneally at 0.7 mmol/kg and coronal T1-weighted images (T1WI) (TR/TEeff=417/24.5 ms) were acquired once before and twice after contrast injection. Post-contrast imaging was performed at 12 min after injection.
(95) Brain enhancement represents a measure of tumor microvascular permeability and relates to how therapeutic agents might be distributed within a tumor and whether contrast agents can highlight a small tumor. The usual normalization method was used in which a ratio of contrast enhancement is determined by comparing tumor tissue to contralateral normal brain. A ratio of enhancement comparing the tumor with cervical skeletal muscle (sternocleidomastoid) was also calculated. This was performed to provide a check for the tumor versus normal brain ratio since it is possible that inaccuracies might arise from altered permeability in the reference white matter due to tumor infiltration and edema.
(96) The tumor to contralateral white matter ratio (TWR) and the tumor-muscle enhancement ratio (TMR) were the mean signal intensity of the enhanced tumor divided by mean signal intensity of white matter and cervical muscle, respectively, at the 12 min post-contrast T1WI. Maximum enhanced regions of interest (ROI) were selected manually on the pre- and post-contrast images. The T1 and T2 acquisitions for each animal were cross-referenced to ensure proper ROI location.
(97) For tumor morphology, all the GBM8 tumors (n=6) has a well-demarcated margin and no central necrosis was observed. The tumors had relatively uniform hyperintensity compared to surrounding brain parenchyma on T2WI and all displayed clearly visible contrast enhancement that was uniform.
(98) The Results are shown in
(99) TABLE-US-00005 TABLE 2 Distribution in normal and tumor cells of pritumumab obtained from its hybridoma or manufactured in CHO cells. Pritumumab - hybridoma Pritumumab - CHO malignant benign normal malignant normal Brain 15/27 2/19 0/8 10/10 Normal brain 0/3 melanoma 10/10 Colon carcinoma 2/2 Tongue 1/1 ND 0/1 Salivary gland 0/1 ND ND Thyroid 2/2 ND ND Esophagus 1/1 ND 0/1 Lung 2/4 ND 0/1 9/9 Stomach 2/5 ND 0/2 Heart ND ND 0/1 Renal 1/1 ND 0/2 11/11 Adrenal 0/2 ND 0/1 Spleen 0/1 ND 0/3 Liver 0/2 ND 0/2 Pancreas 1/1 ND 0/1 9/9 Gall bladder 2/2 ND 0/1 Lymph node 0/17 ND 0/3 Breast 5/15 1/5 0/1 12/12 Ovary 6/8 ND 0/1 Uterus 2/3 ND 0/1 Cervix 7/10 0/2 Squamous 0/2 epithelium Endometrium 0/3 Blood vessels 0/4 Smooth muscle 0/5 Normal fat 0/2
Example 2. Generation of Antibodies with Enhanced Delivery to the Brain Materials
(100) Cell Lines:
(101) E. coli CJ236 (New England Biolabs, Beverly, Mass.); E. coli SS320 (Lucigen, Middleton, Wis.); E. coli One Shot® OmniMAX™ 2 T1R (Invitrogen, Grand Island, N.Y.); Chinese hamster ovary (CHO) cells; HEK cells.
(102) Tumor Tissues and Tumor Cell Lines:
(103) All tumor tissues will be discards after their clinical and diagnostic application and the cell lines will be procured from ATCC (USA). The tumor tissues will include brain, breast, cervical, colon, liver, melanoma, ovarian, and pancreatic cancers. Uterine smooth muscle will be used as normal tissue control. Inclusion of these controls will determine specificity of the recombinantly produced CDR swapped antibodies which will be equivalent to the original human-human hybridoma produced pritumumab particularly with respect to the frame-work.
(104) Media:
(105) One example of synthetic media is synthetic low-density lipoprotein (sLDL), as a lipid supplement in serum-free media (Hayavi and Halbert, 2005). The sLDL can be manufactured by microfluidization of the lipid dissolve in solvent with aqueous solutions, generating a non-toxic product with physico-chemical characteristic of native LDL. The inclusion of 0.1-0.5 mM iron citrate in chemically defined (animal-free) media has been shown to increase mAb expression in CHO cells by around a third, involving upregulation of genes associated with ribosome formation and protein folding (Bai et al., 2011).
(106) Antibodies/Reagents:
(107) Specific antibodies and other immunochemicals and routine reagents will be procured from Sigma-Aldrich and Pierce Thermo Fisher.
(108) Pritumumab:
(109) Pritumumab has been produced by Catalent using the patented GPEx technology.
(110) Primer Design Using Integrated DNA Technologies Program “PRIME QUEST” for Pritumumab CDRs and Frameworks:
(111) TABLE-US-00006 Start Stop Length Tm GC % HC-CDR1 primer sequence of pritumumab Sequence Name: HC-CDR1 primer sequence of pritumumab Amplicon Length: 242 Forward: TCACCTTCAGCAACTATGCC (SEQ ID NO: 12) 2 22 20 67 50 Reverse: AAGGGTACCAAGTGCTTCTATATG (SEQ ID NO: 13) 220 244 24 62 41.7 HC-CDR2 primer sequence of pritumumab Sequence Name: HC-CDR2 primer sequence of pritumumab Amplicon Length: 281 Forward: GAGTGGGTCTCAGCGATTAC (SEQ ID NO: 14) 58 78 20 62 55 Reverse: AGAGGTGCTCTTGGAGGA (SEQ ID NO: 15) 321 339 18 62 55.6 HC-CDR3 primer of pritumumab Sequence Name: HC-CDR3 primer sequence of pritumumab Amplicon Length: 213 Forward: CTATGCCATGAGCTGGGT (SEQ ID NO: 16) 15 33 18 61 55.6 Reverse: TCTATATGGACTCTCCCACAGATA (SEQ ID NO: 17) 204 228 24 62 41.7 Framework primer sequence of HC of Pritumumab Set 1 Sequence Name: Framework primer sequence of HC of Pritumumab-1 Amplicon Length: 219 Forward: GCCTGGTCAAAGGCTTCTAT (SEQ ID NO: 18) 641 661 20 62 50 Reverse: TCTTCTGCGTGTAGTGGTTG (SEQ ID NO: 19) 840 860 20 62 50 Framework primer sequence of HC of Pritumumab Set 2 Sequence Name: Framework primer sequence of HC of Pritumumab-2 Amplicon Length: 292 Forward: GCTGAATGGCAAGGAGTACA (SEQ ID NO: 20) 480 500 20 62 50 Reverse: GAGCTTGCTGTAGAGGAAGAAG (SEQ ID NO: 21) 750 772 22 62 50 Framework primer sequence of HC of Pritumumab Set 3 Sequence Name: Framework primer sequence of HC of Pritumumab-3 Amplicon Length: 658 Forward: CAAGGTGGACAAGAAAGTTGAG (SEQ ID NO: 22) 168 190 22 61 45.5 Reverse: CATCACGGAGCATGAGAAGA (SEQ ID NO: 23) 805 626 20 62 50 Framework primer sequence of HC of Pritumumab Set 4 Sequence Name: Framework Primer sequence of HC of Pritumumab Amplicon Length: 362 Forward: ATCACAAGCCCAGCAACA (SEQ ID NO: 24) 149 167 31 62 50 Reverse: GACCTTGCACTTGTACTCCTT (SEQ ID NO: 25) 149 167 18 62 50 Framework primer sequence of HC of Pritumumab Set 5 Sequence Name: Framework Primer sequence of HC of Pritumumab Amplicon Length: 225 Forward: GTGCAAGGTCTCCAACAAAG (SEQ ID NO: 26) 500 521 21 63 47.5 Reverse: GCGTGGTCTTGTAGTTGTTCTC (SEQ ID NO: 27) 703 725 22 63 50 LC-CDR1 primer sequence of Pritumumab Sequence Name: LC-CDR1 primers of Pritumumab Amplicon Length: 261 Forward: GCATCTGTAGGAGACAGAGTCA (SEQ ID NO: 28) 37 59 22 63 50 Reverse: GCCGAAGGTGATAGGGTAAGTA (SEQ ID NO: 29) 276 298 22 63 50 LC-CDR2 primer sequence of Pritumumab Sequence Name: LC-CDR2 primers of Pritumumab Amplicon Length: 201 Forward: AGTCTCCATCCTCACTGTCT (SEQ ID NO: 30) 17 37 20 62 50 Reverse: GAGTGAAATCTGTCCCAGATCC (SEQ ID NO: 31) 196 218 22 62 50 LC-CDR3 primer sequence of Pritumumab Sequence Name: LC-CDR primers of Pritumumab Amplicon Length: 239 Forward: GAGACAGAGTCACCATCACTTG (SEQ ID NO: 32) 47 69 22 62 50 Reverse: AGGGTAAGTACTATACTGTAGGCA (SEQ ID NO: 33) 262 286 24 62 41.7 LC Framework Primers sequence of Pritumumab Set 1 Sequence Name: LC Framework Primers for Pritumumab-1 Amplicon Length: 249 Forward: CTGCACCATCTGTCTTCATCT (SEQ ID NO: 34) 32 53 21 62 47.6 Reverse: AGGCGTAGACTTTGTGTTTCT (SEQ ID NO: 35) 260 281 21 62 32.9 LC Framework Primers sequence of Pritumumab Set 2 Sequence Name: LC Framework Primers for Pritumumab-2 Amplicon Length: 223 Forward: CTTCATCTTCCCGCCATCT (SEQ ID NO: 36) 45 64 19 61 52.5 Reverse: GTGTTTCTCGTAGTCTGCTTTG (SEQ ID NO: 37) 248 268 22 61 45.5 LC Framework Primers sequence of Pritumumab Set 3 Sequence Name: LC Framework Primers for Pritumumab-3 Amplicon Length: 209 Forward: ATCTGGAACTGCCTCTGTTG (SEQ ID NO: 38) 78 98 20 62 50 Reverse: CTTCGCAGGCGTAGACTTT (SEQ ID NO: 39) 268 287 19 62 52.6 LC Framework Primers sequence of Pritumumab Set 4 Sequence Name: LC Framework Primers for Pritumumab-4 Amplicon Length: 241 Forward: GTTGTGTGCCTGCTGAATAAC (SEQ ID NO: 40) 94 115 21 62 47.6 Reverse: CCCTGTTGAAGCTCTTTGTGA (SEQ ID NO: 41) 314 335 21 63 47.6 LC Framework Primers sequence of Pritumumab Set 5 Sequence Name: LC Framework Primers for Pritumumab Amplicon Length: 215 Forward: AGGTGGAGATCAAACGAACTG (SEQ ID NO: 42) 8 29 21 62 47.6 Reverse: GCTGTAGGTGCTGTCCTTG (SEQ ID NO: 43) 204 223 19 62 57.9
Methods:
(112) PCR Primers and Framework Cassette:
(113) Extended Packaging Region.
(114) The PCR primers will be designed to amplify a portion of the Moloney Murine Leukemia Virus extended packaging region that is found in all gene constructs used in the GPEx® process. The primers shown below amplify an 85 bp fragment of the EPR.
(115) EPR PCR primers will include:
(116) TABLE-US-00007 EPR1 5′-GTTATGCGCCTGCGTCTGTAC-3′ (SEQ ID NO: 44) EPR2 5′-CCGGGTGTTCAGAACTCGTC-3′ (SEQ ID NO: 45)
(117) Heavy Chain.
(118) These PCR primers are designed to amplify a portion of the human IgG1, IgG2, IgG3 and IgG4 constant regions. The primers shown below will be amplified in a 92 bp fragment of the constant region. These primers will be:
(119) TABLE-US-00008 Human Ab heavy chain F 5′-ACGGTGTCGTGGAACTCAG-3′ (SEQ ID NO: 46) Human Ab heavy chain R 5′-CACGCTGCTGAGGGAGTAGAGTCC-3′ (SEQ ID NO: 47)
(120) Light Chain. These PCR primers are designed to amplify a portion of the human kappa constant region. The primers shown below will be amplified in a 83 bp fragment of the constant region.
(121) LC PCR Primers:
(122) TABLE-US-00009 Human Ab light chain (kappa) F 5′-CAAAGTACAGTGGAAGGTGGAT-3′ (SEQ ID NO: 48) Human Ab light chain (kappa) R 5′-GTGCTGTCCTTGCTGTCCTGCTCT-3′ (SEQ ID NO: 49)
(123) Control.
(124) These PCR primers will be designed to amplify a portion of the CHO β 1, 4-galactosyltransferase gene. The primers shown below amplify an 82 bp fragment of the CHO β 1, 4-galactosyltransferase-1 gene.
(125) Control Single Copy Gene PCR Primers:
(126) TABLE-US-00010 CHO Internal 1 5′-AAAGATGGGCGGTCGTTATTC-3′ (SEQ ID NO: 50) CHO Internal 2 5′-CCTGCCGGTTGCGAAATGGGATAA-3′ (SEQ ID NO: 51)
(127) DNA will be isolated from the cell lines using the DNeasy genomic DNA purification kit (Catalog #69504, Qiagen, Valencia, Calif.). PCR reactions will be set up on the SYBR® Green PCR Master Mix (Catalog #4311034, Applied Biosystem, Foster City, Calif.) under the conditions described below. The samples will be run using the following cycling program on an iQ cycler from Bio-Rad (Hercules, Calif.).
(128) PCR Reaction Setup with Respect to PCR Components Final Concentration:
(129) SYBR® Green PCR Master Mix 12.5 μL per reaction,
(130) Primer final concentration: 125 nM for each primer
(131) Separate reactions will be done for each of the different primer sets using 20 ng genomic DNA for each 25 μL reaction (Diluted in nuclease free water);
(132) Nuclease free water will be added to bring final volume to 25 μL.
(133) Each sample (EPR and internal control) will be run in triplicate.
(134) The Samples Will be Run Using the Following Cycling Program on an iQ Cycler from Bio-Rad for PCR Program:
(135) Step 1: 95° C. 9 minutes (denature and activate polymerase)
(136) Step 2: 94° C. 15 seconds (denature)
(137) 60° C. 1 minute (combined anneal and synthesis steps) 40 cycles as in Step 2
(138) The gene copy index will be calculated by subtracting the Ct of the transgene assay (EPR, HC or LC) from the Ct for the control assay (β 1, 4-galactosyltransferase-1).
(139) Gene Cloning into Expression Retrovector:
(140) Pritumumab (P-mAb) Heavy Chain grafted with CDR of interest will be cloned into Expression Retrovector. In the first PCR reaction P-mAb heavy chain variable region CDS with CPS-M's (Catalent) proprietary bovine α-lactalbumin signal peptide sequence will be amplified from the synthesized DNA fragment, plasmid GDD2120.0001, using primers SP75′(5′-TTTTAAGCTTGCCGCCACCATGATGTCCTTTGTCT-3′ (SEQ ID NO:52)) and P-mAbHC2 (5′-GCCAGGGGGAAGACCGATGGGCCCTTGGTGGAGGCAGAGGACACGGTCACGAG GGTG CCCTGGCCCCAATA-3′ (SEQ ID NO:53)). Primer SP75′ will be added to a Hind III site at the 5′ end and Kozak translation initiation sequence just before the translation start codon of the signal peptide. Primer P-mAbHC2 will be amplified the variable region sequences for in-frame fusion to the P-mAb heavy chain constant region by addition of an overlap between the two sequences. In the second PCR reaction the P-mAb heavy constant region will be amplified to allow for fusion with the variable region using primers P-mAbHC1 (5′TATTGGGGCCAGGGCACCCTCGTGACCGTGTCCTCTGCCTCCACCAAGGGCCC ATCGGTCTTCCCCCTGGC-3′ (SEQ ID NO:54)) and INHC2 (5′-TTTCTCGAGATCTCATCATTTCCCGGGAGACAGGGAGAGGCTCTTCTGCGTGTAG TGGT-3′ (SEQ ID NO:55)) and GDD2110.0004 plasmid as a DNA template. The GDD2110.0004 plasmid will be constructed by CPS-M previously and will serve as the reaction source of the heavy chain constant region sequence. Primer P-mAbHC1 will be a reverse compliment to primer P-mAbHC2 and hence will serve the purpose of configuring the amplified constant region sequence for in-frame fusion to the variable region by addition of an overlap between the two sequences. Primer INHC2 will encode the 3′ end of the heavy constant region and contributed an Xho I site for easy cloning. The amplified products from PCR reactions 1 and 2 will be used as DNA template with the outermost primers SP75′ and INHC2 to join the variable and the constant regions together and to amplify full-length P-mAb heavy chain CDS. The resultant PCR product will be digested with Hind III and Xho I restriction endonucleases and ligated into the retrovector plasmid pFCSnewMCS-WPRE-SIN (new ori) (GDD1008.0146) which will also be digested with the same enzymes.
(141) The resultant clones will be sequenced through the assembled heavy chain gene and the flanking regions and a clone will be confirmed to encode the desired full-length P-mAb heavy chain CDS.
(142) P-mAb Light Chain Gene Cloning into Expression Retrovector:
(143) In the first PCR reaction P-mAb light chain variable region CDS with CPS-M's proprietary bovine α-lactalbumin signal peptide sequence will be amplified from the synthesized DNA fragment, plasmid GDD2120.0001, using primers SP75′ (5′-TTTTAAGCTTGCCGCCACCATGATGTCCTTTGTCT-3′ (SEQ ID NO:56)) and PmabLC2 (5′-GCGGGAAGATGAAGACAGATGGTGCAGCCACAGTTCGCTTGATTTCCACCTTGGT GCCTCCGCCGAAGGTGATAGG-3′ (SEQ ID NO:57)). Primer SP75′ will be added to a Hind III site at the 5′ end and Kozak translation initiation sequence just before the translation start codon of the signal peptide. Primer PmabLC2 amplified the light chain variable region sequence for in-frame fusion to the P-mAb light chain constant region by addition of an overlap between the two sequences. In the second PCR reaction the P-mAb light chain constant region will be amplified to allow for fusion with the light chain variable region using primers PmabLC1 (5′-CCTATCACCTTCGGCGGAGGCACCAAGGTGGAAATCAAGCGAACTGTGGCTGCA CCATCTGTCTTCATCTTCCCGC-3′ (SEQ ID NO:58)) and INLC2 (5′-TTTCTCGAGATCTCACTAACACTCTCCCCTGTTGAAGCTCT-3′ (SEQ ID NO:59)) and GDD2103.0003 plasmid as the DNA template. The GDD2103.0003 plasmid will be constructed by CPS-M previously and in this reaction will a source of the light chain constant region sequence. Primer PmabLC1 will be a reverse compliment to primer PmabLC2 and hence will serve the purpose of configuring the amplified constant region sequence for in-frame fusion to the variable region. Primer INLC2 encoded the 3′ end of the light chain constant region and contributed an Xho I site for easy cloning.
(144) The amplified products from PCR reactions 1 and 2 will be used as the DNA templates with the outermost primers SP75′ and INLC2 to join the variable and the constant regions and to amplify full-length P-mAb light chain CDS. The resultant PCR product will be digested with Hind III and Xho I restriction endonucleases and ligated into the retrovector plasmid pFCS-newMCSWPRE-SIN (new ori) (GDD1008.0146) which would have also been digested with the same enzymes. Plasmid DNA isolated from the resultant clones will be sequenced through the assembled light chain gene and the flanking regions and a clone was confirmed to encode the desired full-length P-mAb light chain CDS.
(145) Development of Catalent Pharma Solutions-Middleton's Expression Retrovector Construct pFCS-newMCS-WPRE-SIN (new ori) (GDD1008.0146): The latest generation GPEx® expression plasmid pFCS-newMCS-WPRE-SIN (new ori) (GDD1008.0146) will be created by adding WPRE, a post-transcriptional regulatory element whose function is described below, to pFCS-newMCS-SIN (new ori) (GDD1008.0136), which is also described below. Briefly, pCNS-newMCS-WPRE (new ori), (GDD1008.0068), also described below, was digested with ClaI, and the fragment containing WPRE will be isolated and purified. The WPRE fragment will be ligated into the major vector fragment purified from the digestion of pFCS-newMCS-SIN (new ori) (GDD1008.0136) with ClaI. The recombinant molecules will be screened using the restriction endonucleases HindIII and NaeI to confirm the correct orientation of the WPRE element. The sequence of the resultant vector across the ClaI insertion sites will be confirmed.
(146) The GPEx® expression plasmid pFCS-newMCS-SIN (new ori) (GDD1008.0136) is a self-inactivating (SIN) vector featuring a full-length human cytomegalovirus (CMV) immediate early enhancer/promoter in the 5′ LTR. The full-length human CMV promoter and the mutated (SIN) version of 3′ LTR will improve expression by increasing viral titers and reducing 5′ LTR promoter interference. This vector is a legacy of the previous highly successful expression vector pCS-newMCS-WPRE (new ori) (GDD1008.0074). Plasmid pFCS-newMCS-SIN (new ori) (GDD1008.0136) will be constructed by removal of an EcoRI/HindIII fragment encompassing a portion of the 3′ part of the Extended Packaging Region (EPR) and Neo gene (neomycin phosphotransferase, selectable marker) from plasmid pFCNS-newMCS-SIN (new ori) (GDD1008.0140) and complementing the EPR with the small EcoRI/HindIII fragment of pCSnewMCS-WPRE (new ori) (GDD1008.0074) comprising its missing part. Plasmid pCSnewMCS-WPRE (new ori) (GDD1008.0074) is GPEx® previous generation expression vector and history of its development is described below. Construct pFCNS-newMCS-SIN (new ori) (GDD1008.0140) will be derived by removing the ClaI restriction fragment containing WPRE sequence from plasmid pFCNS-newMCS-WPRE-SIN (new ori) GDD1008.0141. Plasmid pFCNS-newMCS-WPRE-SIN (new ori) (GDD1008.0141) will be created from vector pCNS-newMCS-WPRE (new ori), (GDD1008.0068) by cloning the full-length human CMV promoter amplified by PCR from plasmid pLNC-MCS (GDD1008.0001) into the 5′ LTR region upstream of the Neomycin selectable marker gene. Finally, construct pCNS-newMCSWPRE (new ori); (GDD1008.0068) will be developed by the addition of the high-copy origin of replication from the plasmid pUC19 into plasmid pCNS-newMCS-WPRE (GDD1008.0033). The origins and evolution of plasmid pCNS-newMCS-WPRE (GDD1008.0033) are detailed below in the description of development of GPEx® previous basic expression vector pCSnewMCS-WPRE (new ori) (GDD1008.0074).
(147) The plasmid pCS-newMCS-WPRE (new ori) (GDD1008.0074) will be originally derived from plasmid pLNCX II (GD0004). The pLNCX II plasmid will be recreated at Catalent Pharma Solutions-Middleton by removing the cc49 gene from the plasmid pLNC-cc49 (GDD1008.0049) which has been received from the laboratory of Dr. Paul Sondel at the University of Wisconsin-Madison. The pLNCX II plasmid is a slight modification of the pLNCX plasmid (Genbank ACCESSION M28247) created by A. D. Miller (removal of Eco RI site; Kashmiri et al. Hybridoma 14: 461-473 1995 performed in the laboratory of Dr. Jeffery Schlom at the National Institutes of Health). The pLNCX II plasmid will be modified with oligonucleotides to create a multiple cloning site following the hCMV promoter (plasmid pLNC-MCS GDD1008.0001). In order to enhance production of retrovector particles, the human CMV promoter will be used to replace the 5′ LTR U5 region of pLNC-MCS to create plasmid pCNC-MCS (GDD1008.0085). When used in this way, the human CMV promoter on the 5′ end of the LTR does not get incorporated into retrovector particles or inserted into production cell lines.
(148) A segment from the Pol gene of the woodchuck Hepatitis B virus will be obtained from Dr. Tom Hope then at the Salk Institute (plasmid pBluescript II SK+WPRE-B11). This fragment (WPRE—Woodchuck Post-transcriptional Regulatory Element) enhances export of mRNA lacking introns from the nucleus to the cytoplasm as well as enhances expression of genes that include this sequence in their mRNA. The plasmid pBluescript II SK+WPRE-B11 sequence will be mutated by its developers to eliminate promoter function and the initiation codon for a fragment of the putative oncogene encoding protein pX. The WPRE fragment will be inserted 3′ from the multiple cloning site to create plasmid pLNC-MCS-WPRE (GDD1008.0005). Later, the WPRE fragment was transferred from pLNC-MCS-WPRE into pCNC-MCS to create pCNCMCS-WPRE (GDD1008.0030).
(149) The simian cytomegalovirus (sCMV) promoter will be procured from Dr. Tom Hope at the University of Illinois as part of the plasmid IEX, an expression plasmid for the HTLV Tax gene. Research into the literature and intellectual property background on the simian CMV promoter denotes that it is similar to the hCMV promoter in having high constitutive activity, but will be available in the public domain. The sCMV promoter fragment will be PCR amplified from the IEX plasmid and used to replace the hCMV promoter in pLNC-MCS, creating plasmid pSCMV-MCS (GDD1008.0018). The sCMV promoter fragment will be later modified by PCR to remove a Sal I site in the 5′ end and cloned into pCNC-MCS-WPRE in place of the hCMV promoter to create plasmid pCNS-MCS-WPRE (GDD1008.0031).
(150) A second set of oligonucleotides will be used to add additional restriction enzyme sites to the multiple cloning site to create plasmid pCNSnewMCS-WPRE (GDD1008.0033). To reduce the burden of excess production of neomycin phosphotransferase protein from retrovector inserts in production cell lines, the NEO gene will be removed from pCNS-newMCS-WPRE to create pCS-newMCS-WPRE (GDD1008.0054). To improve yield from plasmid preps, the E. coli origin of replication in pCS-newMCSWPRE will be replaced with the origin of replication from the plasmid pUC19. This will create a plasmid pCS-newMCS-WPRE (new ori), GDD1008.0074.
(151) Cos-7 Expression:
(152) COS7 cells were obtained from the Health Science Research Resources Bank (Osaka) is the haploid strain of Saccharomyces. This unit describes the use of COS cells to efficiently produce a desired protein in a short period of time. These cells express high levels of the SV40 large tumor (T) antigen, which is necessary to initiate viral DNA replication at the SV40 origin. Three factors contribute to make COS cell expression systems appropriate for the high-level, short-term expression of proteins: (1) the high copy number achieved by SV40 origin-containing plasmids in COS cells 48 hr post-transfection, (2) the availability of good COS cell expression/shuttle vectors, and (3) the availability of simple methods for the efficient transfection of COS cells. Each COS cell transfected with DNA encoding a cell-surface antigen (in the appropriate vector) or cytoplasmic protein will express several thousand to several hundred thousand copies of the protein 72 hr post-transfection. If the transfected DNA encodes a secreted protein, up to 10 μg of protein can be recovered from the supernatant of the transfected COS cells 1 week post-transfection. COS cell transient expression systems have also been used to screen cDNA libraries, to isolate cDNAs encoding cell-surface proteins, secreted proteins, and DNA binding proteins, and to test protein expression vectors rapidly prior to the preparation of stable cell lines.
(153) ELISA:
(154) A sandwich ELISA was developed using pritumumab antibody as the capture reagent. Biotin-labeled recombinant antibody will be used as the detection antibody. This homologous antibody format would be possible assuming that the target antigen would have multiple epitopes. Microtiter plates (96-well Nunc Maxisorp) will be coated with purified unlabeled pritumumab antibody at 10 μg/ml concentration in 0.5M sodium carbonate pH 9.5 overnight at 25° C. Plates will then be blocked with 1% skim milk made in Tris-Buffered Saline (TBS) containing 5 mM EDTA and 1% sucrose for 4 hours at 25° C. Plates prepared in this manner could be stored dried and sealed for at least 12 months. All dilutions will be made in ImmunoBooster buffers (Bioworld Consulting Laboratories, LLC) supplemented with 20 mM EDTA. Wash buffer will be TBS containing 0.05% Tween-20 nonionic detergent. A detergent extract of cultured human tumor cells will be used as a source of antigen to derive a standard curve. Units will be in cells/well. Extracts derived from human brain tumor cells will be generated in a similar manner. As indicated above, all tumor cell lines will be purchased from American Type Culture Collection (Manassas, Va.) and grown in RPMI medium containing 10% FBS (heat-inactivated) with 8 mM glutamine. To measure direct binding of the antibody to the target antigen, cells will be grown in serum-free medium for 5 days and the conditioned medium will be filtered and stored in one large lot at 4° C. The sandwich ELISAs will be performed by diluting the cell extract standard on each plate. All incubations were performed at 25° C. and all volumes will be 100 ul per well. The plates were incubated for 15 minutes and washed three times with wash buffer. The biotin-labeled pritumumab antibody will then be added to the wells at 1 μg/ml, incubated for 15 minutes, and plates will be washed three times. Peroxidase-conjugated streptavidin (1:5,000 dilution) will be added to the plates for 15 minutes, and plates will be washed three times with wash buffer and two times with TBS. The signal will be developed by the addition of TMB substrate (BioFX Laboratories Inc.) to the plates, incubation for 15 minutes, then the color reaction will be stopped with the addition of 0.5M sulfuric acid. The data was acquired by measuring absorbance at 450 nm, and analyzed using GraphPad Prism or Microsoft Excel software programs.
(155) Immunohistochemistry (IHC):
(156) For IHC analyses, the antibody will be purified, and will be covalently conjugated to HRP (courtesy of American Qualex) and used to analyze various tissue sections such as brain, breast, cervical, colon, liver, melanoma, and pancreatic tissue sections. Tumor tissues left after needed diagnostic and clinical evaluation of the donor will be processed or left over paraffin blocks will be used to determine reactivity in IHC of pritumumab or its hybrid CDR version. For this purpose, Sum sections will be cut from the paraffin blocks, placed on slides and dried and de-paraffinized overnight at 60° C. The slides will be heat treated for epitope retrieval using the Dako Target Retrieval Solution at pH 9 (Dako cat #52367) in conjunction with pressure cooker for 30 minutes. The slides will then be stained on Dako Autostainer by using 3% hydrogen peroxide for 5 minutes, primary antibody (HRP-pritumumab or control) at 1:25 dilution for 1 hour, polymer-based Power Vision Plus detection solution (Leica cat #PV6104) for 30 minute, and DAB for 10 minutes. The stained slides will be counterstained in hematoxylin for 1 minute, dehydrated, and cover-slip applied for pathological examination.
(157) IEF (Isoelectric Focusing):
(158) IEF will be performed using IsoGel Agarose of Lonza according their protocol using the pH range from 3.5 to 9.5. The IEF plates will be stained first with Coomassie Blue and then after de-staining with Silver stain.
(159) Immunofluorescence Assay (FACS) Analysis with Soluble Antibodies:
(160) Freshly cultured tumor cells from established cell lines (melanoma, lung, breast) will be used for FACS analysis as described elsewhere. Cells from log-phase growing cultures with greater than 95% viability will be gently scraped off, after incubation with EDTA 0.02% (Sigma), and 3×105 cells per test tube will be used. Soluble pritumumab or test antibody of the selected GPEx clone will be prepared by methods described above. Tumor cells will be incubated with the antibody (diluted 1/1 in FCS RPMI 1640) at 37° C. for 1 h in pretreated (1% BSA) plastic tubes. After three washes with FCS RPMI 1640, cells will be incubated with biotin labelled anti-human IgG antibody (1:50)(Vector Lab) for 1 h at 4° C. After three wash steps (1% BSA PBS and PBS), Phycoerithrin Streptavidin (1:20) will be added for 20 minutes at 20° C. In repeat experiments FITC labeled anti human IgG (Fab′)2(1:25) (Sigma-Aldrich) will be used. Immunofluorescence labelled cells will be finally fixed in 1% Formalin-PBS. Ten thousand cells will be counted in a FACS Calibur (BD Biosciences) and analyzed by Cell Quest.
(161) Identification of CDRs and CDR Removal/Insertion—Polymerase Chain Reaction (PCR):
(162) PCR:
(163) Two novel approaches of recombinant PCR technology were employed to graft the CDRs from murine monoclonal antibodies (mAb) onto human antibody frameworks (Daugherty B L, DeMartino J A, Law M F, Kawka D W, Singer I I, Mark G E (1991) Polymerase chain reaction facilitates the cloning, CDR grafting, and rapid expression of a murine monoclonal antibody directed against the CD18 component of leukocyte integrins. Nucleic Acids Research, 19:2471-2476). One approach relied on the availability of cloned human variable region templates, whereas the other strategy is dependent only on human variable region protein sequence data. The transient expression of recombinant humanized antibody is generally driven by the adenovirus major late promoter and can be detected within 48 hrs post-transfection into non-lymphoid mammalian cells. Application of these approaches enables the expression of a recombinant humanized antibody just within 6 weeks after initiating the cDNA cloning of the murine mAb.
(164) Identification of CDRs and CDR Removal/Insertion:
(165) CDRs of interest will be identified, removed and inserted from hybridoma cells as detailed by Fields et al (Fields C, O'Connell D, Xiao S, Lee G U, Billiald P, Muzard J: (2013) Creation of recombinant antigen-binding molecules derived from hybridomas secreting specific antibodies. Nature Protocols 8:1125-1148). This protocol describes the design and development of recombinant monovalent antigen-binding molecules derived from monoclonal antibodies through rapid identification and cloning of the functional variable heavy (VH) and variable light (VL) genes and the design and cloning of a synthetic DNA sequence optimized for expression in recombinant bacteria. Typically, monoclonal antibodies are obtained from mouse hybridomas, which most often result from the fusion of B lymphocytes from immunized mice with murine myeloma cells. The protocol described here has previously been exploited for the successful development of multiple antibody-based molecules targeting a wide range of biomolecular targets. The protocol is accessible for research groups who may not be specialized in this area, and should permit the straightforward reverse engineering of functional, recombinant antigen-binding molecules from hybridoma cells secreting functional IgGs within 50 working days. Furthermore, convenient strategies for purification of antibody fragments are also described in this protocol.
(166) Protein a Purification Method:
(167) Purification of antibody molecules using protein A chromatography: Purification of antibody proteins will be essentially the same as the method used for purification of regular mAbs. The protocol to be used is outlined below:
(168) 1. Prepare protein A column as instructed (GE Healthcare).
(169) 2. Gently apply cell culture medium (diluted 1:1 with binding buffer) to the column by layering onto the top of the resin.
(170) 3. Wash column with 10 volumes of the wash/binding buffer, or until the absorbance of eluate at 280 nm approaches the background level.
(171) 4. To each collection tube add 100 ml 1 M Tris buffer (pH 8.0) so the eluate could be immediately neutralized.
(172) 5. To elute the antibody, gently add elution buffer to the top of the resin, collecting the eluate in a prepared collection tube (0.9 ml/tube).
(173) 6. Repeat until the entire volume has been collected, up to eight tubes.
(174) 7. Identify positive fractions by adding 10-20 μl of eluted fractions to 300 ml of Coomassie Plus Protein Assay Reagent (Pierce) (in a microtiter plate). Positive fractions show a blue reaction.
(175) 8. Combine positive fractions and dialyze against 1000-fold of sample volume of PBS overnight.
(176) 9. Measure OD280 of dialyzed sample.
(177) 10. Antibody protein concentration can be determined UV at 280 nm.
(178) 11. Check purity of the sample by SDS-PAGE. Single bands of about 200 kDa should be observed for antibody molecules under nonreducing condition, and two bands of 37.5 kDa (LC) and 62.5 kDa (HC) should be seen under reducing conditions.
(179) 12. Store purified protein at −20° C.
(180) SDS Page:
(181) For analysis of monoclonal antibodies using polyacrylamide gel electrophoresis, two hydrolytic fragments derived from the heavy chain of mouse IgG1 will be produced during incubation of the antibodies in Laemmli reducing sample buffer at 10° C. for 5 min as described previously (Davagnino J, Wong C, Shelton L, Mankarious S (1995) Acid hydrolysis of monoclonal antibodies. J Immunol Method. 185:177-180). The cleavage sites will be identified by amino terminal sequencing.
(182) Western Blotting:
(183) Expression levels of antibody in individual expression systems will be evaluated by Western blotting according to the procedure described previously (T. Matsuo, A. Yamamoto, T. Yamamoto, K. Otsuki, N. Yamazaki, M. Kataoka, H. Terada, Y. Shinohara, Replacement of C305 in heart/muscle-type isozyme of human carnitine palmitoyltransferase I with aspartic acid and other amino acids, Biochem. Genet. 48 (2010) 193-201). Specific antibody will be prepared as stated above.
(184) Measurements of Protein Concentration:
(185) The protein concentration of mitochondrial fractions was measured by use of a BCA protein assay kit with bovine serum albumin as the standard.
(186) Antibody Binding Affinity:
(187) Robust generation of IgG bispecific antibodies has been a long-standing challenge. Existing methods require extensive engineering of each individual antibody, discovery of common light chains, or complex and laborious biochemical processing. Here we combine computational and rational design approaches with experimental structural validation to generate antibody heavy and light chains with orthogonal Fab interfaces. Parental monoclonal antibodies incorporating these interfaces, when simultaneously co-expressed, assemble into bispecific IgG with improved heavy chain-light chain pairing. Bispecific IgGs generated with this approach exhibit pharmacokinetic and other desirable properties of native IgG, but bind target antigens monovalently. As such, these CDR grafted reagents may be useful in many biotechnological and therapeutic applications.
(188) Affinity Measurement of the mAbs and CDR Grafted Antibodies:
(189) Affinities of the mAbs containing heavy chain-light chain redesigns will be determined using surface plasmon resonance (Biacore 3000, GE Lifesciences). Fabs will be generated from the WT pritumumab IgG1 and CRD2 containing IgG1s. Goat anti-human IgG-Fc (Jackson Immunolabs, cat #109-005-098) will be diluted to 40 μm/ml in 10 mM acetate, pH 5, and immobilized to a CMS chip surface to −10,000 RU using standard 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide (EDC)/N-hydroxysuccinimide (NHS) amine coupling protocols. Fc of human antibodies that will be procured from different sources will be captured on the sensorship surface by injection for 4 min at 5 μl/min. The flow will be increased to 30 μl/min and a secondary injection of each Fab (at 50, 35, 20, 10, 5, 2 or 1 nM) will be performed. The running buffer (and dilution buffer) will be HBS-EP 10 mM Hepes, 150 mM NaCl, 3 mM EDTA, 0.005% polysorbate 20. The chip surface will be regenerated by two injections of 0.1 M glycine, pH 2.0. The concentration series will be fitted to a 1:1 binding model to determine the binding (ka) and dissociation (kd) rate constants and the equilibrium dissociation constant (KD).
(190) Mass Spectrometric Determination of Light Chain Specificity and CDR Grafted IgG Assembly:
(191) Proteins will be purified on an Agilent 1100 HPLC using a protein G (PG) ID sensor cartridge (Life Technologies). Purified samples will be analyzed on an Agilent 6210 time-of-flight liquid chromatography/mass spectrometry (LC/MS) system molecular weight analyzer. Theoretical mass-averaged molecular weights of the light chain and heavy chain components will be determined using the GPMaw program (v. 8.20). For the light chain competition experiments, the relative counts of the ionized light chains hitting the detector will be used to quantify the ratio of designed versus WT light chain bound to a designed or WT heavy chain.
(192) Fab Protein Crystallization:
(193) Fab proteins will be produced by proteolytic cleavage of the full-length IgGs using papain. Pritumumab Fab (with Cλ) crystal screening will be performed at 16 mg/ml protein. The crystals (thin microcrystalline plates) should appear after 4 days in 100 mM sodium acetate pH 4.6/30% PEG MME 2K/200 mM ammonium sulfate. Crystals will be cryo-protected in reservoir solution with PEG MME 2K. Concentration will be increased by 10% and supplemented with 20% glycerol. Improved order within the variable domains will be achieved by generating crystal in the same conditions, plus 10% MPD at 12.4 mg/ml protein. The pritumumab Fab containing the CDR will be crystallized using 15 mg/ml protein.
(194) Structure Determination:
(195) X-ray diffraction data will be collected under standard cryogenic conditions at the Advanced Photon Source (Argonne National Laboratory) using the LRL-CAT beamline and reduced to structure factor amplitudes using MOSFLM, SCALA and TRUNCATE. All structures will be solved using PHASER, refined using REFMAC, and visualized and rebuilt using XTALVIEW/XFIT. Structures of subsequent design mutants (CRD1 and an intermediate of CRD2) will be solved by Phaser using this parent structure as a search model. The parent Fab of pritumumab will be solved using the known structure of pritumumab and the variable domains of the antibody. The stereochemical quality of the atomic model will be monitored using an automated quality control procedure.
(196) Phage Display Library:
(197) By using optimized procedures that are based on the classical oligonucleotide-directed mutagenesis method of Kunkel et al., very large phage-displayed antibody repertoires (>10.sup.10 members) can be constructed quite rapidly. Importantly, the method is scalable and can be used to mutate up to four independent regions concurrently with very high efficiency. First, a dut−/ung− E. coli host will be used to propagate phage encapsulating uracil-containing ssDNA (dU-ssDNA) template to which mutagenic oligonucleotides are annealed. “Stop templates” contain stop codons in the CDRs and ensure that only mutated antibodies are displayed, as the parental stop template will fail to express a full-length Fab-Pritumumab fusion protein. Residual template clones are therefore eliminated from the phage pools during selections. Diversity within a Fab library can be designed by using mutagenic oligonucleotides that contain mixed bases at particular positions to produce sets of degenerate codons. Alternatively, finer control of codon usage can be achieved by using oligonucleotides synthesized from sets of trinucleotides. By choosing particular codons for specific amino acids, we biased the CDR amino acids to those that are commonly found in natural antibodies or are particularly well suited for antigen recognition. Annealed mutagenic oligonucleotides to the ssDNA template will serve to prime synthesis of a complementary DNA strand forming a synthetic daughter strand lacking uracil. A ligase then fuses the synthesized DNA fragments to from covalently closed circular double-stranded heteroduplex DNA (CCC-dsDNA). The heteroduplex DNA will then be electroporated into a highly competent strain of dut+/ung+ E. coli, SS320, where the synthesized strand is preferentially amplified compared to the template strand.
(198) Transformation into an E. coli host results in phagemid replication as a double-stranded plasmid. Upon coinfection with helper phage, single-stranded DNA (ssDNA) replication is initiated and phagemid ssDNA is packaged into phage particles containing phagemid-encoded protein, thereby providing physical linkage between the phenotype of the Fab and the encoding phagemid genotype. Helper phage, such as M13KO7, provides all proteins necessary for assembly of phage particles with some phagemid encoded fusion protein incorporated. These phage particles produced by infected cells make up both the genetic barcode and interaction readout of the Fab library as the host E. coli cells are never introduced to antigens during selections.
(199) While specific aspects have been described and illustrated, such aspects should be considered illustrative only and not as limiting in accordance with the accompanying claims.
(200) All publications and patent applications cited in this specification are herein incorporated by reference in their entirety for all purposes as if each individual publication or patent application were specifically and individually indicated to be incorporated by reference for all purposes.
(201) Although the foregoing compositions and methods has been described in some detail by way of illustration and example for purposes of clarity of understanding, it will be readily apparent to one of ordinary skill in the art in light of the teachings herein that certain changes and modifications can be made thereto without departing from the spirit or scope of the appended claims.