Liquid-liquid Phase Separation Driven Protein-based Underwater Adhesive Coatings

Abstract

Liquid-liquid phase separation (LLPS) driven protein-based underwater adhesive coatings are made from a dimeric protein comprising a marine adhesive protein (MAP) domain and a liquid-liquid phase separation-mediating low complexity (LC) domain.

Claims

1. A liquid-liquid phase separation (LLPS) composition comprising a dimeric protein comprising a marine adhesive protein (MAP) domain and an LLPS-mediating low complexity (LC) domain

2. The composition of claim 1, wherein the domains are linked in a fusion protein.

3. The composition of claim 1, wherein the domains are linked through affinity tags on the domains.

4. The composition of claim 1, wherein the marine adhesive protein (MAP) comprises a polypeptide selected from: mussel foot proteins (mfp5, mfp3, mfp3s); barnacle proteins (cp19k, cp20k, and cp68k barnacle surface adhesive proteins); and sandcastle worm adhesive proteins (Pc2 and Pc3); and the low complexity (LC) domain comprises a polypeptide selected from: LC domain TAR DNA-binding protein 43 (TDP-43) (263-414); RNA binding protein Fused in Sarcoma (FUS) (2-214); Heterogeneous nuclear ribonucleoprotein A1 (hnRNPA1) (186-320); Heterogeneous nuclear ribonucleoprotein A2 (hnRNPA2) (181-341); Cytotoxic granule-associated RNA binding protein TIA1 (280-375); Cytoplasmic polyadenylation element binding protein 2 (CPEB2) (2-137); Fragile X mental retardation protein (FMRP) (466-632); Cold inducible RNA binding protein (CIRBP) (1-172); RNA binding motif (RNP1, RRM) protein 3 (RBM3) (1-157); and Yeast Sup35 (2-134).

5. The composition of claim 2, wherein the marine adhesive protein (MAP) comprises a polypeptide selected from: mussel foot proteins (mfp5, mfp3, mfp3s); barnacle proteins (cp19k, cp20k, and cp68k barnacle surface adhesive proteins); and sandcastle worm adhesive proteins (Pc2 and Pc3); and the low complexity (LC) domain comprises a polypeptide selected from: LC domain TAR DNA-binding protein 43 (TDP-43) (263-414); RNA binding protein Fused in Sarcoma (FUS) (2-214); Heterogeneous nuclear ribonucleoprotein A1 (hnRNPA1) (186-320); Heterogeneous nuclear ribonucleoprotein A2 (hnRNPA2) (181-341); Cytotoxic granule-associated RNA binding protein TIA1 (280-375); Cytoplasmic polyadenylation element binding protein 2 (CPEB2) (2-137); Fragile X mental retardation protein (FMRP) (466-632); Cold inducible RNA binding protein (CIRBP) (1-172); RNA binding motif (RNP1, RRM) protein 3 (RBM3) (1-157); and Yeast Sup35 (2-134).

6. The composition of claim 3, wherein the marine adhesive protein (MAP) comprises a polypeptide selected from: mussel foot proteins (mfp5, mfp3, mfp3s); barnacle proteins (cp19k, cp20k, and cp68k barnacle surface adhesive proteins); and sandcastle worm adhesive proteins (Pc2 and Pc3); and the low complexity (LC) domain comprises a polypeptide selected from: LC domain TAR DNA-binding protein 43 (TDP-43) (263-414); RNA binding protein Fused in Sarcoma (FUS) (2-214); Heterogeneous nuclear ribonucleoprotein A1 (hnRNPA1) (186-320); Heterogeneous nuclear ribonucleoprotein A2 (hnRNPA2) (181-341); Cytotoxic granule-associated RNA binding protein TIA1 (280-375); Cytoplasmic polyadenylation element binding protein 2 (CPEB2) (2-137); Fragile X mental retardation protein (FMRP) (466-632); Cold inducible RNA binding protein (CIRBP) (1-172); RNA binding motif (RNP1, RRM) protein 3 (RBM3) (1-157); and Yeast Sup35 (2-134).

7. The composition of claim 1, wherein the protein is selected from GFP-FUS LC-mfp5, mfp5-FUS LC, mfp3-TDP LC, mCherry-FUS LC-mfp3 and Spytag-FUS LC: mfp5-spycatcher

8. The composition of claim 1, configured as a coating.

9. The composition of claim 1 configured as a coating submerged underwater.

10. The composition of claim 1, configured as a coating submerged underwater, and providing underwater adhesion energy at least 2-3 times that of a coating of a corresponding MAP.

11. The composition of claim 2, configured as a coating submerged underwater, and providing underwater adhesion energy at least 2-3 times that of a coating of a corresponding MAP.

12. The composition of claim 5, configured as a coating submerged underwater, and providing underwater adhesion energy at least 2-3 times that of a coating of a corresponding MAP.

13. The composition of claim 1, configured as a coating providing underwater adhesion energy greater than 30 or 40 mJ m.sup.−2.

14. The composition of claim 1, configured as a coating micropatterned on a substrate.

15. The composition of claim 2, configured as a coating micropatterned on a substrate.

16. The composition of claim 5, configured as a coating micropatterned on a substrate.

17. The composition of claim 1 configured as a coating micropatterned on a substrate selected from flexible and interior substrate surfaces.

18. The composition of claim 1 configured as a coating micropatterned on an interior substrate surface selected from a microfluidic channel and microtubule.

19. A method of making the composition of claim 1 comprising incubating the dimeric protein under conditions wherein LLPS occurs, forming the composition, wherein the compositions is optionally micropatterned on a substrate, such as by mask-assisted patterning or soft lithography.

20. A method of using the composition of claim 1 comprising adhering two surfaces with the composition.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0021] FIGS. 1A-D. A combinatorial and modular protein domain strategy for engineering liquid-liquid phase separation-induced self-assembling underwater adhesives. (A) Schematic of the adhesive protein mfp5 that functions in the adhesion plaques of marine mussels. Mfp5, a mussel adhesion foot protein rich in lysine and Dopa residues, displays a random coil structure in solution and is essential for the interfacial underwater adhesion of mussels. (B) Schematic of the human TAR DNA-binding protein 43 (TDP-43), which along with specific RNAs, forms TDP-43 ribonucleoprotein (RNP) granules that mediate cellular processes in neuron cells. TDP-43 contains both RNA recognition motifs and a low-complexity domain, which is an intrinsically disordered domain enriched in glycine and uncharged polar amino acid residues that can contributes to the self-assembly of RNP granules that is driven by a process termed liquid-liquid phase separation (LLPS). (C) The modular genetic design of adhesive proteins is enabled by rationally fusing sequences encoding the protein domains shown in A and B to form a His-tagged mfp5-TDP-43 LC (“MTLC”) fusion protein. (D) MTLC fusion protein monomers in solution can assemble into condensed liquid-like droplets driven by LLPS (left). The liquid-like droplets tend to spread over and adsorb on surfaces, facilitating a priming process for the MTLC coating (middle left). The liquid-like droplets are locally enriched near the substrate surface, and these droplets have high concentrations of protein monomers, thus promoting formation of proto-fibrils on the substrate (middle right). Additional monomers can then aggregate on these surface-localized proto-fibrils, eventually forming amyloid nanofiber coatings on the surface. The MTLC nanofiber coatings exhibit strong underwater adhesion owing to their high surface area and the adhesive properties of the MTLC mfp5 domains, which are exposed at the surface of the nanofibers, external to the amyloid core.

[0022] FIGS. 2A-G. Morphological and structural characterization of LLPS-induced MTLC adhesive coatings. (A) Photographs of adhesive coatings (top left) produced by incubating MTLC monomer solutions at 4° C. and 25° C. and staining of the corresponding samples with Congo Red (lower left). X-ray fiber diffraction pattern (right) of mfp5-TDP-43 LC nanofibers of two samples showed a typical diffraction pattern of cross-β spine of amyloid nanofibers in which the meridional reflection (d.sub.2) is −4.67 Å (corresponding to the spacing between β-strands within each layer of (3-sheets in the fibril) and the equatorial reflection (d.sub.1) is ˜9.27 Å (corresponding to the inter-sheet packing distances between each layer of (3-sheets in the fibril). (B) Morphological characterization of the hierarchical structure of MTLC coatings formed at 4° C. MTLC coatings were dense nanofiber meshes (TEM image, left) formed from nanofiber bundles that assemble via the lateral stacking of amyloid nanofibers (TEM image, middle). These nanofibers are about 3 nanometers in diameter (AFM image, right). (C) ThT fluorescence curve of MTLC in solutions incubated at 4° C. and 25° C. A ThT fluorescence assay was applied to monitor and quantify the kinetics of amyloid nanofiber formation. (D) Turbidity-time curve of MTLC in solution incubated at 4° C. and 25° C.; measured at OD.sub.600. (E) Photographs of MTLC solutions incubated at 4° C. and 25° C. taken at different time intervals. (F) Differential interference contrast (DIC) microscopy images of phase-separation induced assembly of MTLC protein monomers adsorbed on a glass surface at 4° C. and 25° C. assessed after 1 h, 3 h, and 12 h of incubation. LLPS-driven formation of liquid-like droplets during the first 6 h, followed by the appearance of proto-fibrils in the vicinity of the liquid-like droplets. MTLC monomers then aggregate on the proto-fibrils, eventually producing dense MTLC nanofiber coatings. (G) Frequency change comparison in QCM-D experiments showing the different adsorption capacities of MTLC to a gold surface at 4° C. and 25° C. (top). Plots of AD vs AF (bottom) corresponding to the curve shown at the top. The AD/AF value indicates the stiffness of the coatings: higher AD/AF values suggest softer materials. THT and turbidity data shows means±s.e.m. of three replicate samples.

[0023] FIGS. 3A-E. Underwater adhesion performance of adhesive coatings. (A) Schematic of a colloidal AFM probe used to measure the asymmetric adhesion of adhesive coatings on smooth mica surfaces. (B) Comparison of adhesion forces (normalized force (F/R) and adhesion energies (F.sub.ad=F/3πR)) for MTLC coatings produced at 4° C. and 25° C. (measured with a gold probe tip, R=10 μm). Representative adhesion force-distance curves in the right pan& were collected on one spot of the coated mica surface using the single force mode (gold probe tip). (C) Comparison of adhesion forces and adhesion energies for the TDP-43 LC domain (control), unmodified MTLC, and DOPA-modified. MTLC coatings produced at 4° C. (gold probe tip) (top) and representative adhesion force-distance curves of the control TDP-43 LC, unmodified MTLC, and DOPA-modified MTLC coatings (bottom); the curves correspond to three random spots of the coated mica surface (single force mode; gold probe tip). (D) Frequency change comparison in QCM-D experiments showing the different adsorption capacities of unmodified MTLC and DOPA-modified MTLC coatings for a gold surface at 4° C. Plots of AD vs AF (inserted) corresponding to the frequency change curve. (E) Adhesion forces and adhesion energies for DOPA-modified MTLC coatings produced at a range of pH values (3-11) at 4° C. measured with a gold probe tip. For each comparison in B, C. and E, n=25 (5 spots per mica plate, with each spot sampled 5 times using single three mode). In B and D, the adhesion force curves are plotted as force-displacement curves: the x axis, ZSnsr (Z sensor), represents the displacement between the sample surface and the resting position of the cantilever (rather than the actual distance between the sample surface and the AFM tip).

[0024] FIGS. 4A-E. Applications of liquid-liquid phase separation induced MTLC adhesive coatings. (A) Digital camera images of uncoated polytetrafluoroethylene (TEFLON, “Teflon”) (top left) and Teflon coated with phase separation-induced MTLC adhesives (top right) and red QDs adsorption on uncoated Teflon (bottom left) and LLPS-induced MTLC coated Teflon (bottom right) with inset data from the water contact angle analysis. Images were taken under UV light (254 nm). (B) SEM sectional image of a continuous layer of LLPS-induced MTLC adhesive coating formed on Teflon (top) and corresponding X-ray photoelectron spectroscopy (XPS) showing the distinctive element signals representative of N, O, and C (from protein structures) in the coated Teflon substrate, in contrast with the dominant F and C signals shown in the bare Teflon. (C) UV-illuminated photograph (top), and 3D confocal micrograph (bottom) of a Teflon pipe, showing red QDs adsorbed on the interior walls of the MTLC-coated pipe. (D) Schematic (top), UV-illuminated photograph (middle), and 3D confocal micrograph (bottom) of a microfluidic device with an MTLC-coated channel that was post-treated with red QDs. (E) Schematic illustration showing the repair of damage (scratch) on a Teflon substrate. We co-injected purified MTLC monomers in solution with non-sticky fluorescent spherical polystyrene (PS) micro-spheres around the damage site. Upon incubation at 4° C. for 12 hours, an LLPS-induced MTLC coating formed on the substrate and on the surface of the PS micro-spheres, acting as a glue to aggregate the micro-spheres to each other and with the substrate surface, thereby retaining them in place and thus filling the damage site (right). (E) Photograph (top) and SEM (bottom) images showing the damaged Teflon substrates before and after repair using LLPS-induced coatings. Photograph of the repaired sample taken under UV light (254 nm). A zoomed-in SEM image clearly showing that the micro-spheres were piled up and glued together in the damage site.

[0025] FIGS. 5A-E. (A) Schematic illustration showing the fluidic device made of PDMS covered on a glass slide. (B) 3D images taken by a confocal fluorescent microscopy. (C) In situ photograph taken under UV light. (D) SEM image and (E) SEM sectional image showing the inside walls of channel were coated with protein.

[0026] FIGS. 6A-C. (A) Digital images of red ODs assembled on MTLC coated surfaces. (B) 3D image of micro PE tube. Red QDs assembled on MTLC coated inside wall. (C) Water contact angle measurement of various surfaces with/without MTLC coatings.

[0027] FIGS. 7A-C. (A) QDs assembled on lithography patterns mediated by specific mask plates. (B) QDs assembled on soft lithography patterns. (C) Micro-scale pattern displays an orderly light spot under green laser which indicates long range ordered pattern achieved.

[0028] FIGS. 8A-C. (A) Photograph of MTLC coating (left) and copper deposition (right) on the inside wall of PP Eppendorf tube by electro-less metal deposition. (B) Photographs of porous resin models printed by 3D printer before and after copper deposition. (C) C-V curves of copper deposited 3D model. Inserted images are circuit demo of copper deposited 3D model working as an electrical conductor to light the diode.

DESCRIPTION OF PARTICULAR EMBODIMENTS OF THE INVENTION

[0029] The embodiments and examples herein are provided by way of illustration only and not by way of limitation. Those skilled in the art will readily recognize a variety of noncritical parameters that could be changed or modified to yield essentially similar results.

[0030] It is understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and scope of the appended claims. All publications, patents, and patent applications cited herein are hereby incorporated by reference in their entirety for all purposes.

[0031] The invention provides methods and compositions for making liquid-liquid phase separation (LLPS) driven protein-based underwater adhesive coatings. In an aspect the invention provides a fusion protein comprising a marine adhesive protein (MAP) domain and a liquid-liquid phase separation (LLPS) mediating low complexity (LC) domain.

[0032] MAPs are a well-known and well-studied class of proteins (e.g. Wilker et al, Curr Opin Chem Biol. 2010 April; 14(2):276-83), including recombinant forms modified for functional properties, e.g. Yang et al. Biofouling. 2013; 29(5):483-90. In embodiments the MAP may be truncated, so long as functional amyloid nanofiber formation and adhesive properties are retained.

[0033] Liquid-liquid phase separation (LLPS) mediating low complexity (LC) domains are a well-known and well-studied class of proteins domains, with characterized structure-activity-relationships, e.g Martin et al. Biochemistry. 2018 May 1; 57(17):2478-248; Kato et al., Cell, 2012, 149(4): 753-767; etc. In embodiments the LC may be truncated, so long as LLPS mediation functionality is retained.

[0034] The MAP and LC domains maybe linked domains are linked in a fusion protein or through affinity tags on the domains, which non-covalent, such as HA, myc, FLAG or His6 tags, or covalent, such as spytag, snooptag, isopeptag or dogtag.

[0035] Table A. Exemplary Truncated Functional LLPS-Mediating LC Domains

[0036] TAR DNA-binding protein 43 (TDP-43) (263-414)

TABLE-US-00001 (SEQ ID NO: 01) KHNSNRQLERSGRFGGNPGGFGNQGGFGNSRGGGAGLGNNQGSNMGGGMN FGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQRE PNQAFGSGNNSYSGSNSGAAIGWGSASNAGSGSGFNGGFGSSMDSKSSGW GM

[0037] RNA binding protein Fused in Sarcoma (FUS) (2-214)

TABLE-US-00002 (SEQ ID NO: 02) ASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYG QSSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYG QQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNP PQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSG GGGSGGYGQQDRG

[0038] Heterogeneous nuclear ribonucleoprotein A1 (hnRNPA1) (186-320)

TABLE-US-00003 (SEQ ID NO: 03) MASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGG GYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRS SGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF

[0039] Heterogeneous nuclear ribonucleoprotein A2 (hnRNPA2) (181-341)

TABLE-US-00004 (SEQ ID NO: 04) MQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGD GYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGG GNYGSGNYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSG GSGGYGGRSRY

[0040] Cytotoxic granule-associated RNA binding protein TIA1 (280-375)

TABLE-US-00005 (SEQ ID NO: 051) INPVQQQNQIGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWN QQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ

[0041] Cytoplasmic polyadenylation element binding protein 2 (CPEB2) (2-137)

TABLE-US-00006 (SEQ ID NO: 06) PPPSPDSENGFYPGLPSSMNPAFFPSFSPVSPHGCTGLSVPTSGGGGGGF GGPFSATAVPPPPPPAMNIPQQQPPPPAAPQQPQSRRSPVSPQLQQQHQA AAAAFLQQRNSYNHHQPLLKQSPWSNHQSSGWGTGSM

[0042] Fragile X mental retardation protein (FMRP) (466-632)

TABLE-US-00007 (SEQ ID NO: 07) GQGMGRGSRPYRNRGHGRRGPGYTSGTNSEASNASETESDHRDELSDWSL APTEEERESFLRRGDGRRRGGGGRGQGGRGRGGGFKGNDDHSRTDNRPRN PREAKGRTTDGSLQIRVDCNNERSVHTKTLQNTSSEGSRLRTGKDRNQKK EKPDSVDGQQPLVNGVP

[0043] Cold inducible RNA binding protein (CIRBP) (1-172)

TABLE-US-00008 (SEQ ID NO: 08) MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFG FVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGG RGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGG YSDRSSGGSYRDSYDSYATHNE

[0044] RNA binding motif (RNP1, RRM) protein 3 (RBM3) (1-157)

TABLE-US-00009 (SEQ ID NO: 09) MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFG FITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRG RSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGN YRDNYDN

[0045] Yeast Sup35 (2-134)

TABLE-US-00010 (SEQ ID NO: 10) SDSNQGNNQQNYQQYSQNGNQQQGNNRYQGYQAYNAQAQPAGGYYQNYQG YSGYQQGGYQQYNPDAGYQQQYNPQGGYQQYNPQGGYQQQFNPQGGRGNY KNFNYNNSLQGYQAGFQPQSQGMSLNDFQKQQKQ

[0046] In this specific embodiment we designed a fusion protein comprising a full length adhesion foot protein from marine mussels (mfp5), the LC domain of the human TAR DNA-binding protein 43 (TDP-43), and an N-terminal His-tag to facilitate purification (FIG. 1A-C). mfp5 is a very ‘sticky’ protein rich in lysine and post-translationally modified tyrosine residues (L-3,4-dihydroxyphenylalanine; DOPA) that are essential for the interfacial interactions that facilitate the underwater adhesion of mussels (FIG. 1A). Human TDP-43, an amyloid protein comprised of two RNA recognition motifs and an LC domain (FIG. 1B), is known to form LLPS-driven ribonucleoprotein (RNP) granules that mediate cellular processes in neuron cells.

[0047] We anticipated (i) that our engineered mfp5-TDP-43 LC (MTLC) fusion protein monomers would form into condensed liquid-like droplets driven by LLPS, (ii) that the liquid-like droplets would tend to spread over and adsorb on substrate surfaces to facilitate a priming process for the MTLC coating, (iii) that the local enrichment of the MTLC in the droplets would promote the self-assembly of amyloid condensates at the surface, and (iv) that additional MTLC monomers would then aggregate on these surface-localized structures, driving the eventual formation of thick amyloid nanofiber coatings on the substrate (FIG. 1D). We also anticipated that the MTLC nanofiber coatings should exhibit very strong underwater adhesion, owing to their high surface area and the adhesive residues present on the mfp5 domains, which would be exposed at the surface of the nanofibers, external to the amyloid core.

[0048] In our initial attempts to apply purified MTLC monomers as adhesive coatings we observed a striking temperature-dependent phenomenon. Specifically, when incubated at 4° C., the MTLC fusion protein monomers formed a dense and uniform coating on a glass substrate. In contrast, when incubated at 25° C., only very sparse and inhomogeneous depositions were formed on the glass slide (FIG. 2A). Further, staining with the amyloid-specific dye Congo red revealed intense and uniform signals for the MTLC coating formed at 4° C., whereas the coating formed at 25° C. had a much weaker staining signal. TEM and AFM analysis confirmed that the MTLC coating materials formed at 4° C. were nanofiber mesh structures comprised of hierarchically arranged nanofibers (FIG. 2B). Further confirming the amyloid nature of the coatings, x-ray fiber diffraction analysis showed typical diffraction patterns for the cross-0 spine structures of amyloid nanofibres. It is important to note that although the depositions formed at 25° C. were very sparse, TEM and AFM revealed that these materials were also assembled as amyloid nanofibers.

[0049] Intrigued by the observation that incubation of MTLC monomers at 25° C. produced amyloid nanofibers but formed only sparse depositions on the glass substrate, we conducted an amyloid-specific dye assay (Thioflavin T, ThT) to monitor the amyloid assembly process over time at low (4° C.) and high (25° C.) temperatures (FIG. 2C). These assays revealed two distinct trends. First, whereas the high temperature samples exhibited amyloid assembly that started soon after the start of incubation, the low temperature samples had a much longer lag time prior to initiate amyloid assembly. Second, it took about 24 hours for the MTLC monomers of the high temperature samples to complete their assembly into amyloid nanofibers. In contrast, the amyloid assembly process for low temperature samples was completed within a much shorter time window (˜10 h).

[0050] The extreme differences that we observed in the thickness and uniformity of coverage of the coatings formed at low vs. high temperature, and our findings that the temperature difference altered, but did not prevent, the amyloid assembly of MTLC monomers collectively suggest a kinetically trapped state in the low temperature samples during which MTLC monomers form liquid phase condensates in a process driven by LLPS. A hallmark feature of LLPS is high turbidity of solutions. We here conducted turbidimetry based on optical density measurements at 600 nm for a purified MTLC monomer solution over a 6 hour incubation timecourse at 4° C. and 25° C. and observed that, whereas the turbidity of the 4° samples rose from a very low level, subsequently rose sharply to quickly reach a plateau that lasted for around 2 hours, and then gradually declined, the turbidity of the 25° samples rose slightly but then sharply decreased without exhibiting any plateau (FIG. 2D).

[0051] We believe that the high turbidity plateau of the 4° C. samples delineates the aforementioned kinetically trapped state during which the liquid phase condensates are formed. Subsequent macro- and micro-scale observations of the low and high temperature samples collected at different time points further supported this hypothesis. Photographs of the low temperature MTLC incubation process showed that the low-temperature sample solutions became cloudy within several minutes, remained cloudy for 4-5 hours, and then became clear by hour 6, a point by which the amyloid nanofiber assembly process has already begun (FIG. 2E). Consistently, light microscopy showed that liquid-like droplets formed in the low temperature MTLC samples within 1 hour; no droplets formed at any point for the high temperature MTLC samples (FIG. 2F, FIG. S6). Fascinatingly, in the period of time between the initial deposition of these liquid-like droplets and eventual amyloid nanofiber formation in the low temperature MTLC samples, we observed that intermediate “proto-fibrils” formed in the immediate vicinity of the initially absorbed liquid-like droplets. Testing the LC domain-mediated LLPS process under a variety of experimental conditions by monitoring solution turbidity showed that temperature, ionic strength, and solution pH all affected the LLPS-driven formation of liquid-like droplets, but temperature appeared to exert the largest influence (FIG. S8). More specifically, lower temperature, lower ionic strength, and higher pH values all promoted phase separation of the MTLC monomers.

[0052] We next applied Quartz Crystal Microbalance with Dissipation monitoring (QCM-D) experiments to examine the different adsorption capacities of MTLC on a gold surface at 4° C. and 25° C. (FIG. 2G). The adsorption capacity of the MTLC solution at the low temperature was significantly higher than at the high temperature. Additionally, the large value of the acoustic ratio (AD/AF) observed for the low temperature solution was indicative of the presence of soft materials adsorbed on the gold surface. These results highlight the significant role of LLPS-driven liquid-like condensates in the formation of dense and uniform amyloid nanofiber coatings at substrate surfaces at low temperature: as liquid-like droplets, such condensates have low surface energy that effectively lowers the energy barrier required for surface wetting and subsequent adsorption.

[0053] To directly measure the underwater adhesion performance of MTLCs, we used a colloidal probe technique based on AFM that assesses the asymmetric adhesion of nanomaterials that are initially bound to clean and smooth mica in an aqueous buffer (FIG. 3A). We initially examined how the differences in coating density and uniformity between the low and high temperature MTLC coatings affected adhesive strength. The low-temperature MTLC coatings exhibited dramatically and significantly stronger adhesion than the high-temperature coatings (FIG. 3B). Indeed, the adhesive performance of the low-temperature coating was very close to the value reported for the strongest-to-date protein-based underwater adhesive (underwater adhesion energy). This huge difference in adhesion underscores the powerful contribution of the LLPS-driven process in promoting both the initial priming and wetting of a substrate and the subsequent self-assembly of the locally concentrated MTLC monomers into extremely dense and highly uniform amyloid nanofibers.

[0054] Note that the MTLC fusion monomers also contain a marine mussel adhesive plaque protein, we next assessed how the presence of the mfp5 fusion domain influenced the adhesion of three different coatings by coating mica at low temperature with TDP-43 LC domain only, unmodified MTLC, or tyrosinase-modified MTLC bearing DOPA residues. Even lacking tyrosinase treatment, the presence of the mfp5 fusion domain substantially increased the adhesive strength of the coating: the adhesion of the unmodified MTFP coating was 1.6 times stronger than the coating made from the TDP-43 LC domain alone. Impressively, the in vitro conversion of the tyrosine residues on the MTLC monomers into DOPA residues via tyrosinase treatment increased the adhesion strength of the amyloid nanofiber coating by more than 2.7 times, making it by far the strongest ever reported protein-based underwater adhesive (with underwater adhesion energy approaching 48.1 mJ m.sup.−2) (FIG. 3C). Beyond their contribution to increasing adhesion, it was also clear that the DOPA residues on the mfp5 fusion domains enhanced intramolecular interactions and absorption on the gold substrate during LLPS-mediated deposition: QCM-D analysis showed that the tyrosine-modified MTLC coatings were even denser than the unmodified MTLC coatings (FIG. 3D).

[0055] There is an important distinction between LC domain-driven LLPS and another LLPS mechanism—coacervation—that is used by sandcastle worms for priming and wetting and that has inspired existing biomimetic adhesives. Formation of coacervate structures is electrostatically-driven, and is thus dependent on pH, and engineered charge-charge-based coaceravates are therefore currently limited to applications in narrow pH ranges. Given that it is likely the α-helix and aromatic residues in the LC-domain that provide the hydrophobic force to drive the LLPS that we observed during low-temperature MTLC coating deposition, we speculated that LC domain-based LLPS may enable coating applications over a wide range of pH values. Indeed, MTLC coatings on mica could were deposited from solutions at a wide range of pH values (3-11) at 4° C., all of which exceeded the adhesion performance of any previously reported protein-based underwater adhesives (FIG. 3E).

[0056] We next undertook the challenge of applying MTLC coatings to polytetrafluoroethylene (PTFE, “Teflon”), which is an extraordinarily “nonstick” substance. Following incubation of flat Teflon wafers overnight at 4° C., comparison of UV light (254 nm) images revealed the successful deposition of a thick MTLC coating on the Teflon, and water contact angle analysis demonstrated that this coating significantly and dramatically decreased the contact angle of the hydrophobic PTFE surface, from 108.4°±1.4° to 68.7°±2.1° (FIG. 4A). When we incubated uncoated and MTLC-coated PTFE wafers with CdSeS@ZnS quantum dots (QDs), which can interact with the MTLC molecules via His-tag affinity, we observed QDs adsorbed uniformly on the surface of the coated Teflon wafers but found that almost no QDs were present on uncoated Teflon. Cross section images of the MTLC coating by SEM revealed that the surface of the wafer had a thick and uniform coating (FIG. 4B). XPS spectral analysis revealed that, compared to uncoated PTFE, PTFE, wafers coated with MTLC amyloid nanofibers had almost no signal for Fluorine (F1s) but had significant signals for Oxygen (O1s) and Nitrogen (N1s) from the protein coating layers. We also found that coated wafers had decreased signals for Carbon (C1s) arising from C—F bonds, but had increased signals for Carbon (C1s) arising from C—O, C—N, and C—C bonds.

[0057] Exploiting the ability of our LLPS-driven MTLC process to coat difficult-to-access surfaces, we also conducted proof-of-concept demonstrations for the coating of difficult-to-access interior surfaces including the interior surfaces of a flexible Teflon pipe (FIG. 4C) and the channel of a microfluidic device (FIG. 4D). Again, the ability of the MTLC coatings to adsorb QDs allowed us to post-treat and thus visualize MTLC coatings on these and other challenging substrates (e.g., highly flexible polyethylene terephthalate (“Mylar”) thin films) (FIG. S22); the successful formation of thick and uniform MTLC coatings on each of these materials underscored that our LLPS-driven technique can be used to coat a great diversity of surfaces.

[0058] To further explore practical applications of our LLPS-driven MTLC adhesives, we turned to utilize these materials as underwater glues for repairing damages by co-injecting purified MTLC monomers in solution with non-sticky polystyrene (PS) micro-spheres into a damaged site scratched onto a PTEF substrate (FIG. 4E). Upon incubation at 4° C. for 12 hours, an LLPS-driven MTLC coating formed on the surface of the damage site and on the surface of the micro-spheres; the coating functioned as a glue to aggregate the micro-spheres to each other and to the substrate surface, thereby retaining them in place and filling the damage site. Both fluorescent and SEM images showed that the micro-spheres specifically accumulate in the damage site, clearly demonstrating the utility of the LLPS-driven coating for damage repair.

EXAMPLES

[0059] We demonstrated functionality with representative MAP-LC dimeric protein combinations. We demonstrated that FUS LC, GFP-FUS LC, GFP-FUS LC-mfp5 all possess property of reversible, liquid-liquid phase separation, and GFP-FUS LC-mfp5 shows underwater adhesion while displaying green fluorescence. We demonstrated that mfp5-FUS LC, mfp3-TDP-43 LC, and mCherry-FUS LC-mfp3 were also constructed, and mCherry-FUS LC-mfp3 possess underwater adhesion while displaying red fluorescence. We demonstrated that Spytag-FUS and mfp5-spycatcher were constructed separately. When the two proteins were mixed at 1:1 molar ratio, they covalently interact to form conjugated proteins that exhibited underwater adhesion.

[0060] MTLC adhesives can be deposited over difficult-to-access interfaces, such as the channels in micro-fluidic devices and the walls of microtubules. FIG. 5 (A) is a schematic illustration showing the fluidic device made of PDMS covered on a glass slide. MTLC were injected into the fluidic device and incubated at 4° C. Then QDs were injected into the fluidic device to assemble on the MTLC coating on inside walls. Then the channel was washed by distilled water. (B) 3D images was taken by a confocal fluorescent microscopy. (C) In situ photograph was taken under UV light. (D) SEM image and (E) SEM sectional image showing the inside walls of channel were coated with protein.

[0061] MTLC coatings can serve as universal coatings for diverse substrates. FIGS. 6A-C: (A) Digital images of red ODs assembled on MTLC coated surfaces. (B) 3D image of micro PE tube. Red QDs assembled on MTLC coated inside wall. (C) Water contact angle measurement of various surfaces with/without MTLC coatings. Teflon plate: 108.4°+1.4°, 68.7°+2.1°; PS plate: 88.6°+1.5°, 85.2°+1.0°; cover glass: 58.3°+1.9°, 76.0°+2.5°; Silicon wafer: 48.6°+2.3°, 80.3°+1.3°; Aluminum foil: 53.5°+3.9°, 67.5°+0.9°; Iron sheet: 66.8°+1.6°, 75.3°+1.7°.

[0062] MTLC coatings as patterned arrays for binding specific objects. FIGS. 7A-C: (A) QDs assembled on lithography patterns mediated by specific mask plates. (B) QDs assembled on soft lithography patterns. (C) Micro-scale pattern displays an orderly light spot under green laser which indicates long range ordered pattern achieved.

[0063] MTLC coatings for electronic devices: deposition of metal layers et al. on challenging surfaces. FIGS. 8A-C: (A) Photograph of MTLC coating (left) and copper deposition (right) on the inside wall of PP Eppendorf tube by electro-less metal deposition. (B) Photographs of porous resin models printed by 3D printer before and after copper deposition. (C) C-V curves of copper deposited 3D model. Inserted images are circuit demo of copper deposited 3D model working as an electrical conductor to light the diode.