TLX and MIR-219 as potential therapeutic targets for neurodevelopmental disorders
11013753 · 2021-05-25
Assignee
Inventors
Cpc classification
A61K31/7105
HUMAN NECESSITIES
C12N5/06
CHEMISTRY; METALLURGY
A61P25/18
HUMAN NECESSITIES
C12N2310/113
CHEMISTRY; METALLURGY
C07K14/70567
CHEMISTRY; METALLURGY
C12N15/113
CHEMISTRY; METALLURGY
International classification
C12N15/115
CHEMISTRY; METALLURGY
A61P25/18
HUMAN NECESSITIES
C12N15/113
CHEMISTRY; METALLURGY
A61K31/7105
HUMAN NECESSITIES
Abstract
Disclosed herein are methods of treating neurodevelopmental disorders such as schizophrenia (SCZ), bipolar disorder or depression. The methods entail inhibiting expression of miR-219 or overexpressing TLX thereby promoting proliferation of neural stem cells (NSCs) in the subjects.
Claims
1. A method of correcting a defective rate of proliferation in a population of neural stem cells (NSCs) comprising: contacting the population of NSCs with an effective amount of an miR-219 specific inhibitor, wherein the miR-219 specific inhibitor causes an increase in NSC proliferation rate.
2. The method of claim 1, wherein contact of the population of NSCs with the miR-219 specific inhibitor takes place in vitro or in vivo.
3. The method of claim 2, wherein the population of NSCs is derived from a subject suffering from schizophrenia, bipolar disorder, or depression.
4. The method of claim 1, wherein the miR-219 specific inhibitor is a tough decoy RNA, an RNAi molecule, an aptamer, an miR-219-5p hairpin inhibitor, or TuD-miR-219.
5. The method of claim 1, further comprising contacting the population of NSCs with an effective amount of an agent to increase expression or activity of TX, wherein the agent is a vector expressing a gene encoding TLX.
6. A method of treating a neurodevelopmental disorder in a subject comprising: administering a therapeutically effective dose of a pharmaceutical composition to the subject, the pharmaceutical composition comprising an miR-219 specific inhibitor, wherein the miR-219 specific inhibitor maintains normal NSC proliferation in the subject.
7. The method of claim 6, wherein the subject is suffering from schizophrenia, bipolar disorder, or depression.
8. The method of claim 6, wherein the miR-219 specific inhibitor is a tough decoy RNA, an RNAi molecule, an aptamer, an miR-219-5p hairpin inhibitor, or TuD-miR-219.
9. The method of claim 6, wherein the pharmaceutical composition further comprises an agent to increase expression or activity of TLX, wherein the agent is a vector expressing a gene encoding TLX.
10. The method of claim 6, further comprising administering a therapeutically effective dose of a second pharmaceutical composition to the subject, the pharmaceutical composition comprising an agent to increase expression or activity of TLX, wherein the agent is a vector expressing a gene encoding TLX.
11. The method of claim 6, wherein administration of the pharmaceutical composition is an oral, intravenous, intrathecal, or intracranial route of administration.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
DETAILED DESCRIPTION
(17) The following description of the invention is merely intended to illustrate various embodiments of the invention. As such, the specific modifications discussed are not to be construed as limitations on the scope of the invention. It will be apparent to one skilled in the art that various equivalents, changes, and modifications may be made without departing from the scope of the invention, and it is understood that such equivalent embodiments are to be included herein.
(18) In one embodiment, a method of correcting a defective rate of proliferation in a population of neural stem cells (NSCs) is provided. This embodiment may include a step of contacting the population of NSCs with an effective amount of an miR-219 inhibitor, an agent to increase expression or activity of TLX, or both.
(19) The miR-219 inhibitor used in the embodiments described herein may be any suitable agent that inhibits the expression or activity of miR-219 including, but not limited to, a tough decoy RNA, an RNAi molecule (e.g., shRNA, siRNA, or any other RNA interference molecule), or an aptamer. In certain embodiments, the miR-219 inhibitor is an miR-219-5p hairpin inhibitor (Dharmacon) or TuD-miR-219 (a tough decoy RNA). TuD-miR-219 has the following sequence (SEQ ID NO:35):
(20) TABLE-US-00001 5′ GAC GGC GCT AGG ATC ATC AAC CTC GAG CGC TAG CAA GTA TTC TGG TCA CAG AAT ACA ACG TCG ACC ACT AGT CAA GAT GAT CCT AGC GCC GTC TTT TTT 3′
(21) The agent to increase expression or activity of TLX may be any suitable agent including, but not limited to, an agent to chemically modify TLX or a vector expressing a gene encoding TLX. In certain embodiments, the vector expressing TLX may be a plasmid or any suitable recombinant viral vector capable of delivering a nucleotide sequence that is expressed in a cell including, but not limited to, a lentiviral vector, an adenoviral vector, an AAV vector, or any other suitable recombinant viral vector. The vectors described herein may be designed to include the nucleotide sequence of TLX, reproduced below:
(22) TABLE-US-00002 Human NR2E1 (TLX) nucleotide sequence (SEQ ID NO: 36): ATGAGCAAGCCAGCCGGATCAACAAGCCGCATTTTAGATATCCCCTGCA AAGTGTGTGGCGACCGCAGCTCGGGGAAGCACTACGGGGTCTACGCCT GCGACGGCTGCTCAGGTTTTTTCAAACGGAGCATCCGAAGGAATAGGAC CTATGTCTGCAAATCTGGAAACCAGGGAGGCTGTCCGGTGGACAAGACG CACAGAAACCAGTGCAGGGCGTGTCGGCTGAAGAAGTGTTTGGAAGTCA ACATGAACAAAGACGCCGTGCAGCACGAGCGGGGGCCTCGGACGTCCA CCATCCGCAAGCAAGTGGCCCTCTACTTCCGTGGACACAAGGAGGAGAA CGGGGCCGCCGCGCACTTTCCCTCGGCGGCGCTCCCTGCGCCGGCCTT CTTCACCGCGGTCACGCAGCTGGAGCCGCACGGCCTGGAGCTGGCCGC GGTGTCCACCACTCCAGAGCGGCAGACCCTCGTGAGCCTGGCTCAGCC CACGCCCAAGTACCCCCATGAAGTGAATGGGACCCCAATGTATCTCTAT GAAGTGGCCACGGAGTCGGTGTGTGAATCAGCTGCCAGACTTCTCTTCA TGAGCATCAAGTGGGCTAAGAGTGTGCCAGCCTTCTCCACGCTGTCTTT GCAAGACCAGCTGATGCTTTTGGAAGATGCTTGGAGAGAACTGTTTGTTC TAGGAATAGCACAATGGGCCATTCCGGTTGATGCTAACACTCTACTGGCT GTATCTGGCATGAACGGTGACAACACAGATTCCCAGAAGCTGAACAAGA TCATATCTGAAATACAGGCTTTACAAGAGGTGGTGGCTCGATTTAGACAA CTCCGGTTAGATGCTACTGAATTTGCCTGTCTAAAATGCATCGTCACTTT CAAAGCCGTTCCTACACATAGTGGTTCTGAACTGAGAAGTTTCCGGAATG CTGCCGCCATTGCAGCCCTTCAAGATGAGGCTCAGCTAACGCTCAACAG CTACATCCATACCAGATATCCCACTCAACCCTGTCGCTTTGGAAAACTCC TGTTGCTTTTGCCAGCTTTACGTTCTATTAGCCCATCAACTATAGAAGAA GTGTTTTTCAAAAAAACCATCGGCAATGTGCCAATTACAAGACTGCTTTC AGATATGTACAAATCCAGTGATATCTAA
(23) When delivered to a target cell such as a neural stem cell using the vector, the nucleotide sequence above is translated to express the TLX protein, the amino acid sequence of which is shown below:
(24) TABLE-US-00003 Human NR2E1 (TLX) amino acid sequence (SEQ ID NO: 37): MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTY VCKSGNQGGCPVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIR KQVALYFRGHKEENGAAAHFPSAALPAPAFFTAVTQLEPHGLELAAVSTT PERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLLFMSIKWA KSVPAFSTLSLQDQLMLLEDAWRELFVLGIAQWAIPVDANTLLAVSGMNG DNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTH SGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPAL RSISPSTIEEVFFKKTIGNVPITRLLSDMYKSSDI
(25) In another embodiment, a portion of TLX may be used as the agent to increase expression or activity of TLX, such as the Dpi domain of TLX. The Dpi domain may be expressed by the vector or delivered to the population of NSCs. The nucleotide and amino acid sequences of Dpi are shown below:
(26) TABLE-US-00004 Human TLX DPI nucleotide coding sequence (1021 to 1077 nt) (SEQ ID NO: 38): GGAAAACTCCTGTTGCTTTTGCCAGCTTTACGTTCTATTAGCCCATCAA CTATAGAA Human TLX DPI amino acid sequence (341 aa to 359 aa) (SEQ ID NO: 39): GKLLLLLPALRSISPSTIE
(27) The mir-219 inhibitor, the agent to increase expression or activity of TLX, or both may be used to contact the population of NSCs in vitro. In this case, the population of in vitro cells are derived from a subject suffering from a neurodevelopmental disorder such as schizophrenia, bipolar disorder, or depression.
(28) Alternatively, the agent to increase expression or activity of TLX, or both may be used to contact the population of NSCs in vivo. In this case, the population of in vivo cells are present in the nervous system of a subject suffering from schizophrenia, bipolar disorder, or depression.
(29) As discussed in the examples below, the mir-219 inhibitor, the agent to increase expression or activity of TLX, or both causes an increase in NSC proliferation rate, and can therefore be used in methods for treating neurodevelopmental disorders that are associated with having a defective proliferation rate of NSCs, such as schizophrenia, bipolar disorder, or depression. The mir-219 inhibitor, the agent to increase expression or activity of TLX may be used separately or in combination to increase proliferation of NSCs in a subject suffering from one of these disorders.
(30) The terms “treat,” “treating,” or “treatment” as used herein with regards to a condition refers to preventing the condition, slowing the onset or rate of development of the condition, reducing the risk of developing the condition, preventing or delaying the development of symptoms associated with the condition, reducing or ending symptoms associated with the condition, generating a complete or partial regression of the condition, or some combination thereof. In some embodiments, treating a condition means that the condition is cured without recurrence.
(31) The phrase “a therapeutically effective amount,” “therapeutically effective dose” or “an effective amount” as used herein refers to an amount of an agent, including a nucleic acid, a peptide, or a chemical compound, or a composition that produces a desired therapeutic effect. The precise therapeutically effective amount is an amount of the agent or composition that will yield the most effective results in terms of efficacy in a given subject. This amount will vary depending upon a variety of factors, including but not limited to the characteristics of the agent or composition (including activity, pharmacokinetics, pharmacodynamics, and bioavailability), the physiological condition of the subject (including age, sex, disease type and stage, general physical condition, responsiveness to a given dosage, and type of medication), the nature of the pharmaceutically acceptable carrier or carriers in the formulation, and the route of administration. One skilled in the clinical and pharmacological arts will be able to determine a therapeutically effective amount through routine experimentation, namely by monitoring a subject's response to administration of an agent, population of cells, or composition and adjusting the dosage accordingly. For additional guidance, see Remington: The Science and Practice of Pharmacy (Gennaro ed. 20.sup.th edition, Williams & Wilkins PA, USA) (2000).
(32) It is within the purview of one of ordinary skill in the art to select a suitable route of administration of the pharmaceutical compositions disclosed herein. For example, these pharmaceutical compositions can be administered by oral administration including sublingual and buccal administration, and parenteral administration including intravenous administration, intramuscular administration, and subcutaneous administration. In certain embodiments the pharmaceutical composition is administered through an intrathecal or intracranial route of administration.
(33) Also disclosed herein are methods of treating a neurodevelopmental disorder in a subject. The subject may be suffering from schizophrenia, bipolar disorder, or depression. According to the embodiments described herein, the methods may include administering a therapeutically effective dose of a pharmaceutical composition to the subject. In certain embodiments, the pharmaceutical composition may include (i) an agent to increase expression or activity of TLX, (ii) an miR-219 inhibitor, or both (i) and (ii). As disclosed herein, increasing expression or activity of TLX may maintain normal NSC proliferation in the subject. In certain embodiments, the agent may be a vector expressing a gene encoding TLX. In embodiments where the pharmaceutical composition comprises an agent to increase expression or activity of TLX, the pharmaceutical composition may further comprise an miR-219 inhibitor. In embodiments where the pharmaceutical composition comprises an miR-219 inhibitor, the pharmaceutical composition may further comprise an agent to increase expression or activity of TLX. In other embodiments where the pharmaceutical composition comprises an agent to increase expression or activity of TLX, the methods may further include administering a therapeutically effective dose of a second pharmaceutical composition to the subject, the pharmaceutical composition comprising an miR-219 inhibitor. In other embodiments where the pharmaceutical composition comprises an miR-219 inhibitor, the methods may further include administering a therapeutically effective dose of a second pharmaceutical composition to the subject, the pharmaceutical composition comprising an agent to increase expression or activity of TLX. As disclosed herein, the miR-219 inhibitor may be a tough decoy RNA, an RNAi molecule, or an aptamer. In certain embodiments, the miR-219 inhibitor may be an miR-219-5p hairpin inhibitor or TuD-miR-219.
(34) Expression of miR-219 may also be used as a biomarker to detect schizophrenia, bipolar disorder, or depression. In certain embodiments, the miR-219 may be detected in exosomes or cerebrospinal fluid (CSF).
(35) In this disclosure, a role for miR-219 in the regulation of mammalian NSC proliferation and differentiation is demonstrated, and TLX is identified as an upstream regulator of miR-219. Moreover, p68, Drosha and DGCR8 are identified as novel TLX-interacting molecules, and an unexpected role for TLX in regulating miRNA processing at the post-transcriptional level is uncovered. Furthermore, miR-219 expression is up-regulated, whereas TLX expression is down-regulated in SCZ NSCs. Overexpression of TLX or an miR-219 inhibitor is able to rescue the proliferative defects in SCZ NSCs.
(36) In this disclosure, it has been demonstrated that TLX regulates miRNA processing independent of its well-characterized role in transcriptional regulation, and that miR-219 acts downstream of TLX to regulate NSC proliferation and differentiation in mammalian brains. Moreover, miR-219 expression is elevated, whereas TLX expression is reduced, in DISC1-mutant SCZ patient iPSC-derived NSCs. Overexpression of TLX or inhibition of miR-219 could rescue the reduced cell proliferation in DISC1-mutant SCZ NSCs.
(37) Disclosed herein is an unexpected role for TLX in miRNA maturation at the post-transcriptional level beyond transcriptional regulation. In an unbiased search for TLX-interacting proteins, the RNA helicase p68, a component of the miRNA processing machinery, was identified as a novel TLX-interacting protein. Further study revealed that TLX also interacts with p68-associated Drosha and DGCR8, the two main components of miRNA processing machinery. It is shown in this disclosure that TLX inhibits miR-219 processing by interacting with the p68/Drosha/DGCR8 complex, which in turn prevents the miRNA processing machinery from binding to miR-219 primary form. Either knockdown of TLX or blocking the interaction between TLX and the miRNA processing machinery resulted in potent induction of pre-miR-219 and mature miR-219 expression, but had minimal effect on pri-miR-219 expression. The concept that a transcription factor like TLX can participate in post-transcriptional regulation of gene expression may serve as a general paradigm for many of these classes of cellular factors to control cell fate determination.
(38) Robust inhibition of cell proliferation and induction of neuronal differentiation were detected when miR-219 was overexpressed in NSCs. However, no obvious change in cell proliferation and differentiation was observed in NSCs treated with miR-219 inhibitor, presumably because the basal miR-219 expression level is low in NSCs. In TLX siRNA-treated NSCs, where miR-219 expression level was elevated, inhibition of miR-219 was able to rescue the proliferative defect and precocious differentiation. It is also possible that the action of other miRNAs, such as miR-9, miR-124, miR-137, miR-338, or let-7, could compensate for miR-219 inhibition in NSCs. miR-219 has been shown to induce oligodendrocyte differentiation in electroporated mouse brains that were harvested at E17.5 [27]. However, the induction of oligodendrocyte marker expression in miR-219-electroporated mouse brains harvested at E15.5 was not detected, presumably because brains were harvested at an earlier stage that is active for neurogenesis but not for gliogenesis yet. It is possible that miR-219 could play distinct roles at different developmental stages.
(39) miR-219 is dysregulated in neurodevelopmental disorders, including SCZ, bipolar disorder and depression [29,32,42,43]. Understanding the regulation of miR-219 expression in mammalian brains will not only broaden the knowledge about neurodevelopment, but also provide insights into the pathogenesis of neurological disorders. It is shown in this disclosure that TLX represses miR-219 biogenesis in NSCs during mouse brain development. PDGFRα was also identified as a downstream target of the TLX-miR-219 cascade in NSCs. PDGFRα has been shown to be expressed in oligodendrocyte progenitor cells [44] and play a role in oligodendrocyte differentiation downstream of miR-219 [26]. It is shown in this disclosure that knockdown of PDGFRα expression induced NSC phenotypes similar to that induced by miR-219 overexpression, whereas overexpression of PDGFRα restored NSC phenotypes induced by miR-219 overexpression or TLX siRNA treatment.
(40) DISC1 is required for mouse NSC proliferation [40]. However, little is known about its function in human NSCs. In this disclosure, DISC1 has been found to play a role in regulating human NSC proliferation by studying NSCs derived from D/SCI-mutant SCZ patient iPSCs and genetically engineering isogenic iPSCs with an introduced DISC1 mutation. The observation that miR-219 expression is up-regulated, whereas TLX expression is down-regulated, in D/SCI-mutant NSCs provides a direct link between TLX and miR-219 expression and DISC1 function. Previous studies have shown that TLX KO mice exhibit neuroanatomical and behavioral abnormalities similar to that in D/SCI-mutant mice and SCZ patients, including increased lateral ventricles, reduced cerebral cortex, reduced neurogenesis and memory, and increased anxiety and hyperactivity [2,3,6,7,45-56]. The finding of altered expression of TLX in DISC1-mutant NSCs suggests that mutant DISC1 could regulate TLX expression, which in turn induces abnormal miR-219 expression and inhibition of NSC proliferation.
(41) SCZ is a neurodevelopmental disorder for which the pathological mechanism remains elusive. Increasing evidence suggests that miRNAs may play important roles in the etiology of SCZ [57]. miRNA-219 is highly up-regulated in the prefrontal cortex of SCZ patients [29,32] and mediates the behavioral effects of the NMDA receptor antagonist Dizocilpine [58]. However, whether miR-219 plays a role in SCZ pathogenesis remained unknown. This disclosure has identified a novel role for miR-219 in SCZ NSCs; elevated miR-219 expression reduces SCZ NSC proliferation.
(42) Multiple studies provide evidence that NSC proliferation and neurogenesis are tightly linked to SCZ pathogenesis [39,59,60]. Recent studies using patient iPSCs have identified phenotypic differences in human iPSC-derived neural progenitor cells [61] and provided insights into how risk factors for SCZ regulate NSC phenotypes and neurodevelopment [62]. In this disclosure, a direct link between DISC1 mutation and altered TLX and miR-219 expression, and a causative link between dysregulated TLX and miR-219 expression and proliferative defects in DISC1-mutant SCZ NSCs are identified. Disclosed herein is a molecular mechanism underlying defective NSC proliferation in SCZ. Moreover, both TLX and miR-219 could be potential therapeutic targets for SCZ and that TLX inducers or miR-219 inhibitors may serve as potential therapeutic tools to maintain normal NSC proliferation in SCZ patients.
(43) The working examples below further illustrate various embodiments of this disclosure. By no means the working examples limit the scope of this invention.
EXAMPLE 1
(44) Materials and Methods
(45) Animals. Female ICR or Swiss Webster mice at gestation 13.5 were used for in utero electroportion experiments. All mice were produced in the Animal Resource Core of City of Hope. All animal-related work was performed under the IACUC protocol 03038 approved by City of Hope Institutional Animal Care and Use Committee. Mice were maintained in a 12 hr light:12 hr dark light cycle at 4 mice per cage.
(46) Antibodies and immunostaining. Antibodies were used to Flag epitope tag M2 (Sigma, F2426 for IP), HA (1:500, Santa Cruz, sc-805), p68 (1:1000, Abcam, ab10261), Drosha (1:1000, cell signaling, #3364), DGCR8 (1:500, Protein Tech Group, Inc, 10996-1-AP), BrdU (1:5000, Accurate, OBT0030CX), DCX (1:300, Santa Cruz, sc-8806) and Ki67 (1:200, GeneTex, GTX16667). Immunostaining of embryonic mouse brains was performed using antibodies for DCX and Ki67. For Ki67 staining, antigen retrieval was performed by incubating slides in sodium citrate buffer (10 mM sodium citrate, pH 6.0 and 0.1% Triton X) at 80° C. for 10 min before staining.
(47) Mouse NSC culture. Embryonic mouse NSCs were prepared using an established protocol [63] as follows. E14.5 mouse brains were dissociated by gentle pipetting. The dissociated cells were seeded on polyornithine- and fibronectin-coated plates and cultured in N2 medium (DMEM F12, 25 μg per ml insulin, 100 ng per ml apo-transferrin, 30 nM sodium selenite, 20 nM progesterone and 100 μM putrescine) supplemented with 10 ng per ml FGF2. Cells were maintained as mycoplasm-free culture as revealed by routine mycoplasm screen using MycoAlert Mycoplasma Detection Kit. For differentiation, NSCs were dissociated into single cells and cultured in N2 medium supplemented with 0.5% fetal bovine serum and 10 μM Forskolin for 5 days. For BrdU labeling, 10 μM BrdU was added to NSCs and pulsed for 30 min. Cells were then fixed and acid treated, followed by immunostaining with anti-BrdU antibody. Transfection of NSCs with reporter plasmid DNA, miRNA or siRNA was performed using TransFectin (BioRad), following manufacturer's instructions. For actinomycin D treatment, control or TLX siRNA-transduced NSCs were treated with 1 μM actinomycin D for 3 hr, followed by cell harvesting and RNA isolation.
(48) Plasmid DNAs. pCK-Flag-Drosha [64] and pCK-Flag-DGCR8 [64] were gifts from Dr. V. N. Kim. To prepare the PDGFRα 3′ UTR reporter construct, DNA fragments containing mouse PDGFRα 3′ UTR were subcloned into psiCHECK vector (Promega). The miR-219-5P target site 5′-GACAATCA-3′ (SEQ ID NO: 40) in PDGFRα 3′ UTR was mutated into 5′-GATCGTCA-3′ (SEQ ID NO: 41) by site-directed mutagenesis. The cDNA of mouse PDGFRα was purchased from ATCC and subcloned into pEF-pUb-RFP vector [4]. To make TLX siRNA or scrambled control RNA-expressing lentiviral vector, DNA fragments containing TLX siRNA or scrambled control siRNA hairpin sequences were subcloned into pHIV-GFP vector [65]. To prepare the Dpi peptide or control peptide-expressing vector, DNA fragment containing the Dpi (amino acid residues 341-359) (SEQ ID NO: 42) or control peptide (amino acid residues 201-223) (SEQ ID NO: 43) of TLX was fused in frame to three copies of nuclear localization signals and cloned into the CMX-HA or CSC-GFP vector [3]. To make miR-219-expressing retroviral vector, DNA oligos of miR-219 were annealed and cloned into the UEG vector [66]. To prepare the construct of TuD-miR-219, DNA oligos of TuD-miR-219, 5′-TCG AAG AAT TGC GTT CTG ATG GAC AAT CA-3′ (SEQ ID NO: 44) and 5′-CTA GTG ATT GTC CAT CAG AAC GCA ATT CT-3′ (SEQ ID NO: 45) were annealed and cloned into the U6-TuD vector. The DNA fragment containing the U6 promoter and TuD-miR-219 was then subcloned into pHIV-GFP vector or CMVLV lentiviral vector containing a puromycin-resistant gene [65]. To prepare miR-219-Glo vector, 392 bp fragment of pri-miR-219 including the pre-miR-219 hairpin loop was PCR amplified using the following primers: 5′-TTC ATA GAG CTC ACA CCG GCT TGT CCA CCT TAC-3′ (SEQ ID NO: 46) and 5′-TTC ATA CTC GAG GAG GAT ACG GAA AGA GGC GAG-3′ (SEQ ID NO: 47). The PCR product was digested with SacI and XhoI site and cloned into the pmirGLO vector (Promega). To prepare miR-1224-Glo vector, 398 bp fragment of pri-miR-1224 was PCR amplified using the following primers: 5′-GAT AGC TAG CAA TGG CAA CTC CAA GCG TGC T-3′ (SEQ ID NO: 48) and 5′-ATG AGG CCG AGG TGG GGC TGA GTC TAG AGA TC-3′ (SEQ ID NO: 49). The PCR product was digested with Nhel and Xbal and cloned into the pmirGLO vector (Promega).
(49) siRNAs and miRNAs. All synthetic siRNAs, miRNAs and their controls were purchased from Dharmacon. The ON-TARGET plus siRNA for TLX (J-065577-12-0005) and non-targeting control siRNA (D-001810-01-05) were used for the experiments of TLX knockdown; the ON-TARGET plus SMARTpool siRNA for PDGFRα (L-048730-00-0005) and control siRNA pool (D-001810-10-05) were used for the experiments of PDGFRα knockdown. The miRIDIAN miRNA mimic for miR-219-5p (c-310578-05-0005), negative control (CN-001000-01-05), and miR-219-5p hairpin inhibitor (IH-310578-07-0005) were used for overexpressing miR-219 or inhibiting miR-219 action in mouse NSCs.
(50) Northern blot analysis and RT-PCR. Total RNAs from tissue cultured cells or 6 to 8-week-old WT or TLX KO mouse brains were isolated using TRizol (Invitrogen) in accordance with manufacturer's instructions. Oligonucleotides complementary to miRNA sequences were end-labeled with y.sup.32P-ATP and used as probes for Northern blot analysis. The sequences for the probes are listed in
(51) In vivo monitoring of pri-miRNA processing. The miR-219-Glo, miR-1224-Glo or control-Glo (pmirGLO, Promega) vector was transfected together with TLX-expressing vector or TLX siRNA-expressing vector. The firefly luciferase activity was measured 48 hr after transfection and normalized with the Renilla luciferase internal control. The results were then normalized with the luciferase activity in cells transfected with the control vector(s).
(52) Nuclear extract preparation and immunoprecipitation. To make stable HeLa cell line that express HA or HA-TLX, HeLa cells were transduced with lentivirus expressing HA or HA-TLX and a GFP reporter, and plated the transduced cells at 1 cell per well in a 96-well plate. The GFP-positive clones derived from single GFP-positive cells were expanded to make stable cell lines. The expression of HA-TLX in cells transduced with the HA-TLX-expressing virus was confirmed by TLX Western blot analysis. Nuclear extracts were prepared from the stable cell line expressing HA or HA-TLX following a published method [67]. Every ml of nuclear extract was pre-cleared using 20 μl of protein G and 20 μl of IgG-AC (Santa Cruz, sc-2345) for 5 hr, and then incubated with HA beads (Santa Cruz, sc-805 AC) at 4° C. for overnight. Proteins pulled down by the HA beads were collected at 8,200 g for 1 min, then washed with 500 μl TBS for 20 min twice, and re-suspended in protein loading buffer for protein gel electrophoresis and subsequent mass spectrometry analysis.
(53) Mass spectrometry. Proteins were separated on a 4-12% Bis-Tris NuPAGE gel with MES running buffer (Novex, life technology) and stained with SimplyBlue SafeStain solution (Life Technology) to visualize the differentially expressed proteins. Corresponding protein gel bands were excised and destained in ammonium bicarbonate (100 mM)/acetonitrile (45%) followed by in-gel processing, which included reduction with tris(carboxyethyl) phosphine (10 mM), alkylation with iodoacetamide (50 mM), and digestion with sequencing grade trypsin (300 ng per band, Promega); all steps were performed in 100 mM ammonium bicarbonate, pH 7.9. Extracted peptides were acidified with formic acid (1%) and injected straightly into the liquid chromatography (LC) mass spectrometry (MS) system, consisting of a binary pump Agilent 1200 HPLC, a 6520 quadrupole time-of-flight mass spectrometer (Agilent), equipped with a chip cube ion source, utilizing a high capacity LC/MS chip (Agilent) with a 150 mm×75 μm Zorbax 300SB-C18 on-board analytical reverse phase column and a 160 nl trapping column. 10 μl sized peptide samples were loaded at 4 μl per min. LC was performed with a gradient mobile phase system containing buffer A (0.1% aqueous formic acid) and B (100% acetonitrile, 0.1% formic acid). A 50-minute gradient elution from the analytical column was conducted from 7 to 85% buffer B at 300 nl per min. MS and tandem MS analysis of peptide ions with z>2.sup.+ was performed in data-dependent mode. Automated collision energy settings were set by the acquisition software, MassHunter (Agilent). The resulting data was analyzed using the GPM X! Tandem search engine (The Global Proteome Machine Organization) with the human protein database and Scaffold (Proteome Software) at a 1% false discovery rate setting.
(54) Immunoprecipitation and Western blotting. Cells were lysed with lysis buffer containing 50 mM Tris-HCl, pH 7.8, 150 mM NaCl, 1% NP40, 0.1% deoxycholate and protease inhibitor cocktails (Roche). For DNase and RNase treatment, cell lysates were treated with 40 U per ml DNase and 10 μg per ml RNase at 37° C. for 30 min. Lysates were immunoprecipitated using anti-Flag (Sigma, F2426) or anti-HA (Santa Cruz, sc-805 AC) antibodies. For co-immunoprecipitation of endogenous proteins, E13.5 mouse brains were homogenized in the above lysis buffer. Lysates were immunoprecipitated using TLX antibody, followed by immunoblotting using indicated antibodies. To determine whether Dpi disrupts the TLX-Drosha interaction, constructs expressing Dpi (TLX residues 341-359) or a control peptide (TLX residues 201-223), together with HA-TLX and Flag-Drosha were transfected into HEK293T cells. Cell lysates were immunoprecipitated with Flag antibody (Sigma, F2426), followed by immunoblotting with anti-HA (1:500, Santa Cruz, sc-805) or anti-Flag antibody (1:500, Sigma, F1804). Images in
(55) RNA immunoprecipitation (RIP). RIP was performed under native condition [68]. NSCs were transduced with lentivirus expressing TLX siRNA or scrambled control RNA. Cell pellets were resuspended in ice cold lysis buffer containing 100 mM KCl, 5 mM MgCl.sub.2, 10 mM HEPES (pH 7.0), 0.5% NP40, 1 mM DTT, 100 U per ml RNase Inhibitor (Promega), and protease inhibitor cocktail (Roche), and lysates were passed through a 27.5 gauge needle 4 times to promote nuclear lysis. Eighty units of DNase (Ambion) was added to the lysates, which were then incubated on ice for 30 min. Cell lysates were diluted in NT2 buffer (50 mM Tris-HCl, pH 7.4, 150 mM NaCl, 1 mM MgCl.sub.2, 0.05% NP40, 1 mM DTT, RNase Inhibitor and protease inhibitor cocktail) and pre-cleared with protein G agarose. One tenth volume of supernatant was saved as input. The rest of the supernatant was incubated with 5 μg of antibodies at 4° C. for overnight. After incubating with protein G agarose, the RNA-antibody complex was precipitated and washed with NT2 buffer 4 times. RNA was extracted using Trizol (Invitrogen) according to manufacturer's instructions. Reverse transcription was performed using Tetro cDNA synthesis kit (Bioline), followed by PCR reaction.
(56) In utero electroporation. A solution including 100 μM miRNA, siRNA or miRNA inhibitor with 5 μg per μl plasmid DNA expressing RFP only or RFP and PDGFRO was electroporated into E13.5 wild type ICR mouse brains. Both male and female mice were used. For electroporation of the Dpi peptide-expressing vector, plasmids expressing Dpi and RFP or Dpi, RFP and TuD-miR-219, at 2.5 μg per μl each, were electroporated into E13.5 mouse brains. Two days later, the electroporated brains were dissected and sectioned at 20 μm thickness, followed by immunostaining.
(57) Human iPSC culture and differentiation. Human iPSCs were maintained and cultured in Essential 8 (E8) medium (Gibco, A15169-01). For NSC differentiation, iPSCs were detached using 0.5 mM EDTA and cultured in E8 medium for 6 days in suspension for embroid body (EB) formation, then switched to neuronal induction medium (50% DMEM/F12, 50% Neurobasal, 0.5×N2, 0.5×B27, 2 mM L-Glutamine, 0.1 mM NEAA, and 100 units penicillin/streptomycin) supplemented with 5 μM SB431542 and 0.25 μM LDN for 3 days. The EB spheres were transferred into matrigel-coated plates and cultured in neuronal induction medium for 7 days. Rosette structures were mechanically lifted and cultured in neuronal induction medium supplemented with basic FGF (5 ng per ml) and EGF (20 ng per ml) for expansion. Neurospheres were stained for NSC markers using antibodies for SOX1 (1:500, Millipore, AB15766) and NESTIN (1:1000, BD, 611659). All the cells used in this study were maintained as mycoplasm-free culture as revealed by routine mycoplasm screen using MycoAlert Mycoplasma Detection Kit.
(58) Human NSC proliferation and differentiation. Human iPSC-derived NSCs were seeded on matrigel coated 24-well plates in proliferation media and cultured for 24 hr. Lentivirus expressing miR-219 or TuD-miR-219 and a GFP reporter was added to human NSCs in 24-well plates for 16 hr. The virus-transduced cells were labeled by GFP. For proliferation assay, cells were allowed to recover for 2 days and then treated with 10 μM BrdU for 1 hr, followed by immunostaining for BrdU and SOX1. Nuclei were counter-stained using DAPI. NSC proliferation rate was determined using the percentage of BrdU+SOX1+ cells, which was calculated as BrdU+SOX1+/DAPI+ cells for non-virus-transduced cells and BrdU+SOX1+GFP+/GFP+ cells for GFP-expressing virus-transduced cells. For differentiation, NSCs were switched to differentiation medium containing N2 and B27 (1:1) with 1 μM retinoic acid and 0.5% FBS in DMEM F12 media. Cells were allowed to differentiate for 2 weeks, followed by immunostaining for Tuj1. The neuronal differentiation rate was determined using the percentage of Tuj1+ cells, which was calculated as Tuj1+/DAPI+ cells for non-virus-transduced cells and Tuj1+GFP+/GFP+ cells for GFP-expressing virus-transduced cells.
(59) Statistical analysis. Student's t-test and ANOVA were used for statistical analyses for comparison of experimental results as reported in each figure and legend. All results were expressed as mean±s.d. The sample size was chosen based on our preliminary studies. Statistical significance was defined as p<0.05, p<0.01 or p<0.001 as specified in the figure legend. No samples, mice or data points were excluded from the reported analyses. No randomization was used for sample assignment and data collection, and no blinding was performed.
EXAMPLE 2
(60) TLX Represses miR-219 Processing
(61) When comparing gene expression in wild type (WT) and TLX knockout (KO) mouse brains, dramatically elevated expression of miR-219 were detected in TLX KO brains (
(62) The expression levels were determined for the precursor form of miR-219 (pre-miR-219) in TLX KO brains. The level of pre-miR-219 increased substantially in TLX KO brains, compared to WT brains, similar to the change in mature miR-219 level, whereas no dramatic change was observed in pri-miR-219 level (
(63) To confirm that TLX plays a role in miR-219 processing, a luciferase-based processing assay was performed. HEK293T cells were transfected with a luciferase reporter construct containing pri-miR-219 sequences that include the Drosha/DGCR8 binding sites. The pri-miR-219 sequences were placed between the coding region of the luciferase gene and its polyadenylation signal. Cleavage of polyadenylation tails from the luciferase transcripts by Drosha/DGCR8 would induce degradation of the luciferase transcripts and reduce luciferase activity (
EXAMPLE 3
(64) TLX Interacts with the miRNA Processing Machinery
(65) In a parallel effort, novel TLX-interacting proteins were identified. Nuclear extracts of HA-TLX-expressing HeLa cells were immunoprecipitated with an HA antibody. Proteins specifically pulled down in HA-TLX-expressing cells, but not in control cells, were subjected to mass spectrometry analysis to determine their identity (
(66) To confirm the interaction of TLX with p68, HEK293T cells were transfected with HA-TLX. p68 was detected in the HA-TLX immunocomplex and the interaction was not affected by the treatment with DNase and RNase (
(67) To confirm the interaction of endogenous TLX with Drosha/DGCR8, E13.5 mouse brains were harvested, where TLX is highly expressed [4]. Brain lysates were immunoprecipitated with a TLX-specific antibody. Both Drosha and DGCR8 were detected in the TLX immunocomplex (
(68) The interaction of TLX with Drosha and DGCR8 led us to hypothesize that TLX could inhibit miR-219 processing by preventing the miRNA processing machinery from binding to pri-miR-219. Cell lysates were made from NSCs transduced with lentivirus expressing TLX siRNA and performed RNA immunoprecipitation to determine if knockdown of TLX would affect the binding of Drosha and DGCR8 to pri-miR-219 (
EXAMPLE 4
(69) miR-219 Inhibits Mammalian NSC Proliferation
(70) Because TLX plays an important role in regulating mammalian NSC proliferation and differentiation [3,4], the observation that TLX regulates miR-219 processing in mouse NSCs led to a hypothesis that miR-219 could be involved in regulating mammalian NSC phenotypes. To test whether miR-219 affects mammalian NSC proliferation, NSCs were isolated from E14.5 mouse brains and treated with the miR-219 RNA duplex. BrdU labeling was performed to monitor cell proliferation. Treatment with miR-219 reduced cell proliferation substantially (
(71) To determine the effect of miR-219 on NSC regulation in vivo, miR-219 RNA duplex was electroporated together with an RFP-expressing vector into NSCs of E13.5 embryonic brains in uterus. The brains were dissected at E15.5 and analyzed by immunohistochemistry. Immunostaining with Ki67, a proliferation marker, revealed that overexpression of miR-219 decreased cell proliferation in the ventricular zone and subventricular zone (VZ/SVZ) of mouse brains, where NSCs reside (
EXAMPLE 5
(72) miR-219 Acts Downstream of TLX to Regulate NSC Phenotypes
(73) To confirm that miR-219 acts downstream of TLX in NSCs, the effect of TLX knockdown on NSC proliferation and differentiation was tested to see if they could be rescued by an miRNA hairpin inhibitor that is designed specifically to inhibit miR-219 action by interfering with miR-219 binding to downstream targets. When TLX siRNA was electroporated into the VZ/SVZ of E13.5 mouse brains, the percentage of RFP+Ki67+ cells was decreased dramatically, compared to that in control RNA-electroporated brains. However, when TLX siRNA and the miR-219 inhibitor RNA were co-electroporated, the percentage of RFP+Ki67+ cells was recovered substantially (
EXAMPLE 6
(74) PDGFRα is a Target Gene of miR-219 and TLX in NSCs
(75) To uncover mechanisms underlying miR-219-mediated regulation of NSC phenotypes, potential miR-219 target genes were identified using TargetScan, which revealed a set of candidate miR-219 targets, the 3′ UTR of which can base pair with miR-219. Among the candidate targets, PDGFRα is a confirmed miR-219 target [26] and is expressed in NSCs [34]. RT-PCR showed that the expression of PDGFRα was dramatically decreased in TLX KO brains (
(76) Moreover, the expression of PDGFRα, similar to TLX, was relatively high in NSCs but low in neurons, whereas the expression of miR-219 was relatively low in NSCs but increased in neurons, inversely correlating to the expression of PDGFRα and TLX (
(77) Whether overexpressing miR-219 or knockdown of TLX regulates PDGFRα expression was tested next. Repression of PDGFRα expression was detected in miR-219-transfected NSCs and TLX siRNA-transfected NSCs, respectively (
(78) How PDGFRα regulates NSC proliferation and differentiation in vivo was studied. In utero electroporation of PDGFRα siRNA into E13.5 mouse brains reduced NSC proliferation as shown by decreased Ki67+RFP+ cells in the VZ/SVZ, whereas the number of RFP+ cells migrated to the CP was increased (
(79) Because the expression of PDGFRα was reduced in TLX knockdown NSCs (
EXAMPLE 7
(80) A TLX Peptide Promotes miR-219 Processing
(81) To determine the region in TLX that is critical for the interaction with the miRNA processing machinery, the minimal domain of TLX was mapped for p68 and Drosha interactions by serial deletion (
(82) To determine whether the Dpi domain interferes with the TLX-Drosha interaction, an HA-tagged TLX peptide containing the Dpi domain (Dpi) was co-expressed with HA-tagged full-length TLX (HA-TLX) and Flag-Drosha in HEK293T cells. The interaction of TLX with Drosha, as determined by co-immunoprecipitation, was substantially reduced when Dpi was co-expressed, compared to that when an empty vector (−) or a control peptide (C) was expressed (
(83) To determine if the interaction between TLX and the miRNA processing machinery is critical for regulation of miR-219 processing by TLX, Dpi was used to block the interaction of TLX with the miRNA processing machinery and miR-219-Glo, a luciferase reporter containing the pri-miR-219 sequence in its 3′ UTR to monitor miR-219 processing. Co-transfection of TLX with Dpi reduced the luciferase activity substantially, compared to transfection with TLX alone (
(84) The Dpi peptide was electroporated into NSCs and determined miR-219 processing by evaluating the levels of the three forms of miR-219, pri-miR-219, pre-miR-219 and mature miR-219. The levels of both pre-miR-219 and mature miR-219 forms increased considerably, whereas no significant change was detected in the level of pri-miR-219 (
(85) Whether expressing Dpi could affect NSC proliferation and differentiation was tested. NSCs from E14.5 mouse brains were transduced with lentivirus expressing Dpi or a control peptide and a GFP reporter. Compared to the control peptide, expression of Dpi reduced cell proliferation substantially (
(86) To determine the effect of Dpi on NSC proliferation and differentiation in vivo, a vector expressing a control peptide or Dpi was electroporated together with an RFP reporter into E13.5 mouse brains in uterus. Expression of Dpi decreased Ki67+RFP+ cells in the VZ/SVZ, compared to expression of the control peptide. Co-electroporating Dpi with TuD-miR-219 rescued the reduced cell proliferation induced by Dpi (
EXAMPLE 8
(87) Elevated miR-219 Expression Inhibits SCZ NSC Proliferation
(88) Elevated expression of miR-219 has been observed in various brain regions of SCZ patients [29,30,32]. Whether miR-219 expression is altered in SCZ NSCs was tested by obtaining induced pluripotent stem cells (iPSCs) derived from SCZ patients (D1 & D2,
(89) RT-PCR revealed that the level of miR-219 increased substantially in DISC1-mutant SCZ NSCs, compared to WT control NSCs (
(90) Reduced NSC proliferation has been observed in post-mortem brain specimens from SCZ patients [39] and DISC1 has been shown to regulate NSC proliferation in the developing mouse cortex [40,41]. However, whether DISC1 regulates cell proliferation in human NSCs and whether mutant DISC1 induces abnormal NSC proliferation remained unknown. The results showing that mutant DISC1 induces elevated expression of miR-219 in SCZ NSCs led to a hypothesis that increased expression of miR-219 induced by mutant DISC1 could result in abnormal cell proliferation in SCZ NSCs. To test this hypothesis, cell proliferation in WT and DISC1-mutant SCZ NSCs was compared by BrdU and SOX1 double labeling. The percentage of BrdU+SOX1+ cells was significantly reduced in DISC1-mutant SCZ NSCs, compared to that in WT control NSCs (
(91) To determine if elevated miR-219 expression is sufficient to reduce cell proliferation in human NSCs, miR-219 was overexpressed in WT NSCs using an miR-219-expressing retroviral vector and NSC proliferation was determined by BrdU and SOX1 double labeling. Reduced cell proliferation was observed in miR-219-overexpressing WT NSCs compared to control vector-expressing WT NSCs, in a manner similar to the reduced cell proliferation observed in DISC1-mutant NSCs when compared to WT NSCs (
(92) To determine if the proliferative defect in DISC1-mutant NSCs indeed resulted from abnormally elevated miR-219 expression, miR-219 in D/SCI-mutant NSCs was inhibited using TuD-miR-219. NSC proliferation was monitored by BrdU and SOX1 double labeling. Treating the DISC1-mutant NSCs (D1, D2, C1M and C3M) with TuD-miR-219 increased the proliferative rate in these cells substantially, largely rescuing the proliferative defects of the DISC1-mutant NSCs (
(93) In addition to elevated miR-219 expression in D/SCI-mutant SCZ NSCs, reduced expression of TLX in D/SCI-mutant SCZ NSCs was also detected (
(94) All publications and patent documents cited herein are incorporated by reference.
REFERENCES
(95) 1 Yu, R. T., McKeown, M., Evans, R. M., and Umesono, K. Relationship between Drosophila gap gene tailless and a vertebrate nuclear receptor Tlx. Nature 370, 375-379 (1994). 2 Monaghan, A. P., Bock, D., Gass, P., Schwager, A., Wolfer, D. P., Lipp, H. P., and Schutz, G. Defective limbic system in mice lacking the tailless gene. Nature 390, 515-517 (1997). 3 Shi, Y., Lie, C. D., Taupin, P., Nakashima, K., Ray, J., Yu, R. T., Gage, F. H., and Evans, R. M. Expression and function of orphan nuclear receptor TLX in adult neural stem cells. Nature 427, 78-83 (2004). 4 Li, W., Sun, G., Yang, S., Qu, Q., Nakashima, K., and Shi, Y. Nuclear Receptor TLX Regulates Cell Cycle Progression in Neural Stem Cells of the Developing Brain. Mol Endocrinol 22, 56-64 (2008). 5 Qu, Q., Sun, G., Li, W., Yang, S., Ye, P., Zhao, C., Yu, R. T., Gage, F. H., Evans, R. M., and Shi, Y. Orphan nuclear receptor TLX activates Wnt/beta-catenin signalling to stimulate neural stem cell proliferation and self-renewal. Nat Cell Biol 12, 31-40; sup pp 31-39 (2010). 6 Zhang, C. L., Zou, Y., He, W., Gage, F. H., and Evans, R. M. A role for adult TLX-positive neural stem cells in learning and behaviour. Nature 451, 1004-1007 (2008). 7 Murai, K., Qu, Q., Sun, G., Ye, P., Li, W., Asuelime, G., Sun, E., Tsai, G. E., and Shi, Y. Nuclear receptor TLX stimulates hippocampal neurogenesis and enhances learning and memory in a transgenic mouse model. Proc Natl Acad Sci USA 111, 9115-9120 (2014). 8 Roy, K., Kuznicki, K., Wu, Q., Sun, Z., Bock, D., Schutz, G., Vranich, N., and Monaghan, A. P. The Tlx gene regulates the timing of neurogenesis in the cortex. J Neurosci 24, 8333-8345 (2004). 9 Stenman, J. M., Wang, B., and Campbell, K. Tlx controls proliferation and patterning of lateral telencephalic progenitor domains. J Neurosci 23, 10568-10576 (2003). 10 Zhao, C., Sun, G., Li, S., Lang, M., Yang, S., Li, W., and Shi, Y. microRNA let-7b regulates neural stem cell proliferation and differentiation by targeting nuclear receptor TLX signaling. Proc Natl Acad Sci USA 107, 1876-1881 (2010). 11 Sun, G., Yu, R. T., Evans, R. M., and Shi, Y. Orphan nuclear receptor TLX recruits histone deacetylases to repress transcription and regulate neural stem cell proliferation. Proc Natl Acad Sci USA 104, 15282-15287 (2007). 12 Sun, G., Alzayady, K., Stewart, R., Ye, P., Yang, S., Li, W., and Shi, Y. Histone demethylase LSD1 regulates neural stem cell proliferation. Mol Cell Biol 30, 1997-2005 (2010). 13 Yokoyama, A., Takezawa, S., Schule, R., Kitagawa, H., and Kato, S. Transrepressive function of TLX requires the histone demethylase LSD1. Mol Cell Biol 28, 3995-4003 (2008). 14 Zhao, C., Sun, G., Li, S., and Shi, Y. A feedback regulatory loop involving microRNA-9 and nuclear receptor TLX in neural stem cell fate determination. Nature Struct Mol Biol 16, 365-371 (2009). 15 Iwahara, N., Hisahara, S., Hayashi, T., and Florio, Y. Transcriptional activation of NAD+-dependent protein deacetylase SIRT1 by nuclear receptor TLX. Biochem Biophys Res Commun 386, 671-675 (2009). 16 Elmi, M., Matsumoto, Y., Zeng, Z. J., Lakshminarasimhan, P., Yang, W., Uemura, A., Nishikawa, S., Moshiri, A., Tajima, N., Agren, H., and Funa, K. TLX activates MASH1 for induction of neuronal lineage commitment of adult hippocampal neuroprogenitors. Mol Cell Neurosci 45, 121-131 (2010). 17 Bartel, D. P. MicroRNAs: genomics, biogenesis, mechanism, and function. Cell 116, 281-297 (2004). 18 Fukuda, T., Yamagata, K., Fujiyama, S., Matsumoto, T., Koshida, I., Yoshimura, K., Mihara, M., Naitou, M., Endoh, H., Nakamura, T., Akimoto, C., Yamamoto, Y., Katagiri, T., Foulds, C., Takezawa, S., Kitagawa, H., Takeyama, K., O'Malley, B. W., and Kato, S. DEAD-box RNA helicase subunits of the Drosha complex are required for processing of rRNA and a subset of microRNAs. Nat Cell Biol 9, 604-611 (2007). 19 Gregory, R. I., Yan, K. P., Amuthan, G., Chendrimada, T., Doratotaj, B., Cooch, N., and Shiekhattar, R. The Microprocessor complex mediates the genesis of microRNAs. Nature 432, 235-240 (2004). 20 Fuller-Pace, F. V. and Ali, S. The DEAD box RNA helicases p68 (Ddx5) and p72 (Ddx17): novel transcriptional co-regulators. Biochem Soc Trans 36, 609-612 (2008). 21 Davis, B. N., Hilyard, A. C., Lagna, G., and Hata, A. SMAD proteins control DROSHA-mediated microRNA maturation. Nature 454, 56-61 (2008). 22 Suzuki, H. I., Yamagata, K., Sugimoto, K., Iwamoto, T., Kato, S., and Miyazono, K. Modulation of microRNA processing by p53. Nature 460, 529-533 (2009). 23 Kawai, S. and Amano, A. BRCA1 regulates microRNA biogenesis via the DROSHA microprocessor complex. J Cell Bio! 197, 201-208 (2012). 24 Cheng, H. Y., Papp, J. W., Varlamova, O., Dziema, H., Russell, B., Curfman, J. P., Nakazawa, T., Shimizu, K., Okamura, H., Impey, S., and Obrietan, K. microRNA modulation of circadian-clock period and entrainment. Neuron 54, 813-829 (2007). 25 Lukiw, W. J. Micro-RNA speciation in fetal, adult and Alzheimer's disease hippocampus. Neuroreport 18, 297-300 (2007). 26 Dugas, J. C., Cuellar, T. L., Scholze, A., Ason, B., Ibrahim, A., Emery, B., Zamanian, J. L., Foo, L. C., McManus, M. T., and Barres, B. A. Dicerl and miR-219 Are required for normal oligodendrocyte differentiation and myelination. Neuron 65, 597-611 (2010). 27 Zhao, X., He, X., Han, X., Yu, Y., Ye, F., Chen, Y., Hoang, T., Xu, X., Mi, Q. S., Xin, M., Wang, F., Appel, B., and Lu, Q. R. MicroRNA-mediated control of oligodendrocyte differentiation. Neuron 65, 612-626 (2010). 28 Hudish, L. I., Blasky, A. J., and Appel, B. miR-219 regulates neural precursor differentiation by direct inhibition of apical par polarity proteins. Dev Cell 27, 387-398 (2013). 29 Beveridge, N. J., Gardiner, E., Carroll, A. P., Tooney, P. A., and Cairns, M. J. Schizophrenia is associated with an increase in cortical microRNA biogenesis. Mol Psychiatry 15, 1176-1189 (2010). 30 Beveridge, N. J., Tooney, P. A., Carroll, A. P., Gardiner, E., Bowden, N., Scott, R. J., Tran, N., Dedova, I., and Cairns, M. J. Dysregulation of miRNA 181b in the temporal cortex in schizophrenia. Hum Mol Genet 17, 1156-1168 (2008). 31 Santarelli, D. M., Beveridge, N. J., Tooney, P. A., and Cairns, M. J. Upregulation of dicer and microRNA expression in the dorsolateral prefrontal cortex Brodmann area 46 in schizophrenia. Biol Psychiatry 69, 180-187 (2011). 32 Smalheiser, N. R., Lugli, G., Zhang, H., Rizavi, H., Cook, E. H., and Dwivedi, Y. Expression of microRNAs and other small RNAs in prefrontal cortex in schizophrenia, bipolar disorder and depressed subjects. PLoS One 9, e86469 (2014). 33 Berezikov, E., Chung, W. J., Willis, J., Cuppen, E., and Lai, E. C. Mammalian mirtron genes. Mol. Cell 28, 328-336 (2007). 34 Jackson, E. L., Garcia-Verdugo, J. M., Gil-Perotin, S., Roy, M., Quinones-Hinojosa, A., VandenBerg, S., and Alvarez-Buylla, A. PDGFR alpha-positive B cells are neural stem cells in the adult SVZ that form glioma-like growths in response to increased PDGF signaling. Neuron 51, 187-199 (2006). 35 Haraguchi, T., Ozaki, Y., and Iba, H. Vectors expressing efficient RNA decoys achieve the long-term suppression of specific microRNA activity in mammalian cells. Nucleic Acids Res 37, e43 (2009). 36 Sachs, N. A., Sawa, A., Holmes, S. E., Ross, C. A., DeLisi, L. E., and Margolis, R. L. A frameshift mutation in Disrupted in Schizophrenia 1 in an American family with schizophrenia and schizoaffective disorder. Mol Psychiatry 10, 758-764 (2005). 37 Chiang, C. H., Su, Y., Wen, Z., Yoritomo, N., Ross, C. A., Margolis, R. L., Song, H., and Ming, G. L. Integration-free induced pluripotent stem cells derived from schizophrenia patients with a DISC1 mutation. Mol Psychiatry 16, 358-360 (2011). 38 Wen, Z., Nguyen, H. N., Guo, Z., Lalli, M. A., Wang, X., Su, Y., Kim, N. S., Yoon, K. J., Shin, J., Zhang, C., Makri, G., Nauen, D., Yu, H., Guzman, E., Chiang, C. H., Yoritomo, N., Kaibuchi, K., Zou, J., Christian, K. M., Cheng, L., Ross, C. A., Margolis, R. L., Chen, G., Kosik, K. S., Song, H., and Ming, G. L. Synaptic dysregulation in a human iPS cell model of mental disorders. Nature (2014). 39 Reif, A., Fritzen, S., Finger, M., Strobel, A., Lauer, M., Schmitt, A., and Lesch, K. P. Neural stem cell proliferation is decreased in schizophrenia, but not in depression. Mol Psychiatry 11, 514-522 (2006). 40 Mao, Y., Ge, X., Frank, C. L., Madison, J. M., Koehler, A. N., Doud, M. K., Tassa, C., Berry, E. M., Soda, T., Singh, K. K., Biechele, T., Petryshen, T. L., Moon, R. T., Haggarty, S. J., and Tsai, L. H. Disrupted in schizophrenia 1 regulates neuronal progenitor proliferation via modulation of GSK3beta/beta-catenin signaling. Cell 136, 1017-1031 (2009). 41 Ishizuka, K., Kamiya, A., Oh, E. C., Kanki, H., Seshadri, S., Robinson, J. F., Murdoch, H., Dunlop, A. J., Kubo, K., Furukori, K., Huang, B., Zeledon, M., Hayashi-Takagi, A., Okano, H., Nakajima, K., Houslay, M. D., Katsanis, N., and Sawa, A. DISC1-dependent switch from progenitor proliferation to migration in the developing cortex. Nature 473, 92-96 (2011). 42 Sarachana, T., Zhou, R., Chen, G., Manji, H. K., and Hu, V. W. Investigation of post-transcriptional gene regulatory networks associated with autism spectrum disorders by microRNA expression profiling of lymphoblastoid cell lines. Genome Med 2, 23 (2010). 43 Saus, E., Soria, V., Escaramis, G., Vivarelli, F., Crespo, J. M., Kagerbauer, B., Menchon, J. M., Urretavizcaya, M., Gratacos, M., and Estivill, X. Genetic variants and abnormal processing of pre-miR-182, a circadian clock modulator, in major depression patients with late insomnia. Hum Mol Genet 19, 4017-4025 (2010). 44 Rivers, L. E., Young, K. M., Rizzi, M., Jamen, F., Psachoulia, K., Wade, A., Kessaris, N., and Richardson, W. D. PDGFRA/NG2 glia generate myelinating oligodendrocytes and piriform projection neurons in adult mice. Nat Neurosci 11, 1392-1401 (2008). 45 Goldberg, J. F. and Chengappa, K. N. Identifying and treating cognitive impairment in bipolar disorder. Bipolar Disord 11 Suppl 2, 123-137 (2009). 46 Swayze, V. W., 2nd, Andreasen, N. C., Alliger, R. J., Ehrhardt, J. C., and Yuh, W. T. Structural brain abnormalities in bipolar affective disorder. Ventricular enlargement and focal signal hyperintensities. Arch Gen Psychiatry 47, 1054-1059 (1990). 47 Young, K. A., Berry, M. L., Mahaffey, C. L., Saionz, J. R., Hawes, N. L., Chang, B., Zheng, Q. Y., Smith, R. S., Bronson, R. T., Nelson, R. J., and Simpson, E. M. Fierce: a new mouse deletion of Nr2e1; violent behaviour and ocular abnormalities are background-dependent. Behav Brain Res 132, 145-158 (2002). 48 Clapcote, S. J., Lipina, T. V., Millar, J. K., Mackie, S., Christie, S., Ogawa, F., Lerch, J. P., Trimble, K., Uchiyama, M., Sakuraba, Y., Kaneda, H., Shiroishi, T., Houslay, M. D., Henkelman, R. M., Sled, J. G., Gondo, Y., Porteous, D. J., and Roder, J. C. Behavioral phenotypes of Disc1 missense mutations in mice. Neuron 54, 387-402 (2007). 49 Hikida, T., Jaaro-Peled, H., Seshadri, S., Oishi, K., Hookway, C., Kong, S., Wu, D., Xue, R., Andrade, M., Tankou, S., Mori, S., Gallagher, M., Ishizuka, K., Pletnikov, M., Kida, S., and Sawa, A. Dominant-negative DISC1 transgenic mice display schizophrenia-associated phenotypes detected by measures translatable to humans. Proc Natl Acad Sci USA 104, 14501-14506 (2007). 50 Koike, H., Arguello, P. A., Kvajo, M., Karayiorgou, M., and Gogos, J. A. Disc1 is mutated in the 12956/SvEv strain and modulates working memory in mice. Proc Natl Acad Sci USA 103, 3693-3697 (2006). 51 Kvajo, M., McKellar, H., Arguello, P. A., Drew, L. J., Moore, H., MacDermott, A. B., Karayiorgou, M., and Gogos, J. A. A mutation in mouse Disc1 that models a schizophrenia risk allele leads to specific alterations in neuronal architecture and cognition. Proc Natl Acad Sci USA 105, 7076-7081 (2008). 52 Li, W., Zhou, Y., Jentsch, J. D., Brown, R. A., Tian, X., Ehninger, D., Hennah, W., Peltonen, L., Lonnqvist, J., Huttunen, M. O., Kaprio, J., Trachtenberg, J. T., Silva, A. J., and Cannon, T. D. Specific developmental disruption of disrupted-in-schizophrenia-1 function results in schizophrenia-related phenotypes in mice. Proc Natl Acad Sci USA 104, 18280-18285 (2007). 53 Niwa, M., Kamiya, A., Murai, R., Kubo, K., Gruber, A. J., Tomita, K., Lu, L., Tomisato, S., Jaaro-Peled, H., Seshadri, S., Hiyama, H., Huang, B., Kohda, K., Noda, Y., O'Donnell, P., Nakajima, K., Sawa, A., and Nabeshima, T. Knockdown of DISC1 by in utero gene transfer disturbs postnatal dopaminergic maturation in the frontal cortex and leads to adult behavioral deficits. Neuron 65, 480-489 (2010). 54 Pletnikov, M. V., Ayhan, Y., Xu, Y., Nikolskaia, O., Ovanesov, M., Huang, H., Mori, S., Moran, T. H., and Ross, C. A. Enlargement of the lateral ventricles in mutant DISC1 transgenic mice. Mol Psychiatry 13, 115 (2008). 55 Shen, S., Lang, B., Nakamoto, C., Zhang, F., Pu, J., Kuan, S. L., Chatzi, C., He, S., Mackie, I., Brandon, N. J., Marquis, K. L., Day, M., Hurko, O., McCaig, C. D., Riedel, G., and St Clair, D. Schizophrenia-related neural and behavioral phenotypes in transgenic mice expressing truncated Disc1. J Neurosci 28, 10893-10904 (2008). 56 Ellison-Wright, I., Glahn, D. C., Laird, A. R., Thelen, S. M., and Bullmore, E. The anatomy of first-episode and chronic schizophrenia: an anatomical likelihood estimation meta-analysis. Am J Psychiatry 165, 1015-1023 (2008). 57 Olde Loohuis, N. F., Kos, A., Martens, G. J., Van Bokhoven, H., Nadif Kasri, N., and Aschrafi, A. MicroRNA networks direct neuronal development and plasticity. Cell Mol Life Sci 69, 89-102 (2012). 58 Kocerha, J., Faghihi, M. A., Lopez-Toledano, M. A., Huang, J., Ramsey, A. J., Caron, M. G., Sales, N., Willoughby, D., Elmen, J., Hansen, H. F., Orum, H., Kauppinen, S., Kenny, P. J., and Wahlestedt, C. MicroRNA-219 modulates NMDA receptor-mediated neurobehavioral dysfunction. Proc Natl Acad Sci USA 106, 3507-3512 (2009). 59 Flagstad, P., Mork, A., Glenthoj, B. Y., van Beek, J., Michael-Titus, A. T., and Didriksen, M. Disruption of neurogenesis on gestational day 17 in the rat causes behavioral changes relevant to positive and negative schizophrenia symptoms and alters amphetamine-induced dopamine release in nucleus accumbens. Neuropsychopharmacology 29, 2052-2064 (2004). 60 Newton, S. S. and Duman, R. S. Neurogenic actions of atypical antipsychotic drugs and therapeutic implications. CNS Drugs 21, 715-725 (2007). 61 Brennand, K., Savas, J. N., Kim, Y., Tran, N., Simone, A., Hashimoto-Torii, K., Beaumont, K. G., Kim, H. J., Topol, A., Ladran, I., Abdelrahim, M., Matikainen-Ankney, B., Chao, S. H., Mrksich, M., Rakic, P., Fang, G., Zhang, B., Yates, J. R., 3rd, and Gage, F. H. Phenotypic differences in hiPSC NPCs derived from patients with schizophrenia. Mol Psychiatry 20, 361-368 (2014). 62 Yoon, K. J., Nguyen, H. N., Ursini, G., Zhang, F., Kim, N. S., Wen, Z., Makri, G., Nauen, D., Shin, J. H., Park, Y., Chung, R., Pekle, E., Zhang, C., Towe, M., Hussaini, S. M., Lee, Y., Rujescu, D., St Clair, D., Kleinman, J. E., Hyde, T. M., Krauss, G., Christian, K. M., Rapoport, J. L., Weinberger, D. R., Song, H., and Ming, G. L. Modeling a genetic risk for schizophrenia in iPSCs and mice reveals neural stem cell deficits associated with adherens junctions and polarity. Cell Stem Cell 15, 79-91 (2014). 63 Sun, G., Ye, P., Murai, K., Lang, M. F., Li, S., Zhang, H., Li, W., Fu, C., Yin, J., Wang, A., Ma, X., and Shi, Y. miR-137 forms a regulatory loop with nuclear receptor TLX and LSD1 in neural stem cells. Nat Commun 2, 529 (2011). 64 Lee, Y., Ahn, C., Han, J., Choi, H., Kim, J., Yim, J., Lee, J., Provost, P., Radmark, O., Kim, S., and Kim, V. N. The nuclear RNase III Drosha initiates microRNA processing. Nature 425, 415-419 (2003). 65 Sun, G., Yeh, S. Y., Yuan, C. W., Chiu, M. J., Yung, B. S., and Yen, Y. Molecular Properties, Functional Mechanisms, and Applications of Sliced siRNA. Mol Ther Nucleic Acids 4, e221 (2015). 66 Kim, J. Y., Duan, X., Liu, C. Y., Jang, M. H., Guo, J. U., Pow-anpongkul, N., Kang, E., Song, H., and Ming, G. L. DISC1 regulates new neuron development in the adult brain via modulation of AKT-mTOR signaling through KIAA1212. Neuron 63, 761-773 (2009). 67 Abmayr, S. M., Yao, T., Parmely, T., and Workman, J. L. Preparation of nuclear and cytoplasmic extracts from mammalian cells. Curr Protoc Pharmacol Chapter 12, Unit12 13 (2006). 68 Keene, J. D., Komisarow, J. M., and Friedersdorf, M. B. RIP-Chip: the isolation and identification of mRNAs, microRNAs and protein components of ribonucleoprotein complexes from cell extracts. Nat Protoc 1, 302-307 (2006).