[1,2,4]TRIAZOLO[1,5-A]PYRIDINE COMPOUND AS JAK INHIBITOR AND USE THEREOF
20210155621 · 2021-05-27
Assignee
Inventors
- Weiwei MAO (Shanghai, CN)
- Wenyuan QIAN (Shanghai, CN)
- Xuejian Zheng (Shanghai, CN)
- Guoping HU (Shanghai, CN)
- Changqing WEI (Shanghai, CN)
- Jian Li (Shanghai, CN)
- Shuhui Chen (Shanghai, CN)
Cpc classification
A61K31/437
HUMAN NECESSITIES
C07D487/00
CHEMISTRY; METALLURGY
International classification
Abstract
Disclosed are a [1,2,4]triazolo[1,5-a]pyridine compound as JAK inhibitor and an application thereof in preparing a drug for treating a disease related to JAK or/and TYK2. Specifically, the present invention relates to a compound represented by formula (I), or an isomer or pharmaceutically acceptable salt thereof. (I)
##STR00001##
Claims
1. A compound of formula (I), isomers thereof or pharmaceutically acceptable salts thereof, ##STR00061## wherein, E.sub.1 and E.sub.2 are independently selected from single bond, —CH.sub.2— or —(CH.sub.2).sub.2—; L.sub.1 is selected from single bond, —(CH.sub.2).sub.g—, —C(═O)— or —C(═O)—(CH.sub.2).sub.h—; m is 1 or 2; n is 1 or 2; g is 1, 2 or 3; h is 1, 2 or 3; R.sub.1 is selected from H, CN, C.sub.1-6 alkyl group or 3-6-membered cycloalkyl group, wherein the above C.sub.1-6 alkyl group and 3-6-membered cycloalkyl group are optionally substituted by 1, 2 or 3 R.sub.a; R.sub.2 is selected from H, F, Cl, Br, I or C.sub.1-3 alkyl groups, wherein the above C.sub.1-3 alkyl group is optionally substituted by 1, 2 or 3 R.sub.b; R.sub.3, R.sub.4 and R.sub.5 are independently selected from H, F, Cl, Br, I or C.sub.1-3 alkyl group, wherein the above C.sub.1-3 alkyl group is optionally substituted by 1, 2 or 3 R.sub.e; R.sub.6, R.sub.7 and R.sub.8 are independently selected from H, F, Cl, Br, I or C.sub.1-3 alkyl group, wherein the above C.sub.1-3 alkyl group is optionally substituted by 1, 2 or 3 R.sub.d; Each R.sub.a is independently selected from H, F, Cl, Br, I, CN or C.sub.1-3 alkyl group, wherein the above C.sub.1-3 alkyl group is optionally substituted by 1, 2 or 3 R; Each R.sub.b is independently selected from F, Cl, Br or I; Each R.sub.c is independently selected from F, Cl, Br or I; Each R.sub.d is independently selected from F, Cl, Br or I; Each R is independently selected from F, Cl, Br or I.
2. The compound of formula (I), isomers thereof or pharmaceutically acceptable salts thereof according to claim 1, wherein each R.sub.a is independently selected from H, F, Cl, Br, I or CN.
3. The compound of formula (I), isomers thereof or pharmaceutically acceptable salts thereof according to claim 1, wherein, R.sub.1 is selected from H, CN, C.sub.1-3 alkyl group or 3˜5-membered cycloalkyl group, wherein the C.sub.1-3 alkyl group and 3˜5-membered cycloalkyl group are optionally substituted by 1, 2 or 3 R.sub.a.
4. The compound of formula (I), isomers thereof or pharmaceutically acceptable salts thereof according to claim 3, wherein R.sub.1 is selected from H, CN, CH.sub.3, ##STR00062## wherein the CH.sub.3, ##STR00063## are optionally substituted by 1, 2 or 3 R.sub.a.
5. The compound of formula (I), isomers thereof or pharmaceutically acceptable salts thereof according to claim 4, wherein, R.sub.1 is selected from H, CN, CF.sub.3, CHF.sub.2, ##STR00064##
6. The compound of formula (I), isomers thereof or pharmaceutically acceptable salts thereof according to claim 1, wherein, R.sub.2 is selected from H, F, Cl, Br or I.
7. The compound of formula (I), isomers thereof or pharmaceutically acceptable salts thereof according to claim 1, wherein, R.sub.3, R.sub.4 and R.sub.5 are independently selected from H, F, Cl, Br or I.
8. The compound of formula (I), isomers thereof or pharmaceutically acceptable salts thereof according to claim 1, wherein, R.sub.6, R.sub.7 and R.sub.8 are independently selected from H, F, Cl, Br or I.
9. The compound of formula (I), isomers thereof or pharmaceutically acceptable salts thereof according to claim 1, wherein, L.sub.1 is selected from single bond, —CH.sub.2—, —(CH.sub.2).sub.2—, —C(═O)— or —C(═O)—(CH.sub.2)—.
10. The compound of formula (I), isomers thereof or pharmaceutically acceptable salts thereof according to claim 1, wherein, structural unit ##STR00065## is selected from ##STR00066##
11. The compound of formula (I), isomers thereof or pharmaceutically acceptable salts thereof according to claim 1, wherein, structural unit ##STR00067## is selected from ##STR00068##
12. The compound of formula (I), isomers thereof or pharmaceutically acceptable salts thereof according to claim 1, wherein, structural unit ##STR00069## is selected from ##STR00070## ##STR00071##
13. The compound of formula (I), isomers thereof or pharmaceutically acceptable salts thereof according to claim 1, wherein, they are selected from ##STR00072## wherein, L.sub.1 is defined as in claim 1; R.sub.1 is defined as in claim 1; R.sub.2 is defined as in claim 1; R.sub.3, R.sub.4 and R.sub.5 are defined as in claim 1; R.sub.6, R.sub.7 and R.sub.8 are defined as in claim 1.
14. The compound of formula (I), isomers thereof or pharmaceutically acceptable salts thereof according to claim 13, wherein, they are selected from ##STR00073## wherein, L.sub.1 is defined as in claim 1; R.sub.a is defined as in claim 1; R.sub.2 is defined as in claim 1; R.sub.3, R.sub.4 and R.sub.5 are defined as in claim 1; R.sub.6, R.sub.7 and R.sub.8 are defined as in claim 1.
15. The following compounds, isomers thereof and pharmaceutically acceptable salts thereof, ##STR00074## ##STR00075## ##STR00076## ##STR00077## ##STR00078## ##STR00079## ##STR00080##
16. The compounds, isomers thereof and pharmaceutically acceptable salts thereof according to claim 15, wherein, they are selected from ##STR00081## ##STR00082## ##STR00083## ##STR00084## ##STR00085## ##STR00086##
17. A pharmaceutical composition, comprising the compounds, isomers thereof and pharmaceutically acceptable salts thereof according to claim 1 and pharmaceutically acceptable carrier.
18. A method for treating JAK1 and/or TYK2 related diseases, comprising administering a compound, isomer or pharmaceutically acceptable salt of claim 1 to a patient in need thereof.
19. The use method according to claim 18, wherein the drugs are drugs used for treating rheumatoid arthritis.
Description
BRIEF DESCRIPTION OF DRAWINGS
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
DETAILED DESCRIPTION
[0081] The present application will be described in detail by the embodiments below, but it is not intended to impose any adverse limitation to the present application. The present application is described in detail herein, and specific embodiments are also disclosed. It will be apparent to those skilled in the art to make various changes and improvements to the specific embodiments of the present application without departing from the spirit and scope of the present application.
Example 1
[0082] ##STR00036##
[0083] Step 1: LiHMDS (1 M, 51.2 mL) were dripped into THF (150 mL) solution containing compound 1-1 (10.2 g, 42.6 mmol) at −78° C. After stirring the reaction solution for 1 hour at −78° C., THF(150 mL) solution containing 1,1,1-trifluoro-N-phenyl-N-(trifluoromethanesulfonyl) methanesulfonamide (16.7 g, 46.9 mmol) was added to the reaction solution, and then stirred for 12 hours at 15° C. TLC (PE:EA=10:1) showed the raw materials were consumed completely, and there were new points generated. The solution was quenched by using 250 mL saturated ammonium chloride, diluted by 200 mL water, and then extracted with EtOAc (200 mL*3). Organic phases were combined, washed by saturated saline solution, dried by sodium sulfate, filtered and concentrated to provide the compound 1-2. Coarse product was used in the following reactions without purification. .sup.1H NMR (400 MHz, CDCl.sub.3) δ 5.63 (br s, 1H), 3.50-3.65 (m, 4H), 2.34 (br s, 4H), 1.88 (br t, J=5.90 Hz, 2H), 1.37 (s, 9H).
[0084] Step 2: Potassium acetate (12.7 g, 129.3 mmol) and Pd(dppf)Cl.sub.2.CH.sub.2Cl.sub.2 (3.5 g, 4.3 mmol) were added to DMF (100 mL) solution containing compound 1-2 (16 g, 43.1 mmol) and bis(pinacolato)diboron (12.0 g, 47.4 mmol), then replaced with nitrogen for 3 times, and stirred in nitrogen condition for 3 hours at 70° C. TLC showed the raw materials are consumed completely, and there were new points generated. The reaction solution was dispersed in a mixture of 300 mL water and 400 mL EtOAc. Organic phases were separated, washed by saturated saline solution, dried by sodium sulfate, filtered and concentrated to provide a coarse product. The coarse product was purified by silica gel column chromatography to provide compound 1-3. H NMR (400 MHz, CDCl.sub.3) δ6.46 (br s, 1H), 3.71-3.53 (m, 4H), 2.31 (br d, J=3.0 Hz, 2H), 2.24-2.16 (m, 2H), 1.74 (t, J=6.3 Hz, 2H), 1.44 (s, 9H), 1.26 (s, 12H).
[0085] Step 3: In a nitrogen atmosphere, potassium carbonate (3.8 g, 27.3 mmol) and Pd(dppf)Cl.sub.2.CH.sub.2Cl.sub.2 (744 mg, 911.0 μmol) were added into the solution of dioxane (60 mL) and water (15 mL) containing compound 1-3 (3.5 g, 10.0 mmol) and N-(5-bromo-[1,2,4]triazolo[1,5-a]pyridine-2-yl) cyclopropane formamide (2.6 g, 9.1 mmol). This reaction solution was stirred for 3 hours at 90° C. LCMS showed the raw materials were consumed completely, and there were target molecular ion peaks detected. The reaction solution was concentrated to provide a coarse product, which was purified and separated by chromatography to provide compound 1-4. LCMS (ESI) m/z: 424.3[M+H].sup.+.
[0086] Step 4: Dichloromethane (10 mL) solution containing compound 1-4 (3.5 g, 8.2 mmol) was added with hydrochloric acid/EtOAc (4 M, 30 mL), and stirred for 0.5 hour at 25° C. LCMS showed raw materials were consumed completely, and target molecular ion peaks were detected. Solid was precipitated, filtered and dried to provide compound 1-5 (3.3 g hydrochloride, coarse product), then directly used in following reactions without purification. LCMS (ESI) m/z: 324.1.
[0087] Step 5: In a nitrogen atmosphere, Pd/C (1 g, 10%) was added into methanol (100 mL) solution containing compound 1-5 (3.0 g, 8.34 mmol, hydrochloride). The suspension was replaced with hydrogen for 3 times, then stirred for 12 hours in hydrogen (30 psi) atmosphere at 30° C. LCMS showed raw materials were consumed completely, and target molecular ion peaks are detected. The reaction solution was filtered, then concentrated to provide compound 1-6. LCMS (ESI) m/z: 326.2 [M+H].sup.+
[0088] Step 6: Compound 1-6 (0.87 g, 2.40 mmol, hydrochloride) was dissolved in N,N-dimethyl formamide (10 mL), added with HOBt (487 mg, 3.6 mmol) and EDCI (691 mg, 3.6 mmol), then added with (1S)-2,2-difluoro cyclopropanecarboxylic acid (323 mg, 2.6 mmol) and ethyldiisopropylamine (621 mg, 4.8 mmol), and left for reacting for 12 hours at 15° C. LC-MS showed reaction was complete. The reaction solution was concentrated under reduced pressure, and residues were processed by preparative HPLC (neutral system) to provide compound 1-13: .sup.1H NMR (400 MHz, METHANOL-d.sub.4) δ7.32-7.73 (m, 2H), 6.95 (br s, 1H), 3.62-4.22 (m, 4H), 3.45 (br s, 1H), 3.18-3.37 (m, 1H), 2.61 (br s, 1H), 1.45-2.27 (m, 10H), 0.78-1.17 (m, 4H). LCMS (ESI) m/z: 430.0[M+H].sup.+.
[0089] The following compounds having the following characteristic data were obtained from compound 1-6 as common intermediate by using the same synthesis and separation methods as those used for compound 1-13 (i.e. carboxylic acids for synthesizing compound 1-13 were replaced by carboxylic acids corresponding to the following target molecules at acid amide condensation reactions):
##STR00037##
[0090] Compound 1-7: .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ11.08 (br s, 1H), 7.48-7.78 (m, 2H), 7.03 (d, J=7.0 Hz, 1H), 3.86-4.25 (m, 2H), 3.61-3.80 (m, 2H), 3.29-3.38 (m, 1H), 2.69-2.88 (m, 1H), 1.85-2.19 (m, 7H), 1.51-1.79 (m, 4H), 0.83-0.96 (m, 4H). LCMS (ESI) m/z: 430.0[M+H].sup.+.
[0091] Compound 1-8: .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.14 (br s, 1H), 7.52-7.66 (m, 2H), 7.00 (d, J=7.03 Hz, 1H), 3.54-3.83 (m, 6H), 3.29 (br t, J=11.54 Hz, 1H), 1.94-2.09 (m, 5H), 1.41-1.70 (m, 4H), 0.77-0.90 (m, 4H). LCMS (ESI) m/z: 393.1[M+H].sup.+.
[0092] Compound 1-9: .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 10.99 (br s, 1H), 7.49-7.65 (m, 2H), 6.99 (br d, J=7.03 Hz, 1H), 4.02-4.20 (m, 2H), 3.61-3.78 (m, 2H), 1.94-2.13 (m, 5H), 1.48-1.72 (m, 4H), 1.14-1.32 (m, 4H), 0.77-0.87 (m, 4H). LCMS (ESI) m/z: 412.1[M+H].sup.+.
[0093] Compound 1-10: .sup.1H NMR (400 MHz, METHANOL-d.sub.4) δ 7.77-7.87 (m, 1H), 7.62 (d, J=8.78 Hz, 1H), 7.20 (dd, J=7.28, 11.80 Hz, 1H), 4.08 (s, 1H), 3.96 (s, 1H), 3.83 (s, 1H), 3.72 (s, 1H), 3.43-3.56 (m, 1H), 3.22 (dq, J=6.90, 10.75 Hz, 2H), 2.06-2.23 (m, 4H), 1.94 (br s, 1H), 1.56-1.84 (m, 3H), 1.56-2.00 (m, 1H), 0.94-1.14 (m, 4H). LCMS (ESI) m/z: 436.1[M+H].sup.+.
[0094] Compound 1-11: .sup.1H NMR (400 MHz, METHANOL-d.sub.4) δ 7.56-7.67 (m, 1H), 7.50 (d, J=8.78 Hz, 1H), 7.00 (t, J=7.15 Hz, 1H), 4.26-4.48 (m, 2H), 3.70-3.90 (m, 2H), 3.42-3.59 (m, 1H), 2.08-2.24 (m, 4H), 1.48-1.99 (m, 9H), 0.87-1.10 (m, 4H). LCMS (ESI) m/z: 419.1[M+H].sup.+.
[0095] Compound 1-12: .sup.1H NMR (400 MHz, METHANOL-d.sub.4) δ 7.56-7.64 (m, 1H), 7.48 (d, J=9.03 Hz, 1H), 6.97 (d, J=7.28 Hz, 1H), 3.91-4.17 (m, 2H), 3.78-3.86 (m, 1H), 3.67-3.75 (m, 1H), 3.40-3.54 (m, 1H), 2.53-2.69 (m, 1H), 1.92-2.21 (m, 6H), 1.72-1.85 (m, 3H), 1.50-1.69 (m, 2H), 0.86-1.08 (m, 4H). LCMS (ESI) m/z: 430.1[M+H].sup.+.
[0096] Compound 1-14: .sup.1H NMR (400 MHz, METHANOL-d.sub.4) δ 7.57-7.66 (m, 1H), 7.50 (d, J=8.78 Hz, 1H), 6.95-7.03 (m, 1H), 6.01-6.38 (m, 1H), 4.62 (s, 1H), 3.65-4.10 (m, 4H), 3.43-3.58 (m, 1H), 2.76-2.93 (m, 2H), 2.04-2.21 (m, 4H), 1.51-1.87 (m, 4H), 1.01-1.07 (m, 2H), 0.93 (qd, J=3.74, 7.34 Hz, 2H). LCMS (ESI) m/z: 418.1[M+H].sup.+.
[0097] Compound 1-15: .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.01 (br s, 1H), 7.48-7.66 (m, 2H), 7.00 (dd, J=7.53, 9.79 Hz, 1H), 4.11-4.33 (m, 2H), 3.60-3.81 (m, 2H), 3.25-3.32 (m, 1H), 2.03 (br t, J=9.03 Hz, 5H), 1.53-1.73 (m, 4H), 1.49 (d, J=4.77 Hz, 6H), 0.76-0.88 (m, 4H). LCMS (ESI) m/z: 421.1[M+H].sup.+.
##STR00038##
[0098] Synthesis of compound 1-16: Compound 1-6 (100 mg, 227.6 μmol, TFA) was dissolved into N,N-dimethyl formamide (5 mL), added with potassium carbonate (94 mg, 682.7 μmol) and 2-bromoacetonitrile (30 mg, 250.3 μmol), and stirred for 12 hours at 10° C. LC-MS showed reaction was complete. Reaction solution was diluted with water (5 mL), extracted by dichloromethane/methanol (10/1, 10 mL), washed by saturated saline solution (10 mL), dried by sodium sulfate anhydrous, filtered and concentrated under reduced pressure. Residues were processed by preparative HPLC (neutral system) to provide compound 1-16. .sup.1H NMR (400 MHz, METHANOL-d.sub.4) δ 7.83 (t, J=8.03 Hz, 1H), 7.64 (br d, J=8.78 Hz, 1H), 7.21 (d, J=7.53 Hz, 1H), 4.51 (s, 2H), 4.23 (s, 2H), 4.08 (s, 2H), 3.49 (br t, J=11.92 Hz, 1H), 2.14-2.30 (m, 4H), 1.79-1.97 (m, 3H), 1.59-1.74 (m, 2H), 0.95-1.12 (m, 4H). LCMS (ESI) m/z: 365.0[M+H].sup.+.
[0099] The following compounds having the following characteristic data were obtained from compound 1-6 as common intermediate by using the same synthesis and separation methods as those used for compound 1-16 (bromoacetonitrile was correspondingly replaced by bromopropionitrile in the target molecules):
[0100] Compound 1-17: .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ11.00 (br s, 1H), 7.50-7.63 (m, 2H), 6.96 (d, J=6.27 Hz, 1H), 3.33-3.34 (m, 2H), 3.23-3.30 (m, 1H), 2.95 (s, 2H), 3.05 (s, 2H), 2.58-2.69 (m, 2H), 1.99 (br d, J=10.29 Hz, 5H), 1.40-1.65 (m, 4H), 0.74-0.88 (m, 4H). LCMS (ESI) m/z: 379.0[M+H].sup.+.
Example 2
[0101] ##STR00039## ##STR00040##
[0102] Step 1: In nitrogen atmosphere at −78° C., tert-butyl 9-oxygen-3-azaspiro[5.5]hendecane-3-carboxylic acid (3-1) (5 g, 18.7 mmol) was dissolved into anhydrous tetrahydrofuran (150 mL), slowly dripped with bis(trimethylsilyl)amine lithium (1 M, 22.4 mL), and stirred for 1 hour at −78° C. Then, the reaction solution was added with anhydrous tetrahydrofuran (50 mL) solution containing 1,1,1-trifluoro-N-[-(trifluoromethyl)sulfonyl]-methane sulfonamide (7.35 g, 20.6 mmol), and stirred for 12 hours at 15° C. TLC showed reaction was complete. The reaction solution was quenched by saturated ammonium chloride (50 mL), and extracted by EtOAc (200 mL*2). The combined organic phase was washed by saturated saline solution (50 mL), dried by anhydrous sodium sulfate, filtered and concentrated at reduced pressure to provide compound 3-2, which was directly used in following reactions without being purified.
[0103] Step 2: Compound 3-2 (8 g, 20.0 mmol) and Bis(pinacolato)diboron (5.59 g, 22.0 mmol) were dissolved into N,N-dimethylformamide (100 mL), added with potassium acetate (5.90 g, 60.1 mmol) and 1,1′-Bis(diphenylphosphino)ferrocene-palladium(II)dichloride dichloromethane (1.64 g, 2.0 mmol), and stirred for 3 hours at 70° C. TLC showed reaction was complete. The reaction solution was diluted with water (300 mL), and extracted by EtOAc (200 mL*2). Combined organic phases were washed by saturated saline solution (150 mL), dried by anhydrous sodium sulfate, filtered and concentrated at reduced pressure. Residues were separated by rapid silicon gel column (0-10% EtOAc/PE) to provide compound 3-3. .sup.1H NMR (400 MHz, CDCl.sub.3) δ6.41 (br s, 1H), 6.34-6.47 (m, 1H), 3.32-3.44 (m, 2H), 3.14-3.29 (m, 2H), 2.00-2.10 (m, 2H), 1.90 (br d, J=3.01 Hz, 2H), 1.38 (s, 9H), 1.28 (br t, J=5.52 Hz, 4H), 1.19 (s, 12H).
[0104] Step 3: In nitrogen atmosphere, mixed dioxane (40 ml) and water (10 ml) solution containing N-(5-bromo-[1,2,4]triazole[1,5-a] pyridine-2-yl) cyclopropyl formamide (2 g, 7.1 mmol), compound 3-3 (3.49 g, 9.3 mmol), potassium carbonate (2.95 g, 21.3 mmol), and [1,1-Bis (diphenylphosphine) ferrocene]palladium dichloride dichloromethane (581 mg, 711.5 μmol) was replaced by nitrogen for 3 times, and the reaction solution was heated to 90° C. for 3 hours. LC-MS showed that the reaction was complete. The reaction solution was concentrated under reduced pressure, and the residue was separated by a rapid silica gel column (0 4% methanol/dichloromethane) to provide compounds 3-4. LCMS (ESI) m/z: 452.4[M+H].sup.+.
[0105] Step 4: Compound 3-4 (3.5 g, 7.8 mmol) was dissolved into dichloromethane (15 mL), added with hydrochloric acid/EtOAc (4 M, 30 mL), and left to react for 30 minutes at 20° C. LC-MS showed reaction was complete. Solid was precipitated, filtered and dried to provide compound 3-5. LCMS (ESI) m/z: 352.2[M+H].sup.+.
[0106] Step 5: In N.sub.2 atmosphere, compound 3-5 (2.9 g, 7.4 mmol, hydrochloride) was dissolved into methanol (100 mL), added with catalyst dry palladium/carbon) 1 g, 10%), and replaced by hydrogen for 3 times. The reaction solution was stirred for 12 hours at hydrogen pressure (30 Psi) and reaction temperature of 25° C. LC-MS showed reaction was complete. Solid was filtered by diatomite to provide filtrate, which was then concentrated to provide compound 3-6 ((2.6 g hydrochloride). LCMS (ESI) m/z: 354.7[M+H].sup.+.
[0107] Step 6: Compound 3-6 (1 g, 2.6 mmol, hydrochloride) was dissolved into N,N-dimethylformamide (20 mL), added with HOBt (573 mg, 4.2 mmol) and EDCI (813 mg, 4.2 mmol) and then (1S)-2,2-difluorocyclopropyl carboxylic acid (380 mg, 3.1 mmol) and DIEA (731 mg, 5.7 mmol), and left to react for 12 hours at 15° C. LC-MS showed reaction was complete. The reaction solution was diluted with water (100 mL), and extracted by dichloromethane/methanol (10/1, 150 mL*2). Combined organic phases were washed with saturated saline solution (100 mL), dried by anhydrous sodium sulfate, filtered and concentrated at reduced pressure. The residue was processed by preparative HPLC (neutral system) to provide compound 3-7. .sup.1H NMR (400 MHz, METHANOL-d.sub.4) δ 7.57-7.64 (m, 1H), 7.48 (d, J=8.78 Hz, 1H), 7.02 (d, J=7.28 Hz, 1H), 3.63-3.77 (m, 3H), 3.41-3.61 (m, 2H), 2.93 (dt, J=8.28, 11.80 Hz, 1H), 1.36-2.06 (m, 15H), 1.04 (quin, J=3.76 Hz, 2H), 0.93 (qd, J=3.66, 7.34 Hz, 2H). LCMS (ESI) m/z: 458.1[M+H].sup.+.
[0108] The following compounds having the following characteristic data were obtained from compound 3-6 as common intermediate by using the same synthesis and separation methods as those used for compound 3-7 (carboxylic acids for compound 3-7 were replaced by carboxylic acids in the following target molecules at acid amide condensation reactions):
##STR00041##
[0109] Compound 3-8: .sup.1H NMR (400 MHz, METHANOL-d.sub.4) δ7.57-7.67 (m, 1H), 7.49 (d, J=8.53 Hz, 1H), 7.03 (dd, J=3.76, 6.78 Hz, 1H), 4.61 (s, 1H), 3.83-3.91 (m, 1H), 3.62 (td, J=3.76, 7.53 Hz, 2H), 3.42-3.54 (m, 3H), 1.68-2.08 (m, 9H), 1.40-1.56 (m, 4H), 1.05 (quin, J=3.76 Hz, 2H), 0.88-0.97 (m, 2H). LCMS (ESI) m/z: 421.1 [M+H].sup.+.
[0110] Compound 3-9: .sup.1H NMR (400 MHz, METHANOL-d.sub.4) δ 7.61 (dd, J=7.28, 8.78 Hz, 1H), 7.49 (d, J=8.78 Hz, 1H), 7.02 (dd, J=4.52, 6.78 Hz, 1H), 3.63 (td, J=3.83, 7.40 Hz, 2H), 3.43-3.58 (m, 5H), 1.67-2.07 (m, 9H), 1.39-1.54 (m, 4H), 1.01-1.08 (m, 2H), 0.93 (qd, J=3.68, 7.28 Hz, 2H). LCMS (ESI) m/z: 464.1[M+H].sup.+.
Example 3
[0111] ##STR00042## ##STR00043##
[0112] Step 1: At 0° C., 5-bromo-[1,2,4]triazolo[1,5-a]pyridyl-2-amine (4-1)(5 g, 23.5 mmol) was dissolved into acetonitrile (50 mL), added with triethylamine (11.87 g, 117.4 mmol) and cyclopropanecarbonyl chloride (6.13 g, 58.7 mmol), and left to react for 12 hours at 25° C. TLC showed reaction was complete. Solvent acetonitrile was removed by concentration under reduced pressure, and residues were separated by rapid column (0-5% methanol/dichloromethene) to provide compound 4-2. LCMS (ESI) m/z: 350.8[M+H].sup.+.
[0113] Step 2: In N.sub.2 atmosphere, compound 4-2 (1.99 g, 5.7 mmol) and compound 1-1 (1.5 g, 6.3 mmol) were dissolved into anhydrous tetrahydrofuran (30 mL), slowly added with n-butyllithium (2.5 M, 5.7 mL) solution at −70° C., and stirred for 30 minutes at 10°. LC-MS showed reaction was complete. The reaction solution was quenched by saturated ammonium chloride (50 mL) at 0° C., and extracted by EtOAc (150 mL*2). Combined organic phases were washed by saturated saline solution (10 mL), dried by anhydrous sodium sulfate, filtered and concentrated under reduced pressure. Residues were separated by rapid silicon gel column (0-3% methanol/dichloromethane) to provide compound 4-3. LCMS (ESI) m/z: 442.3[M+H].sup.+.
[0114] Step 3: At 0° C., compound 4-3 (0.8 g, 1.81 mmol) was dissolved into anhydrous dichloromethane (10 mL), added with diethylaminosulphur trifluoride (DAST) (351 mg, 2.17 mmol), left to react for 15 minutes at 0° C., and then left to react for 1 hour after heating to 25° C. LC-MS showed reaction was complete. Reaction solution was quenched by saturated aqueous sodium bicarbonate solution (5 mL) at 0° C., diluted by water (10 mL), and extracted by dichloromethane (50 mL*3). The combined organic phases were by saturated saline solution (20 mL), dried by anhydrous sodium sulfate, filtered and concentrated under reduced pressure. Residues were separated by rapid silicon gel column (0-100% EtOAc/PE) to provide compound 4-4. LCMS (ESI) m/z: 444.3[M+H].sup.+.
[0115] Step 4: Compound 4-4 (410 mg, 924.4 μmol) was dissolved into dichloromethane (5 mL), added with hydrochloric acid/EtOAc (4 M, 10 mL), and left to react for 30 minutes at 20° C. LC-MS showed reaction was complete. Solid was precipitated, filtered and dried to provide compound 4-5 (390 mg hydrochloride). LCMS (ESI) m/z: 344.2[M+H].sup.+.
[0116] Step 5: Compound 4-5 (130 mg, 342.2 μmol, hydrochloride) was dissolved into N,N-dimethylformamide (10 mL), added with HOBt (77 mg, 567.9 μmol) and EDCI (109 mg, 567.9 μmol), then added with 2-cyanoacetic acid (35 mg, 416.4 μmol) and diisopropylethylamine (98 mg, 757.1 μmol), and left to react for 12 hours at 15° C. LC-MS showed reaction was complete. Reaction solution was concentrated under reduced pressure, and residues were processed by preparative HPLC (neutral system) to provide compound 4-6. .sup.1H NMR (400 MHz, METHANOL-d.sub.4) δ 7.66-7.72 (m, 1H), 7.56-7.62 (m, 1H), 7.25 (t, J=7.28 Hz, 1H), 4.29 (s, 1H), 4.03 (s, 1H), 3.97 (s, 1H), 3.76 (s, 1H), 3.26-3.30 (m, 2H), 2.97-3.28 (m, 2H), 1.74-2.08 (m, 7H), 0.89-1.13 (m, 4H). LCMS (ESI) m/z: 411.1 [M+H].sup.+.
[0117] The following compounds 4-7 and 4-8 having the following characteristic data were obtained from compound 4-5 as common intermediate by using the same synthesis and separation methods as those used for compound 4-6 (carboxylic acids compounds with different substituents from compound 4-6 were added)
##STR00044##
[0118] Compound 4-7: .sup.1H NR (400 MHz, METHANOL-d.sub.4) δ=7.65-7.73 (m, 1H), 7.59 (dt, J=1.13, 9.72 Hz, 1H), 7.20-7.29 (m, 1H), 4.33 (s, 1H), 4.01 (d, J=11.29 Hz, 2H), 3.76 (s, 1H), 2.99-3.30 (m, 4H), 1.74-2.10 (m, 7H), 0.88-1.12 (m, 4H). LCMS (ESI) m/z: 454.1[M+H].sup.+.
[0119] Compound 4-8: .sup.1H NMR (400 MHz, METHANOL-d.sub.4) δ=7.64-7.73 (m, 1H), 7.59 (dt, J=1.25, 9.16 Hz, 1H), 7.20-7.28 (m, 1H), 6.01-6.44 (m, 1H), 4.30 (s, 1H), 3.99 (d, J=11.80 Hz, 2H), 3.73 (s, 1H), 2.99-3.27 (m, 2H), 2.76-2.99 (m, 2H), 1.75-2.10 (m, 7H), 0.89-1.10 (m, 4H). LCMS (ESI) m/z: 436.1[M+H].sup.+.
Example 4
[0120] ##STR00045## ##STR00046##
[0121] Step 1: At −78° C., LiHMDS(1 M, 770 μL) was dripped into THF (8 mL) containing compound 5-1 (0.15 g, 592.1 μmol). The mixture was stirred for 1 hour at −78° C. At −78° C., tetrahydrofuran (4 mL) solution containing 1,1,1-trifluoro-N-phenyl-N-(trifluoromethyl sulfonyl) methanesulfonamide (233 mg, 651 μmol) was dripped into the reaction solution, and then stirred for 12 hours at 15° C. TLC(PE:EA=5:1) showed reaction was complete, and new points were generated. The reaction solution was quenched by 10 mL saturated ammonium chloride solution, then added with 20 mL water, and extracted by EtOAc (30 mL*3). The organic phases were combined, washed by saturated saline solution (40 mL), dried by anhydrous sodium sulfate, filtered and concentrated to provide compound 5-2, which was directly used in following reactions without purification.
[0122] Step 2: KOAc (191 mg, 2.0 mmol) and Pd (dppf) Cl.sub.2 (48 mg, 64.9 μmol) were added into DMF (10 mL) solution containing compound 5-2 (0.25 g, 648.7 μmol) and bis(pinacolato)diboron (165 mg, 648.7 μmol). The reaction solution was stirred for 12 hours at 70° C. TLC (PE:EA=5:1) showed reaction was complete, and generation of new points were detected. The reaction solution was added with 20 mL water, and extracted by EtOAc (30 mL*3). Organic phases were combined, washed by saturated saline solution (40 mL), dried by anhydrous sodium sulfate, filtered and concentrated to provide a coarse product, which was separated and purified by chromatography (SiO.sub.2, PE:EA=50:0 20:1) to provide colorless oily compound 5-3. .sup.1H NMR (400 MHz, METHANOL-d4) δ6.50 (br s, 1H), 3.35-3.49 (m, 2H), 3.07-3.15 (m, 2H), 2.02-2.22 (m, 4H), 1.54-1.81 (m, 4H), 1.47 (s, 9H), 1.27 (s, 12H).
[0123] Step 3: The solution of dioxane (4 mL) and water (1 mL) containing compound 5-3 (0.13 g, 357.8 μmol), N-(5-bromo-[1,2,4]triazolo[1,5-a]pyridine-2-yl)cyclopropane formamide (101 mg, 357.8 μmol), K.sub.2CO.sub.3 (149 mg, 1.1 mmol), and Pd(dppf)Cl.sub.2 (26 mg, 35.8 μmol) was replaced by nitrogen gas. The mixture was stirred in nitrogen atmosphere for 12 hours at 90° C. LCMS showed reaction was complete, and target molecular ion peaks were detected. The reaction solution was removed of the solvent by concentrating, then dispersed in 10 mL water, and extracted by DCM/MeOH (10:1, 30 mL*3). Organic phases were combined, washed by the saturated saline solution (40 mL) and dried by anhydrous sodium sulfate, then filtered to provide filtrate, which was distillated under reduced pressure to provide a coarse product. The coarse product was purified by the chromatographic column method (SiO.sub.2, DCM:MeOH=1:0 to 20:1) to provide compound 5-4. LCMS (ESI) m/z: 438.3[M+H].sup.+.
[0124] Step 4: In argon atmosphere, Pd/C (10%, 50 mg) was added into methanol (10 mL) containing compound 5-4 (0.2 g, 457.1 μmol). The mixture was replaced by hydrogen for 3 time, and then stirred in hydrogen atmosphere (15 psi) for 2 hours at 25° C. LCMS showed raw materials were consumed completely, and target molecular ion peaks were detected. The reaction solution was filtered and concentrated to provide compound 5-5, which was directly used in following reactions without purification. LCMS (ESI) m/z: 440.4[M+H].sup.+.
[0125] Step 5: Dichloromethane (10 mL) containing compound 5-5 (150 mg, 341.3 μmol) and TFA (4 mL) was replaced by nitrogen for 3 times, and the reaction solution was stirred for 30 minutes at 25° C. LCMS showed raw materials were consumed completely, and target molecular ion peaks were detected. The reaction solution was concentrated and removed of solvent to provide compound 5-6 (0.15 g, TFA salt), which was directly used in following reactions without purification. LCMS (ESI) m/z: 340.2[M+H].sup.+.
[0126] Step 6: EDCI (104 mg, 541.1 μmol), HOBt (73 mg, 541.1 μmol), and DIEA (140 mg, 1.1 mmol, 189 μL) were added into DMF (4 mL) containing (1S)-2, 2-difluorocyclopropyl formic acid (44 mg, 360.7 μmol), stirred to react for 5 minutes at 25° C., then added with compound 5-6 (122 mg, 270 μmol, TFA salt), and stirred for 16 hours at 25° C. LCMS showed raw materials were consumed completely, and target molecular ion peaks were detected. Coarse product was separated (neutral separation condition, chromatographic column: Waters Xbridge 150 mm*25 mm 5 μm; mobile phase: [H.sub.2(10 mM NH.sub.4HCO.sub.3)-ACN]; B(CH.sub.3CN)%: 25%-55%, 7 min) and SFC chiral separation (chromatographic column: DAICEL CHIRALCEL OD-H(250 mm*30 mm, 5 μm); mobile phase: [0.1% NH.sub.3H.sub.2O EtOH]; B(CO.sub.2)%: 40%) to provide compound 5-7, SFC retention time: 3.685 min. .sup.1H NMR (400 MHz, METHANOL-d.sub.4) δ 7.48-7.55 (m, 1H), 7.39 (d, J=8.78 Hz, 1H), 6.92 (dd, J=6.90, 3.39 Hz, 1H), 3.35-3.76 (m, 5H), 2.66-2.94 (m, 1H), 1.51-2.10 (m, 13H), 0.94 (br s, 2H), 0.78-0.88 (m, 2H). LCMS (ESI) m/z: 444.1[M+H].sup.+. Compound 5-8, SFC retention time: 4.283 min. .sup.1H NMR (400 MHz, METHANOL-d.sub.4) δ 7.48-7.59 (m, 1H), 7.40 (br d, J=8.53 Hz, 1H), 6.94 (br d, J=6.78 Hz, 1H), 3.23-3.78 (m, 5H), 2.65-2.81 (m, 1H), 1.54-2.06 (m, 13H), 0.95 (br s, 2H), 0.77-0.87 (m, 2H). LCMS (ESI) m/z: 444.2[M+H].sup.+.
[0127] The following compounds having the following characteristic data were obtained from compound 5-6 as common intermediate by using the same synthesis and separation methods as those used for compound 5-7 (carboxylic acids compounds with different substituents from compound 5-7 were added):
##STR00047##
[0128] Compound 5-9: Use HPLC (neutral separation condition, chromatographic column: Waters Xbridge 150 mm*25 mm 5 μm; mobile phase: [H.sub.2O(10 mM NH.sub.4HCO.sub.3)-ACN]; B(CH.sub.3CN)%: 18%-32%, 9 min) for separation, retention time of 2.117 min. .sup.1H NMR (400 MHz, METHANOL-d.sub.4) δ 7.60-7.68 (m, 1H), 7.52 (d, J=8.6 Hz, 1H), 7.05 (dd, J=3.4, 6.8 Hz, 1H), 3.44-3.73 (m, 4H), 3.31 (br s, 2H), 2.11 (td, J=7.6, 14.9 Hz, 3H), 2.01 (br t, J=7.3 Hz, 1H), 1.96 (br s, 1H), 1.66-1.88 (m, 6H), 1.31 (br s, 1H), 1.02-1.10 (m, 2H), 0.91-0.99 (m, 2H). LCMS (ESI) m/z: 407.2[M+H].sup.+.
[0129] Compounds 5-10: SFC chiral resolution condition, chromatographic column: DAICEL CHIRALCEL OD-H(250 mm*30 mm, 5 μm); mobile phase: [0.1% NH.sub.3H.sub.2O EtOH]; B(CO.sub.2)%: 40%-40%, retention time of 4.114 min. .sup.1H NMR (400 MHz, METHANOL-d.sub.4) 6=7.52 (br d, J=8.0 Hz, 1H), 7.40 (br d, J=8.8 Hz, 1H), 6.89-6.98 (m, 1H), 3.57 (t, J=7.0 Hz, 1H), 3.25-3.51 (m, 6H), 1.78-2.09 (m, 5H), 1.51-1.76 (m, 6H), 0.94 (br d, J=3.8 Hz, 2H), 0.79-0.88 (m, 2H). LCMS (ESI) m/z: 450.2[M+H].sup.+.
Example 5
[0130] ##STR00048## ##STR00049##
[0131] Step 1: At −78° C., LiHMDS(1 M, 1.3 mL) was dripped into THF (8 mL) containing compound 6-1 (250 mg, 986.8 μmol). The mixture was stirred for 1 hour at −78° C. At −78° C., tetrahydrofuran (4 mL) containing 1,1,1-trifluoro-N-phenyl-N-(trifluoromethyl sulfonyl) methane sulfonamide (388 mg, 1.1 mmol) was dripped to the reaction solution, and then stirred for 12 hours at 25° C. TLC (PE:EA=5:1) showed raw materials were completely reacted, and new points were generated. The reaction solution was quenched by using 10 mL saturated ammonium chloride solution, then added with 20 mL water, and extracted by EtOAc (30 mL*3). Organic phases were combined, washed by saturated saline solution (40 mL), dried by anhydrous sodium sulfate, filtered and concentrated to provide coarse product, then separated and purified by chromatographic column (SiO.sub.2, PE:EA=20:1 10:1) to provide compound 6-2.
[0132] Step 2: KOAc (295 mg, 3.0 mmol) and Pd(dppf)Cl.sub.2.CH.sub.2Cl.sub.2 (82 mg, 100 μmol) were added into DMF (5 mL) solution containing compound 6-2 (386 mg, 1.0 mmol) and bis(pinacolato)diboron (254 mg, 1.0 mmol). The reaction solution was stirred for 12 hours at 70° C. TLC(PE:EA=5:1) showed raw materials were consumed completely, and generation of new points were detected. The reaction solution was added with 20 mL water, and extracted by EtOAc (30 mL*3). Organic phases were combined, washed by saline solution (40 mL), dried by anhydrous sodium sulfate, filtered and concentrated to provide coarse product, which was separated and purified by chromatographic column (SiO.sub.2, PE:EA=50:0 20:1) to provide compound 6-3.
[0133] Step 3: Dioxane (4 mL) and water (1 mL) solution containing compound 6-3 (186 mg, 512 μmol), N-(5-bromo-[1,2,4]triazolo[1,5-a]pyridine-2-yl)cyclopropane formamide (144 mg, 512 μmol), K.sub.2CO.sub.3 (212 mg, 1.5 mmol), Pd(dppf)Cl.sub.2.CH.sub.2Cl.sub.2 (42 mg, 51.2 μmol) was replaced by nitrogen for 3 times. In nitrogen condition, the mixture was stirred for 12 hours at 90° C. LCMS showed raw materials were consumed completely, and target molecular ion peaks were detected. The reaction solution was removed of solvent, dispersed in 10 mL water, and extracted by DCM:MeOH (10:1, 30 mL*3). Organic phases were combined, washed by saturated saline solution (40 mL), dried by anhydrous sodium sulfate, filtered, and then distillated under reduced pressure to provide a coarse product. The coarse product was purified by chromatographic column method (SiO.sub.2, DCM:MeOH=1:0 20:1) to provide compound 6-4. LCMS (ESI) m/z: 438.7[M+H].sup.+.
[0134] Step 4: In argon atmosphere, Pd/C (10%, 50 mg) was into methanol solution (10 mL) containing compound 6-4 (196 mg, 448 μmol). The mixture was replaced by hydrogen for 3 times, and then stirred for 16 hours in hydrogen atmosphere (15 psi) at 25° C. LCMS showed raw materials were consumed completely, and target molecular ion peaks were detected. The reaction solution was filtered, then concentrated to provide compound 6-5, which was directly used in following reactions without purification. LCMS (ESI) m/z: 440.3[M+H].sup.+.
[0135] Step 5: Dichloromethane (10 mL) solution containing compound 6-5 (130 mg, 296 μmol) and TFA (4 mL) was replaced by nitrogen for 3 times, and then stirred for 30 minutes at 25° C. LCMS showed raw materials were consumed completely, and target molecular ion peaks were detected. The reaction solution was concentrated to remove the solvent, to provide compound 6-6 (134 mg, TFA salt), which was directly used in following reactions without purification.
[0136] Step 6: EDCI (85 mg, 443.3 μmol), HOBt (60 mg, 443.3 μmol), and DIEA (115 mg, 886.5 μmol, 154.4 μL) were added into DMF (4 mL) containing (1S)-2,2-bifluorocyclopropanecarboxylic acid (36 mg, 295.5 μmol), stirred to react for 5 minutes at 25° C., then added with compound 6-6 (134 mg, 295.5 μmol, TFA salt), and stirred for 16 hours at 25° C. LCMS showed that raw materials were consumed completely, and target molecular ion peaks were detected. Coarse product was separated (neutral condition, chromatographic column: Waters Xbridge 150*25 5 μm; mobile phase: [water (10 mM NH.sub.4HCO.sub.3)-ACN]; B %: 30%-50%, 7 min) and SFC chiral separation (chromatographic column: YMC CHIRAL Amylose-C(250 mm*30 mm, 10 μm; mobile phase: [0.1% NH.sub.3H.sub.2O EtOH]; B %: 50%). Compound 6-7 was obtained with a SFC retention time of 2.339 min. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.01 (br s, 1H), 7.51-7.63 (m, 2H), 7.08 (br d, J=6.78 Hz, 1H), 3.83 (br s, 1H), 3.41-3.66 (m, 4H), 3.15 (br d, J=5.02 Hz, 1H), 2.14-2.35 (m, 2H), 2.06 (br s, 1H), 1.75-1.95 (m, 4H), 1.40-1.73 (m, 6H), 0.84 (br s, 4H). LCMS (ESI) m/z: 444.1[M+H].sup.+. Compound 6-8: SFC retention time is, 4.142 min. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.01 (br s, 1H), 7.54-7.65 (m, 2H), 7.08 (br s, 1H), 3.80-3.90 (m, 1H), 3.45-3.66 (m, 4H), 3.09-3.22 (m, 1H), 2.18-2.36 (m, 2H), 2.06 (br s, 1H), 1.75-1.95 (m, 4H), 1.68 (br d, J=7.28 Hz, 3H), 1.50 (br d, J=4.77 Hz, 3H), 0.77-0.88 (m, 4H). LCMS (ESI) m/z: 444.1 [M+H].sup.+.
Example 6
[0137] ##STR00050## ##STR00051##
[0138] Step 1: At −78° C., LiHMDS (1 M, 1.7 mL) was added into THF (8 mL) solution containing compound 7-1 (0.3 g, 1.33 mmol). After stirring for one hour at −78° C., the mixture was dripped with tetrahydrofuran (4 mL) solution containing 1,1,1-trifluoro-N-phenyl-N-(trifluoromethylsulfonyl) methane sulfonamide (523 mg, 1.46 mmol), and then stirred for 12 hours at 25° C. TLC(PE:EA=5:1) showed raw materials were reacted completely, and new points were generated. The reaction solution was quenched by saturated ammonium chloride, then added with 20 mL water, and extracted by EtOAc (30 mL*3). Organic phases were combined, washed by saturated saline solution (40 mL), dried by anhydrous sodium sulfate, filtered and concentrated to provide a coarse product, which was separated and purified by chromatographic column method (SiO.sub.2, PE:EA=20:1-10:1) to provide compound 7-2. .sup.1H NMR (400 MHz, CDCl.sub.3) δ 5.72 (s, 1H), 3.86-3.92 (m, 2H), 3.76-3.82 (m, 2H), 2.53-2.61 (m, 2H), 2.18-2.25 (m, 2H), 1.37 (s, 9H).
[0139] Step 2: KOAc (379 mg, 3.9 mmol) and Pd(dppf)Cl.sub.2.CH.sub.2Cl.sub.2 (105 mg, 128.7 μmol) were added into DMF (5 mL) solution containing compound 7-2 (0.46 g, 1.3 mmol) and bis(pinacolato)diboron (327 mg, 1.3 mmol). The reaction solution was stirred for 12 hours at 70° C. TLC(PE:EA=5:1) showed raw materials were reacted completely, and generation of new points were detected. The reaction solution was quenched by adding 20 mL water, and extracted by EtOAc (30 mL*3). Organic phases were combined, washed by saturated saline solution (40 mL), dried by anhydrous sodium sulfate, filtered and concentrated to provide a coarse product, which was purified by chromatographic method (SiO.sub.2, PE:EA=50:0 20:1) to provide compound 7-3. .sup.1H NMR (400 MHz, CDCl.sub.3) δ 6.45 (t, J=1.88 Hz, 1H), 3.83-3.88 (m, 2H), 3.73-3.78 (m, 2H), 2.36-2.42 (m, 2H), 2.04 (t, J=7.03 Hz, 2H), 1.37 (s, 9H), 1.21 (s, 12H).
[0140] Step 3: Dioxane (4 mL) and water (1 mL) solution containing compound 7-3 (0.15 g, 447.43 μmol), N-(5-bromo-[1,2,4]triazolo[1,5-a]pyridine-2-yl)cyclopropane formamide(126 mg, 447.43 μmol), K.sub.2CO.sub.3(186 mg, 1.34 mmol), and Pd(dppf)Cl.sub.2.CH.sub.2Cl.sub.2 (37 mg, 44.7 μmol) was replaced by nitrogen for 3 times. The mixture was stirred in nitrogen atmosphere for 12 hours at 90° C. LCMS showed that raw materials were consumed completely, and target molecular ion peak were detected. The reaction solution was concentrated to remove solvent, then dispersed in 10 mL water, and extracted by DCM:MeOH (10:1, 30 mL*3). Organic phases were combined, washed by saturated saline solution (40 mL), dried by hydrous sodium sulfate, filtered, and distillated under reduced pressure to provide coarse product, which was purified by chromatographic column method (SiO.sub.2, DCM:MeOH=1:0 20:1) to provide compound 7-4. LCMS (ESI) m/z: 410.2[M+H].sup.+.
[0141] Step 4: In argon atmosphere, Pd/C (10%, 0.05 g) was added into methanol (10 mL) solution containing compound 7-4 (0.15 g, 366.3 μmol). The mixture was replaced by hydrogen for 3 times, and then stirred for 16 hours in hydrogen atmosphere (15 psi) at 25° C. LCMS showed raw materials were consumed completely, and target molecular ion peaks were detected. The reaction solution was filtered, and concentrated to provide compound 7-5, which was directly used in following reactions without purification. LCMS (ESI) m/z: 412.2[M+H].sup.+.
[0142] Step 5: Dichloromethane solution (10 mL) containing compound 7-5 (0.13 g, 315.9 μmol) and TFA (4 mL) was replaced by nitrogen for 3 times, and then stirred for 30 minutes at 25° C. LCMS showed raw materials were consumed completely, and target molecular ion peaks were detected. The reaction solution and remove solvent to provide compound 7-6 (130 mg, TFA salt), which was directly used in following reactions without purification. LCMS (ESI) m/z: 312.1[M+H].sup.+.
[0143] Step 6: EDCI (88 mg, 458.4 μmol), HOBt (62 mg, 458.4 μmol), and DIEA (119 mg, 916.8 μmol, 160 μL) were added into DMF (4 mL) solution containing (1S)-2,2-bifluorocyclopropyl formic acid (37 mg, 305.6 μmol) then stirred to react for 5 minutes at 25° C., then added with compound 7-6 (0.13 g, 305.6 μmol, TFA salt), and stirred for 16 hours at 25° C. LCMS showed that raw materials were consumed completely, and target molecular ion peaks were detected. The coarse product was separated (chromatographic column: Waters Xbridge 150*25 5 μm; mobile phase: [H.sub.2O(10 mM NH.sub.4HCO.sub.3)-ACN]; B(CH.sub.3CN)%: 20%-50%, 7 min) and chiral separation (chromatographic column: DAICEL CHIRALPAK AD(250 mm*30 mm, 10 μm); mobile phase, A %: (0.1% NH.sub.3H.sub.2O EtOH); B(CO.sub.2)%:(40%-40%) to provide compound 7-7, SFC retention time: 3.714 min.
[0144] .sup.1H NMR (400 MHz, CDCl.sub.3) δ=9.59 (br d, J=12.05 Hz, 1H), 7.34-7.57 (m, 2H), 6.70-6.84 (m, 1H), 4.06-4.21 (m, 2H), 3.92-3.99 (m, 1H), 3.74-3.92 (m, 2H), 1.81-2.38 (m, 8H), 1.59 (dtd, J=11.36, 7.62, 7.62, 3.76 Hz, 1H), 1.08-1.24 (m, 2H), 0.79-0.96 (m, 2H). LCMS (ESI) m/z: 416.0[M+H].sup.+. Separation was performed to provide compound 7-8, SFC retention time: 4.468 min. .sup.1H NMR (400 MHz, CDCl.sub.3) δ=9.48 (br s, 1H), 7.34-7.54 (m, 2H), 6.76 (br d, J=7.03 Hz, 1H), 4.03-4.25 (m, 2H), 3.73-3.99 (m, 3H), 2.50 (ddd, J=16.81, 13.18, 8.16 Hz, 1H), 1.80-2.40 (m, 8H), 1.53-1.66 (m, 1H), 1.05-1.23 (m, 2H), 0.80-0.95 (m, 2H). LCMS (ESI) m/z: 416.0[M+H].sup.+.
Example 7
[0145] ##STR00052## ##STR00053##
[0146] Step 1: In nitrogen atmosphere, mixed dioxane (40 mL) and water (10 mL) solution containing compound 8-1 (1.11 g, 5.21 mmol), compound 1-3, potassium carbonate (2.16 g, 15.6 mmol), and 1,1′-Bis(diphenylphosphino)ferrocene-palladium(II)dichloride dichloromethane (425 mg, 520.6 μmol) was replaced by nitrogen for 3 times, and then heated to 90° C. to react for 3 hours. LC-MS showed reaction was complete. The reaction solution was concentrated under reduced pressure to provide residues, which were separated by rapid column (04% methanol/dichloromethane) to provide compound 8-2. LCMS (ESI) m/z: 356.3[M+H].sup.+.
[0147] Step 2: Under the protection of N.sub.2 atmosphere, compound 8-2 (2 g, 5.6 mmol) was dissolved into methanol (100 mL) solution, added with catalyst, that is, dry palladium/carbon (0.5 g, 10%), and replaced by hydrogen for 3 times. The reaction solution was stirred for 12 hours in the condition of hydrogen pressure (30 Psi) and reaction temperature of 30° C. LC-MS showed 50% of the raw materials were remained. The catalyst was removed by filtration, new catalyst, that is, dry palladium/carbon (1 g) was added, and the reaction was continued for 3 hours. LCMS showed that reaction was complete. The solid was filtered by diatomite to provide filtrate, which was concentrated under reduced pressure to provide compound 8-3. LCMS (ESI) m/z: 358.2[M+H].sup.+.
[0148] Step 3: (1R)-2,2-difluorocyclopropyl carboxylic acid (282 mg, 2.3 mmol) was dissolved into pyridine (10 mL), added with EDCI (4.0 g, 21.0 mmol) and compound 8-3 (0.75 g, 2.1 mmol), and stirred for 12 hours at 10° C. LC-MS showed reaction was complete. The reaction solution was diluted by water (30 mL), and extracted with dichloromethane/methanol (10/1, 50 mL*3). The combined organic phases were washed by saturated saline solution (30 mL), dried by anhydrous sodium sulfate, filtered and concentrated under reduced pressure. Residues were separated by rapid silicon gel column (0-3% methanol/dichloromethane), and then beating-purified by EtOAc to provide compound 8-4. LCMS (ESI) m/z: 462.3[M+H].sup.+.
[0149] Step 4: Compound 8-4 (300 mg, 650.1 μmol) was dissolved into dichloromethane (5 mL), added with hydrochloric acid/EtOAc (4 M, 10 mL), and left to react for half-hour at 15° C. LC-MS showed that reaction was complete. The reaction solution was concentrated to provide compound 8-5 (hydrochloride). LCMS (ESI) m/z: 362.2[M+H].sup.+.
[0150] Step 5: Compound 8-5 (100 mg, 251.4 μmol, HCl) was dissolved into N,N-dimethyformamide (5 mL), added with HOBt (51 mg, 377.0 μmol) and EDCI (72.28 mg, 377.0 μmol), then added with (1S)-2,2-difluorocyclopropyl carboxylic acid (34 mg, 276.5 μmol) and diisopropylethylamine (65 mg, 502.7 μmol), and left to react for 12 hours at 15° C. LC-MS showed that reaction was complete. The reaction solution was concentrated under reduced pressure, and the residues were processed by preparative HPLC (neutral system) to provide compound 8-6. .sup.1H NMR (400 MHz, METHANOL-d.sub.4) δ7.59-7.67 (m, 1H), 7.51 (d, J=8.78 Hz, 1H), 7.01 (br d, J=7.53 Hz, 1H), 3.92-4.20 (m, 2H), 3.79-3.88 (m, 1H), 3.67-3.77 (m, 1H), 3.43-3.57 (m, 1H), 2.81 (br s, 1H), 2.62 (dq, J=7.78, 11.96 Hz, 1H), 2.07-2.24 (m, 5H), 1.52-2.05 (m, 7H). LCMS (ESI) m/z: 466.2[M+H].sup.+.
[0151] The following compounds 8-7 and 8-8 having the following characteristic data were obtained from compound 8-5 as common intermediate by using the same synthesis and separation methods as those used for compound 8-6 (carboxylic acids compounds with different substituents from compound 8-6 were added)
##STR00054##
[0152] Compound 8-7, Coarse product was processed by preparative HPLC (neutral system) for purification. .sup.1H NMR (400 MHz, METHANOL-d.sub.4) δ 7.59-7.66 (m, 1H), 7.51 (d, J=8.78 Hz, 1H), 6.97-7.04 (m, 1H), 4.30 (d, J=4.27 Hz, 1H), 4.18 (d, J=4.27 Hz, 1H), 3.87 (s, 1H), 3.76 (s, 1H), 3.49 (br t, J=11.80 Hz, 1H), 2.81 (br s, 1H), 2.05-2.28 (m, 5H), 1.74-1.96 (m, 3H), 1.53-1.70 (m, 2H), 1.23-1.33 (m, 4H). LCMS (ESI) m/z: 448.2[M+H].sup.+.
[0153] Compound 8-8, Coarse product was processed by preparative HPLC (neutral system) for purification. .sup.1H NMR (400 MHz, METHANOL-d.sub.4) δ7.59-7.67 (m, 1H), 7.51 (d, J=8.78 Hz, 1H), 7.00 (t, J=7.40 Hz, 1H), 4.61 (s, 2H), 3.69-4.11 (m, 4H), 3.41-3.54 (m, 1H), 2.82 (br s, 1H), 2.04-2.26 (m, 5H), 1.72-1.93 (m, 3H), 1.61 (q, J=11.80 Hz, 2H). LCMS (ESI) m/z: 429.0[M+H].sup.+.
##STR00055##
[0154] Synthesis of compound 8-9: Intermediate 8-5 (100 mg, 227.6 μmol, TFA) was dissolved into N,N-dimethylformamide (5 mL), added with potassium carbonate (94 mg, 682.7 μmol) and 2-bromoacetonitrile (30 mg, 250.3 μmol), and stirred for 12 hours at 10° C. LC-MS showed reaction was complete. The reaction solution was diluted by water (5 mL), and extracted by dichloromethane/methanol (10/1, 10 mL). The organic phases were washed by saturated saline solution (10 mL), dried by anhydrous sodium sulfate, then filtered and concentrated under reduced pressured under reduced pressure. Residues were processed by preparative HPLC (neutral system) for purification, to provide compound 8-9. .sup.1H NMR (400 MHz, METHANOL-d.sub.4) δ 7.59-7.66 (m, 1H), 7.50 (d, J=8.78 Hz, 1H), 6.99 (d, J=7.53 Hz, 1H), 3.62 (s, 2H), 3.46 (br t, J=12.05 Hz, 1H), 3.33 (s, 2H), 3.21 (s, 2H), 2.80 (br s, 1H), 2.14 (br d, J=9.79 Hz, 5H), 1.82-1.95 (m, 1H), 1.52-1.77 (m, 4H). LCMS (ESI) m/z: 401.0[M+H].sup.+.
Example 8
[0155] ##STR00056##
[0156] Step 1: (S)-2,2-difluorocyclopropyl carboxylic acid (1.13 g, 9.2 mmol) was dissolved into pyridine (150 mL), added with EDCI (16.1 g, 84 mmol) and compound 8-3 (3 g, 8.4 mmol), and stirred for 12 hours at 10° C. LC-MS showed that reaction was complete. The reaction solution was diluted by aq(100 mL), and then extracted by dichloromethane/methanol(10/1, 100 mL*3). The combined organic phases were washed by saturated saline solution (30 mL), then dried by anhydrous sodium sulfate, filtered and concentrated under reduced pressure. Residues were separated by rapid column (0-3% methanol/dichloromethane), and then beating-purified by using EtOAc to provide compound 9-1. LCMS (ESI) m/z: 462.3[M+H].sup.+.
[0157] Step 2: Compound 9-1 (2.3 g, 4.9 mmol) was dissolved into dichloromethane (5 mL), added with hydrochloric acid/EtOAc (4 M, 20 mL), and left to react for half-hour at 15° C. LC-MS showed that reaction was complete, and target molecular ion peaks were detected. The precipitated solid was filtered, and dried to provide compound 9-2 (hydrochloride). LCMS (ESI) m/z: 362.2[M+H].sup.+.
[0158] Step 3: Compound 9-2 (1.23 g, 3.1 mmol, HCl) was dissolved into N,N-dimethylformamide (20 mL), add HOBt (626 mg, 4.6 mmol) and EDCI(889 mg, 4.6 mmol), then added with (1S)-2,2-difluorocyclopropyl carboxylic acid (414.92 mg, 3.40 mmol) and diisopropylethylamine (798.70 mg, 6.18 mmol), and left to react for 12 hours at 15° C. LC-MS showed that reaction was complete. The reaction solution was diluted by water (10 mL), and extracted by dichloromethane/methanol (10/1, 50 mL). Organic phases were washed by saturated saline solution (10 mL), dried by anhydrous sodium sulfate, filtered and concentrated under reduced pressure. Residues were processed by preparative HPLC (neutral system) to provide compound 9-3. .sup.1H NMR (400 MHz, METHANOL-d.sub.4) δ 7.63 (dd, J=7.53, 8.78 Hz, 1H), 7.51 (d, J=8.78 Hz, 1H), 7.01 (br d, J=7.28 Hz, 1H), 3.92-4.19 (m, 2H), 3.79-3.87 (m, 1H), 3.67-3.76 (m, 1H), 3.44-3.55 (m, 1H), 2.52-2.92 (m, 2H), 1.53-2.25 (m, 12H). LCMS (ESI) m/z: 466.1[M+H].sup.+.
[0159] The following compounds 9-4, 9-5 having the following characteristic data were obtained from compound 9-2 as common intermediate by using the same synthesis and separation methods as those used for compound 9-3 (carboxylic acids compounds with different substituents from compound 9-3 were added):
##STR00057##
[0160] Compound 9-4: .sup.1H NMR (400 MHz, METHANOL-d.sub.4) δ 7.58-7.68 (m, 1H), 7.51 (d, J=8.78 Hz, 1H), 6.97-7.05 (m, 1H), 4.30 (d, J=4.02 Hz, 1H), 4.18 (d, J=4.27 Hz, 1H), 3.87 (s, 1H), 3.76 (s, 1H), 3.49 (br t, J=11.80 Hz, 1H), 2.82 (br s, 1H), 2.07-2.25 (m, 5H), 1.73-1.95 (m, 3H), 1.51-1.70 (m, 2H), 1.24-1.35 (m, 4H). LCMS (ESI) m/z: 448.2[M+H].sup.+.
[0161] Compound 9-5: .sup.1H NMR (400 MHz, METHANOL-d.sub.4) δ 7.58-7.68 (m, 1H), 7.51 (d, J=9.03 Hz, 1H), 7.00 (t, J=7.53 Hz, 1H), 4.61 (s, 2H), 3.69-4.10 (m, 4H), 3.43-3.55 (m, 1H), 2.82 (br s, 1H), 2.05-2.25 (m, 5H), 1.72-1.97 (m, 3H), 1.51-1.69 (m, 2H). LCMS (ESI) m/z: 429.0[M+H].sup.+.
##STR00058##
[0162] Synthesis of compound 9-6: The intermediate compound 9-2 (190 mg, 525.8 μmol) was dissolved into N,N-dimethylformanide (5 mL), potassium carbonate (218 mg, 1.6 mmol) and 2-bromoacetonitrile (70 mg, 578.3 μmol) were added, reaction solution was stirred for 12 hours at 10° C. LC-MS showed that reaction was complete. Reaction solution was diluted with water (5 mL), extracted by dichloromethane/methanol (10/1, 10 mL), washed organic phase by saturated saline solution (10 mL), dried by anhydrous sodium sulfate, filtered and concentrated under reduced pressure. Residues were processed by preparative HPLC (neutral system) for purification, to provide compound 9-6. .sup.1H NMR (400 MHz, METHANOL-d.sub.4) δ7.58-7.66 (m, 1H), 7.50 (d, J=8.53 Hz, 1H), 6.99 (d, J=7.28 Hz, 1H), 3.62 (s, 2H), 3.46 (br t, J=11.42 Hz, 1H), 3.33 (s, 2H), 3.21 (s, 2H), 2.81 (br s, 1H), 2.14 (br d, J=10.29 Hz, 5H), 1.81-1.95 (m, 1H), 1.51-1.78 (m, 4H). LCMS (ESI) m/z: 401.2[M+H].sup.+.
Example 9
[0163] ##STR00059## ##STR00060##
[0164] Step 1: Mixed dioxane (12 mL) and H.sub.2O (3 mL) containing compound 10-1 (100 mg, 334.3 μmol), compound 3-3 (126 mg, 334.3 μmol), Pd(dppf)Cl.sub.2 (25 mg, 33.4 μmol), and potassium carbonate (139 mg, 1.00 mmol) was replaced by nitrogen by 3 times, and stirred in nitrogen atmosphere for 2 hours at 90° C. LCMS showed that raw materials were consumed completely, and the main peak was detected as target molecular ion peak. The reaction solution was filtered and concentrated to remove solvent, and separated and purified by using a preparation plate to provide compound 10-2. LCMS (ESI) m/z: 470.4[M+H].sup.+.
[0165] Step 2: Dichloromethane (1 mL) solution containing compound 10-2 (130 mg, 276.9 μmol) and HCl/EtOAc (4 M, 2 mL) was stirred for 5 minutes at 25° C. LCMS showed that raw materials were consumed completely, and the main peak was detected as target molecular ion peak. Reaction solution was concentrated under reduced pressure to provide yellow solid compound 10-3 (120 mg, hydrochloride), which was directed used in following reactions without purification. LCMS (ESI) m/z: 370.6[M+H].sup.+.
[0166] Step 3: In nitrogen atmosphere, Pd/C (20 mg, 10%) was added into MeOH (25 mL) solution containing compound 10-3 (120 mg, 295.6 μmol, hydrochloride). Suspension was replaced by hydrogen for 3 times, and then stirred for 12 hours in nitrogen atmosphere (15 Psi), 25° C. LCMS showed that raw materials were consumed completely, and main peak was detected as target molecular ion peak. Reaction solution was filtered, concentrated under reduced pressure to remove the solvent, and provide compound 10-4 (130 mg, hydrochloride), which was directly used in following reactions without purification. LCMS (ESI) m/z: 372.3[M+H].sup.+.
[0167] Step 4: DMF (5 mL) solution containing compound 10-4 (130 mg, 318.7 μmol, hydrochloride), 2-cyanoacetic acid (33 mg, 382.4 μmol), EDCI (92 mg, 478 μmol), HOBt (65 mg, 478 μmol) and DIEA (206 mg, 1.6 mmol, 277.6 μL) was stirred for 12 hours at 25° C. LCMS showed that raw materials were consumed completely, and target molecular ion peaks were detected. Reaction solution was concentrated under reduced pressure to remove solvent, and then separated to provide compound (neutral system) 10-5. .sup.1H NMR (400 MHz, METHANOL-d.sub.4) δ=7.57-7.65 (m, 1H), 7.49-7.55 (m, 1H), 3.59-3.81 (m, 3H), 3.44-3.54 (m, 2H), 3.34-3.38 (m, 2H), 2.48 (br s, 2H), 1.81-2.04 (m, 5H), 1.64-1.77 (m, 2H), 1.36-1.58 (m, 4H), 0.86-1.12 (m, 4H). LCMS (ESI) m/z: 439.1[M+H].sup.+.
Biological Activity Test
Experiment 1: In Vitro Test of Activities of Jak1, Jak2, Jak3, Tyk2 Kinases
Materials
[0168] Recombinant human JAK1, JAK2, JAK3, Tyk2 protease, most of the apparatuses and reagents were supplied by Eurofins (UK).
Methods
[0169] Dilution of JAK2, JAK3 and TYK2: 20 mM 3-(N-morpholine)propanesulfonic acid (MOPS), 1 mM EDTA, 0.01% Brij-35.5% glycerol, 0.1% β-mercaptoethanol, 1 mg/mL BSA; Dilution of JAK1: 20 mM TRIS, 0.2 mM EDTA, 0.1% $-mercaptoethanol, 0.01% Brij-35.5% glycerol. All the compounds were prepared into 100% DMSO solution and the concentration reached final measured concentration of 50 times. The test compound was diluted by a 3-fold concentration gradient, and the final concentration was 9 concentrations from 10 μM to 0.001 μM. The content of DMSO in the detect reaction was 2%. The stock solution of this compound was added into wells as a first component, then the other components were added as the following detailed process.
Enzyme Reaction of JAK1(h)
[0170] JAK1(h) was incubated with 20 mM Tris/HC pH7.5, 0.2 mM EDTA, 500M MGEEPLYWSFPAKKK, 10 mM magnesium acetate and [y-.sup.33P]-ATP (activities and concentration were customized as required). Mixture of Mg/ATP was added to start reaction, which was stopped by adding 0.5% phosphoric acid after 40 minutes incubation at room temperature. Then 10 μL of the reaction was dispersed on the P30 filter pad, washed with 0.425% phosphoric acid for three times and with methanol for one time within 4 minutes, dried, and scintillate counted.
Enzyme Reaction of JAK2(h)
[0171] JAK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC, 10 mM magnesium acetate and [γ-.sup.33P]-ATP (activities and concentration were customized as required). Mixture of Mg/ATP was added to start reaction, which was stopped by adding 0.5% phosphoric acid after 40 minutes incubation. Then 10 μL of the reaction solution was dispersed on the P30 filter pad, washed with 0.425% phosphoric acid for three times and with methanol for one time within 4 minutes, dried, and scintillate counted.
Enzyme Reaction of JAK3(h)
[0172] JAK3(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 500 μM GGEEEEYFELVKKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activities and concentration were customized as required). Mixture of Mg/ATP was added to start reaction, which was stopped by adding 0.5% phosphoric acid after 40 minutes incubation. Then 10 μL of the reaction solution was dispersed on the P30 filter pad, washed with 0.425% phosphoric acid for three times and with methanol for one time within 4 minutes, dried, and scintillate counted.
Enzyme Reaction of TYK2(h)
[0173] TYK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 M GGMEDIYFEFMGGKKK, 10 mM magnesium acetate and [γ-.sup.33P]-ATP (activities and concentration were customized as required). Mixture of Mg/ATP was added to start reaction, which was stopped by adding 0.5% phosphoric acid after 40 minutes incubation. Then 10 μL of the reaction solution was dispersed on the P30 filter pad, washed with 0.425% phosphoric acid for three times and with methanol for one time within 4 minutes, dried, and scintillate counted.
Data Analyses
[0174] Results of IC.sub.50 were provided by analysis of XLFIT5 (205 formula) from IDBS, and details are shown in table 1.
TABLE-US-00001 TABLE 1 The test results of compound screening in vitro TYK2 JAK1 JAK2 JAK3 Compounds (IC.sub.50, nM) (IC.sub.50, nM) (IC.sub.50, nM) (IC.sub.50, nM) 1-7 38 6 60 3834 1-8 27 14 78 2939 1-9 366 34 315 >10000 1-10 311 32 426 >10000 1-11 18 15 198 >10000 1-12 360 45 527 >10000 1-13 36 3 37 1517 1-14 134 12 144 5035 1-15 106 20 208 9669 1-16 581 114 1020 >10000 1-17 371 65 791 >10000 3-7 26 3 40 1002 3-8 26 20 80 2323 3-9 155 54 294 >10000 4-6 307 170 2008 8448 4-7 194 436 7685 >10000 4-8 >10000 244 3711 364 5-7 67 31 324 5759 5-8 692 75 789 7349 5-9 278 68 520 >10000 5-10 1526 131 2730 >10000 6-7 829 63 998 9391 6-8 570 381 1924 >10000 7-7 830 63 1632 >10000 7-8 404 176 2313 >10000 8-6 127 14 110 7637 8-7 1032 63 5463 >10000 8-8 109 60 1376 >10000 8-9 1329 52 3672 >10000 9-3 105 7 292 >10000 9-4 1186 253 982 >10000 9-5 175 224 624 >10000 9-6 1388 432 1174 >10000 10-5 430 336 812 5410
[0175] Conclusion: The compounds in the present application showed good selectivity inhibition to JAK1 and/or TYK2 in the in vitro test of activities of the 4 subtypes of kinases JAK1, JAK2, JAK3 and TYK2 kinases.
Experiment 2: Pharmacokinetics (PK)Test
[0176] The clear solution obtained by dissolving the test compound was injected into the tail vein and intragastrically administered to male mice (C57BL/6) or rats (SD) (overnight fasting, 7-8 weeks old). After administration of the test compound, for the intravenous group (2 mg/kg) at 0.117, 0.333, 1, 2, 4, 7 and 24 hours and the intravenous group (15 mg/kg) at 0.25, 0.5, 1, 2, 4, 8 and 24 hours, blood was collected from the mandibular vein and centrifuged to obtain plasma. LC-MS/MS method was used to determine the plasma concentration, and the WinNonlin™ Version 6.3 pharmacokinetic software was used to calculate the relevant pharmacokinetics by the non-compartmental model linear logarithmic ladder method Parameters. The test results are as follows:
TABLE-US-00002 TABLE 2-1 The result of PK test of compound 1-11 in mice PK parameters Results T.sub.1/2 (hr) 2.99 C.sub.max (nM) 5745 AUC.sub.0-inf (nM .Math. hr) 9918 Bioavailability (%).sup.a 42.1%
TABLE-US-00003 TABLE 2-2 The result of PK test of compound 1-13 in mice PK parameters Results T.sub.1/2 (hr) 1.61 C.sub.max (nM) 5105 AUC.sub.0-inf (nM .Math. hr) 9917 Bioavailability (%).sup.a 38.1%
TABLE-US-00004 TABLE 2-3 The result of PK test of compound 3-7 in mice PK parameters Results T.sub.1/2 (h) 4.74 C.sub.max (nM) 7380 AUC.sub.0-inf (nM .Math. h) 17969 Bioavailability (%).sup.a 50.1%
Note: T.sub.1/2: half-life; C.sub.mx: peak concentration;
[0177] AUC.sub.0-inf: AUC of plasma concentration-time from time 0 to infinity;
Conclusion: Compound in the present application has good bioavailability, high exposure, and excellent in vivo efficacy.
Experiment 3: In Vivo Efficacy Study of Collagen-Induced Arthritis (CIA) in Mice
Experimental Purpose:
[0178] Rheumatoid arthritis (RA) is a type of multiple autoimmune diseases with a global incidence rate of about 1%, which leads to inflammation, damages and malformation of arthrosis, and in serious situation, leads to systemic inflammation reactions. Studies of drugs for RA treatment can help ease the symptom of rheumatoid arthritis, and can improve quality of life of a patient. Collagen-induced mice arthritis model is an animal model often used to evaluate the efficacy of drugs in the treatment of RA. Its pathogenesis and symptoms are significantly related to RA disease. The reactivity of B cells and T cells to bone collagen are activated by injecting type II collagen in the model, and activated B cells and T cells enter the joint site to cause joint damage, which triggers a series of symptoms similar to human rheumatoid arthritis. Evaluation of drug treatment for rheumatoid before clinical in the process of candidate compounds for arthritis, collagen-induced arthritis in mice is often used to evaluate its effectiveness.
[0179] The purpose of the experiment is to study the therapeutic effects of compound 1-13, compound 3-7 and reference compound Filgotinib in collagen-induced arthritis of mice, thus to provide pre-clinical pharmacodynamic information for subsequent clinical studies.
Experimental Methods:
1. Type II Collagen/Complete Freund's Adjuvant Immune
[0180] Preparation of acetic acid: 2N acetic acid was diluted to100 mM, filtered by 0.22 micron filter membrane, and stored at 4° C.
[0181] Bovine type 2 collagen (CII) was dissolved in 100 mM acetic acid solution, then stored overnight at 4° C. Final concentration of the collagen is 8 mg/ml.
[0182] Preparation of emulsion: the overnight stored CII solution was mixed with equal volume of complete Freund's adjuvant, and homogenized on ice on a high-speed homogenizer at 30,000 revolutions per minute for approximately 60 minutes until the solution forms a stable emulsion.
2. Induction of Arthritis:
[0183] Mice were randomly divided into different treatment groups. The day for the first immunization is recorded as day 0, and the subsequent days are marked in order.
[0184] DBA/1 mice were anesthetized with isoflurane and injected with 50 ml prepared collagen emulsion (containing 200 mg CII) subcutaneously (2-3 cm from the root of the tail). At day 21, the tail was injected with the same volume of collagen emulsion in the same way. The mice in the normal group was not immunized.
3. Designs of Administration and Dosages
[0185] At day 28, when average clinical score is about 1, 50 mice with moderate incidence were selected ad randomly divided into 5 treatment groups based on body weights and scores, with each group having 8 mice.
[0186] Dexamethasone (Dex.) was used as a reference drug for measuring whether the model was successfully established, with a dose of 0.3 mg/kg (a commonly used dose in a CIA model). In addition, according to the results of preliminary experiments, the dosages of test compound 1-13, compound 3-7 and reference compound Filgotinib were determined and shown in table 3-1: the first group is of normal mice without any treatment; the second group is a blank group given only solvent; the third group is given a dose of 0.3 mg/kg of dexamethasone; the sixth group, the seventh group and the eighth group are given the dose of 15 mg/kg. They were administered twice a day for a total of 14 days.
TABLE-US-00005 TABLE 3-1 Design of dosages and grouping Names of test Administration Concentration Administration Groups drugs Numbers route mg/mL Dosage mg/kg frequency G1 Normal 5 N/A N/A N/A N/A G2 Blank (Solvent 8 p.o. N/A N/A bid, 14 days control) G3 dexamethasone 8 p.o. 0.03 0.3 qd, 14 days (Dex.) G6 Compound 8 p.o. 1.5 15 bid, 14 days 1-13 G7 Compound 3-7 8 p.o. 1.5 15 bid, 14 days G8 Filgotinib 8 p.o. 1.5 15 bid, 14 days Note: PO: oral; bid: twice a day; qd: once a day.
4. Measuring of Incidence Index of Arthritis
[0187] Clinical observation: from 7 days before immunization to the 21st day after immunization, the basic health status and weight changes of DBA/1 mice was observed daily (recorded once a week). After the 22nd day, the health status, the incidence circumstances, and weight changes of the mice was observed every day (recorded at least three times a week) until the end of the experiment.
[0188] Clinical scoring: the incidence of the mice was observed every day after boosting the immune function. After the mice was attacked (showing clinical symptoms of arthritis), the incidence was scored from 0-4 as scoring standard according to different levels of the disease (redness, joint deformation). The highest score for each limb is 4, and the highest score for each animal is 16. The scoring standards are shown in Table 3-2. The scoring was performed three times a week.
TABLE-US-00006 TABLE 3-2 Clinical scoring criteria of arthritis Scores Clinical symptoms 0 No erythema and swelling 1 Erythema or slight swelling near tarsal bone or ankle or metatarsal bone, and swelling on one toe 2 Slight erythema and swelling on ankle and metatarsal bone, or swellings on more than two toes 3 Moderate erythema and swelling on ankle and wrist joints and metatarsal bone 4 Severe swelling on all of ankle and wrist joints, metatarsal bone and toes
5. Statistic Processing
[0189] The experimental data is expressed as mean standard error (Mean SEM), and the area under the curve (AUC) is analyzed by one-way ANOVA. P<0.05 is considered to be significant.
Experimental Results:
1. Clinical Scoring and Incidence:
[0190] At day 28 after the first immune (day 7 after the second immune), mice began to show clinical symptoms of arthritis. The administration was started at day 28. The detailed experimental results were showed in table 5 and
TABLE-US-00007 TABLE 3-3* Average clinical scores of the present application G6 G7 G1 Date G2 Blank group G3 Dex Compound1-13 Compound3-7 G8 Filgotinib Normal 21 0.00 ± 0.00 0.00 ± 0.00 0.00 ± 0.00 0.00 ± 0.00 0.00 ± 0.00 0.00 ± 0.00 24 0.00 ± 0.00 0.00 ± 0.00 0.00 ± 0.00 0.00 ± 0.00 0.00 ± 0.00 0.00 ± 0.00 27 0.38 ± 0.18 0.25 ± 0.16 0.50 ± 0.19 0.50 ± 0.19 0.25 ± 0.16 0.00 ± 0.00 28 0.50 ± 0.19 0.50 ± 0.27 0.63 ± 0.26 0.63 ± 0.26 0.63 ± 0.26 0.00 ± 0.00 29 1.38 ± 0.38 0.25 ± 0.16 1.00 ± 0.38 0.75 ± 0.25 0.88 ± 0.40 0.00 ± 0.00 31 2.50 ± 0.73 0.00 ± 0.00 1.38 ± 0.53 1.00 ± 0.33 1.88 ± 0.81 0.00 ± 0.00 34 4.25 ± 0.73 0.00 ± 0.00 1.50 ± 0.63 1.63 ± 0.38 2.63 ± 0.82 0.00 ± 0.00 36 4.75 ± 1.08 0.00 ± 0.00 1.75 ± 0.67 2.50 ± 0.46 3.88 ± 1.27 0.00 ± 0.00 38 5.38 ± 1.00 0.00 ± 0.00 1.88 ± 0.77 3.13 ± 0.58 4.88 ± 1.39 0.00 ± 0.00 41 5.75 ± 0.96 0.00 ± 0.00 1.50 ± 0.71 3.00 ± 0.60 5.63 ± 1.45 0.00 ± 0.00 *Note: average clinical score ± standard error
[0191] By analyzing the clinical scoring curve of each animal in each group, the area under the curve (AUC) was calculated, and the inhibition rate of each administration group relative to the solvent control group was calculated by the AUC average between groups. The detailed results are shown in Table 3-4 and
TABLE-US-00008 TABLE 3-4* AUC of incidence G2 Blank group G3 Dex G6 Compound1-13 G7 Compound3-7 G8 Filgotinib AUC ± SEM 51.75 ± 10.97 1.38 ± 0.81 20.75 ± 8.05 26.63 ± 4.57 42.06 ± 12.50 Inhibition rate N/A 97.3% 59.9% 48.6% 18.7% *Note: the value of the area under the curve is fitted according to the animal's clinical software Graphpad Prism ®, and they are the area under the incidence curve of each mouse in each group during the administration period. Inhibition rate = (average area under the curve in the blank group Value-the average of the area under the curve of the administration group)/the average of the area under the curve of the blank group
[0192] Various treatment factors can also affect the incidence of collagen-induced arthritis. The detailed results of the experiment are shown in Table 7 and
TABLE-US-00009 TABLE 3-5* Incidence of the present application Date G2 Blank group G3 Dex G6 Compound1-13 G7 Compound3-7 G8 Filgotinib G1 Normal 21 0% 0% 0% 0% 0% 0% 24 0% 0% 0% 0% 0% 0% 27 38% 25% 50% 50% 25% 0% 28 50% 38% 50% 50% 50% 0% 29 75% 25% 63% 63% 50% 0% 31 75% 0% 63% 75% 75% 0% 34 100% 0% 63% 88% 88% 0% 36 100% 0% 63% 100% 88% 0% 38 100% 0% 63% 100% 88% 0% 41 100% 0% 63% 100% 100% 0% *Note: incidence = the number of pathogenic animals in each group/the total number of animals in each group *100%
2. Body Weight
[0193] The detailed results of the experiment are shown in Table 8 and
TABLE-US-00010 TABLE 3-6* Average body weight in the present application Date G2 Blank group G3 Dex G6 Compound1-13 G7 Compound3-7 G8 Filgotinib G1 Normal 21 22.38 ± 0.23 22.41 ± 0.26 22.38 ± 0.30 22.59 ± 0.27 22.63 ± 0.27 22.30 ± 1.10 24 21.89 ± 0.67 22.36 ± 0.20 22.33 ± 0.37 22.66 ± 0.28 22.50 ± 0.33 23.00 ± 1.07 27 21.96 ± 0.63 22.35 ± 0.25 21.99 ± 0.44 22.10 ± 0.33 22.25 ± 0.32 23.22 ± 1.11 28 22.14 ± 0.56 22.43 ± 0.26 22.08 ± 0.51 22.36 ± 0.30 22.30 ± 0.35 23.12 ± 1.12 29 21.89 ± 0.47 21.51 ± 0.23 21.59 ± 0.41 22.26 ± 0.38 21.95 ± 0.40 23.30 ± 1.15 31 21.64 ± 0.48 21.24 ± 0.23 21.80 ± 0.58 22.40 ± 0.42 21.61 ± 0.49 23.78 ± 1.17 34 22.21 ± 0.54 20.71 ± 0.26 22.18 ± 0.53 22.25 ± 0.49 21.46 ± 0.57 23.70 ± 1.24 36 22.40 ± 0.52 21.28 ± 0.20 22.53 ± 0.47 22.46 ± 0.42 21.84 ± 0.61 24.26 ± 1.36 38 21.79 ± 0.44 19.91 ± 0.20 22.09 ± 0.40 21.88 ± 0.49 20.88 ± 0.54 23.56 ± 1.32 41 23.06 ± 0.49 20.84 ± 0.30 22.99 ± 0.34 22.59 ± 0.43 22.30 ± 0.52 24.24 ± 1.42 *Note: average body weight ± standard error
Conclusion: In the collagen-induced mice arthritis (CIA) model, the compounds according to the present application showed a good therapeutic effect on the disease, with no significant effect on the body weight of mice, and has better in vivo efficacy than Filgotinib at the same dose.
Experiment 4: In Vivo Efficacy Study of Adjuvant Induced Arthritis (AIA)
Experimental Purpose:
[0194] Adjuvant induced arthritis (AIA) rat model is one of the commonly used animal models in rheumatoid arthritis disease research and new drug development. Its pathogenesis and clinical symptoms are similar to those of human rheumatoid arthritis. The model is established by injecting Mycobacterium tuberculosis into the footpad to induce immune cells and antibodies with bone and joint damage functions, which caused a systemic response manifested as joint swelling, osteolysis, synovial damage and other symptoms similar to human rheumatoid arthritis. The purpose of this experiment is to evaluate the therapeutic effect of compound 1-13 on adjuvant-induced arthritis rat model by using dexamethasone and filgotinib as reference compounds. There are 8 groups in this experiment, namely the normal group (Normal group), the solvent control group (Vehicle group), compound 1-13 1 mg/kg BID, 3 mg/kg BID, 10 mg/kg BID and 30 mg/kg BID dose groups, the positive drug dexamethasone 0.3 mg/kg QD group and the reference compound Filgotinib 30 mg/kg BID group. Except for the normal group, all the rats were injected with Freund's complete adjuvant subcutaneously into the left foot on day 0 to induce arthritis. According to the experimental protocol, groups were grouped according to body weight and scores, and the administration was started on the 13th day, which continued for 14 days. During the experiment, the body weight, feet volume (measured three times a week after the 13th day) and clinical score of the rats were monitored. At the end of the experiment, the right hind feet of rats were collected for hematoxylin-eosin staining (HE) staining for pathological score analysis.
Experimental Method:
1. Arthritis Model
[0195] Adjuvant preparation: 100 mg of Mycobacterium tuberculosis H37Ra were weighted, ground for about 5 minutes, added with 3 mL of paraffin oil to dissolve the powder, and transferred to a brown dispensing bottle. The mortar was washed twice with 3 mL and 4 mL of paraffin oil, and all the oil were transferred into the brown dispensing bottle, which had a final concentration of 10 mg/mL. The solution was broken by ultrasonic wave in an ice-water mixture for about 30 minutes.
2. Induction of Arthritis
[0196] The prepared adjuvants were homogenized under shaking, and removed of air bubbles by drawing with a 1 mL glass syringe (20 G needle), and then a 25 G needle. The rats were anesthetized with isoflurane. Before immunization, the syringe was turned upside down, so that the Mycobacterium tuberculosis was thoroughly mixed. After anesthesia, 0.1 mL of adjuvant was injected subcutaneously into the sole of the left foot of the rat. The day of the injection of 0.1 mL of paraffin oil subcutaneously in the soles of the rats in the normal group was the 0th day.
3. Administration
[0197] On the 13th day, all the animals showed symptoms of arthritis such as erythema or swelling of the feet, and they were stratified and randomly grouped according to score, foot size and weight. The grouping was shown in Table 9. 70 rats were divided into 7 groups, 10 rats in each group, and 5 rats in the normal group. According to Table 4-1, the dosage of each group is as follows. The intragastric administration volume was 5 mL/kg. Compound was administered twice a day for a total of 14 days.
TABLE-US-00011 TABLE 4-1 Grouping and dosage design Concentration Dosage Administration Group Test drugs Number Administration mg/mL mg/kg frequency G1 Normal 5 N/A N/A N/A N/A G2 Vehicle 10 p.o. N/A N/A bid, 14 days G3 Dex. 10 po 0.06 0.3 qd, 14 days G4 Filgotinib 10 p.o. 6 30. bid. 14 days G5 Compound1-13 10 p.o. 0.2 1 bid, 14 days G6 Compound1-13 10 p.o. 0.6 3 bid, 14 days G7 Compound1-13 10 p.o. 2 10 bid, 14 days G8 Compound1-13 10 p.o. 6 30 bid, 14 days
4. Determination of the Incidence of Arthritis
[0198] Weight: the rats were weighed for three times a week from day 13 to day 27.
[0199] Foot volume: it was measured once before immunization, three times a week from the 13th day to the 27th day.
[0200] Scoring: the scoring was performed for three times a week from the 13th day to the 27th day. According to the different degrees of the lesions (redness, joint deformation) and the standard of 0-4 points, the highest score for each limb is 4 points, and the highest score for each animal is 12 points (except for the left hind limb on the injection side). The scoring standards are shown in Table 4-2.
TABLE-US-00012 TABLE 4-2 Clinical scoring criteria of arthritis Scores Clinical symptoms 0 No erythema and swelling 1 Erythema or slight swelling on tarsal bone nearby or ankle or metatarsal bone, or erythema and swelling on one toe 2 Slight erythema and swelling on ankle and metatarsal bone, erythema and swelling on two or more toes 3 Moderate erythema and swelling on ankles, wrist joints and metatarsal bone 4 Severe swelling on all of ankles, wrist joints, metatarsal bone and toes
5. Pathological Analysis
[0201] On day 27, the rats were euthanized. After blood collection, the right hind leg of the rat was taken, soaked in 10% formalin solution, decalcified with formic acid solution, embedded in paraffin, sectioned, HE stained, and observed under microscope. The degree of joint damage was evaluated from four aspects: inflammatory cell infiltration, pannus formation, cartilage injury and bone resorption, and scored according to the 0-4 points standard. The scoring standards are as follows (Table 4-3)
TABLE-US-00013 TABLE 4-3 Standard for pathology score of arthritis Lesion Lesion characteristics Score inflammatory cell infiltration There was no inflammatory cells observed; 0 The subsynovial cells were fibrotic with minimal cellularinfiltration; 1 Synovial cells proliferated with a small number of mononuclear cells 2 infiltrated; Synovial cell proliferation, a large number of monocytes, plasma cells, 3 lymphocytes infiltrated; A large number of inflammatory cell infiltrated around tire joint, tissue 4 fibrosis, synovial thickening; Pannus formation No pannus formation were observed; 0 There was very little pannus formation in the margin of cartilage; 1 There was a proliferation of intercartilaginous fibrous tissue with a small 2 amount of pannus formation at the joint margin; Pannus formation was present on 50% of articular cartilage; 3 Pannus formation was observed throughout the articular cartilage; 4 cartilage injury No cartilage injury was observed; 0 Articular chondrocytes proliferated; 1 The chondrocyte matrix was lost and a small number of chondrocytes were 2 destroyed; There was a proliferation of fibrous tissue around the joint and a large 3 number of chondrocytes are destroyed; There was a lot of fibrous tissue hyperplasia between articular cartilage, 4 cartilage erosion; Bone resorption No bone resorption was observed; 0 Minimal bone resorption was observed at the synovial margin; 1 A small number of osteoclasts can be formed in small areas of bone tissue; 2 Local subarticular cartilage bone tissue with bone resorption; 3 Bone resorption in large areas of bone tissue with cartilage erosion; 4
6. Statistical Processing
[0202] The experimental data is expressed by Mean i Standard Error (Mean±SEM), and weight, clinical score, and pathology score are expressed by One-way ANOVA, and p<0.5 is considered to be significant
Experimental Results:
1. Clinical Scoring
[0203] This experiment evaluated the improvement effect of compound 1-13 on clinical scores in a rat arthritis (AIA) model by using dexamethasone and Filgotinib as references. Rats began to develop arthritis symptoms on the 6th day after adjuvant immunization. The administration started on the 13th day, and the average clinical score of the solvent control group gradually increased. Experimental results showed that the average clinical score of the solvent control group reached a peak on the 24th day and were stabilized at about 8 points, indicating the successful establishment of the AIA model (
[0204] At the end of the experiment (day 27), compound 1-13 at four doses of 1, 3, 10, and 30 mg/kg significantly inhibited the clinical score of arthritic rats (compared with the solvent control group, p values are all <0.0001), and the clinical scores of arthritic rats were reduced to 5.4, 3.9, 3.2 and 2.7, respectively, in a dose-dependent manner (compared with the high-dose group and the low-dose group, p<0.0001). Among them, the effect of compound 1-13 at 30 mg/kg is the most obvious (starting from day 17, there is a very significant difference compared with the solvent control group, p<0.0001). The average arthritis clinical score of this group is 6.0 from the peak on day 13, dropped to 2.7 points on the 27th day of the experimental end point (
[0205] The average clinical score of the positive control dexamethasone treatment group reached the highest value of 6.0 after the 13th day. After the administration, the clinical score continued to decline and dropped to 2.7 at the experimental end point on the 27th day. Compared with the control group, there is a very significant difference (
2. Feet Volume
[0206] This experiment evaluated the effect of compound 1-13 on foot volume in a rat arthritis (AIA) model, with dexamethasone and Filgotinib as references. The average foot volume of animals in the solvent control group increased steadily from 1.9 mL on day 13 to 2.9 mL at the end of the experiment on day 27, marking the successful establishment of the AIA model (
3. Weight
[0207] Compared with the normal group, the body weight of the rats was reduced after immunizing and modeling. After the start of administration on the 13th day, the body weight of each administration group increased slowly and continuously compared with the solvent control group, while the weight of the positive control dexamethasone group recovered more slowly, which suggests that the rats tolerate Filgotinib and compound 1-13 well. The body weight of the compound 1-13 30 mg/kg group increased the fastest, and the body weights for 4 dosages were increased in a dose-dependent manner (
[0208] 4 Histopathological Test Results
[0209] Arthritis rats in the solvent control group had a total pathological score of 16±0.00, and for those administrated with compound 1-13 at a dose of 1 mg/kg, the score decreased to 13.3±0.44 (compared with the solvent control group, P=0.09, no statistical difference), with an inhibition rate of 16.9%; while the 3 mg/kg, 10 mg/kg and 30 mg/kg doses can significantly reduce the pathological scores of arthritic rats to 11.3 1.64, 4.4±1.16 and 1.6±0.47, respectively, with p values of 0.014, <0.0001 and <0.0001, and inhibition rate of 29.4%, 72.5% and 90%. The reference compound Filgotinib 30 mg/kg had a total pathological score of 15.2±0.49, and the inhibition rate was 5%. There was no significant difference compared with the solvent group. Compound 1-13 at the same dose (30 mg/kg) has a total pathological score of significantly lower than Filgotinib (p<0.0001). The control compound dexamethasone at 0.3 mg/kg dose extremely significantly reduced the pathological score of arthritic rats to 4.4 0.8, p value<0.0001, inhibition rate 72.5% (Table 4-7).
TABLE-US-00014 TABLE 4-4 Clinical scoring dexamethasone acetate Filgotinib Compound1-13 Normal group Solvent control group group (0.3 mg/kg) (30 mg/kg) (1 mg/kg) Standard Standard Standard Standard Standard Days Average error Average error Average error Average error Average error 13 0.0 0.0 6.1 0.5 6.0 0.5 6.0 0.6 6.0 0.5 15 0.0 0.0 7.3 0.4 5.3* 0.5 6.6 0.5 6.9 0.5 17 0.0 0.0 7.6 0.4 4.1**** 0.5 6.3 0.6 6.7 0.4 20 0.0 0.0 7.8 0.4 3.4**** 0.5 5.8** 0.6 6.0* 0.4 22 0.0 0.0 8.0 0.4 3.1**** 0.5 5.5*** 0.6 5.8** 0.4 24 0.0 0.0 8.1 0.3 3.1**** 0.5 5.4**** 0.5 5.6*** 0.4 27 0.0 0.0 8.1 0.3 2.9**** 0.5 5.1**** 0.5 5.4**** 0.3 Compound1-13 Compound1-13 Compound1-13 (3 mg/kg) (10 mg/kg) (30 mg/kg) Standard Standard Standard Days Average error Average error Average error 13 6.0 0.6 6.1 0.5 6.0 0.5 15 5.8 0.5 5.5* 0.4 4.5*** 0.4 17 5.4** 4.4 4.4**** 0.4 3.1**** 0.2 20 4.1**** 3.8 3.8**** 0.2 3.0**** 0.2 22 4.0**** 3.7 3.7**** 0.3 2.8**** 0.2 24 4.0**** 3.4 3.4**** 0.2 2.7**** 0.2 27 3.9**** 3.2 3.2**** 0.1 2.7**** 0.2 *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001 vs. Solvent control group, one-way ANOVA.
TABLE-US-00015 TABLE 4-5 Feet volume dexamethasone acetate Filgotinib Compound1-13 Normal group Solvent control group group (0.3 mg/kg) (30 mg/kg) (1 mg/kg) Standard Standard Standard Standard Days Average Standard error Average error Average error Average error Average error 13 1.1 0.0 1.9 0.1 1.9 0.1 1.9 0.1 1.9 0.1 15 1.1 0.0 2.3 0.1 1.7**** 0.1 2.2 0.1 2.0 0.1 17 1.1 0.0 2.4 0.1 1.4**** 0.1 2.0** 0.1 2.0** 0.1 20 1.0 0.0 2.5 0.1 1.3**** 0.1 1.9**** 0.1 1.9**** 0.1 22 1.1 0.0 2.6 0.1 1.3**** 0.1 2.0**** 0.1 1.9**** 0.1 24 1.1 0.0 2.8 0.1 1.2**** 0.1 2.0**** 0.1 1.9**** 0.1 27 1.1 0.0 2.9 0.1 1.2**** 0.1 1.9**** 0.1 1.9**** 0.1 Compound1-13 Compound1-13 Compound1-13 (3 mg/kg) (10 mg/kg) (30 mg/kg) Standard Standard Standard Days Average error Average error Average error 13 1.9 0.1 1.9 0.1 1.9 0.1 15 2.0* 0.1 1.8*** 0.1 1.6**** 0.1 17 1.9**** 0.1 1.6**** 0.1 1.4**** 0.1 20 1.8**** 0.1 1.5**** 0.1 1.3**** 0.1 22 1.7**** 0.1 1.4**** 0.1 1.2**** 0.0 24 1.6**** 0.1 1.3**** 0.1 1.2**** 0.0 27 1.6**** 0.1 1.3**** 0.1 1.2**** 0.0 *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001 vs. Solvent control group, one-way ANOVA.
TABLE-US-00016 TABLE 4-6 Body weight dexamethasone acetate Filgotinib Compound1-13 Normal group Solvent control group group (0.3 mg/kg) (30 mg/kg) (1 mg/kg) Standard Standard Standard Standard Standard Days Average error Average error Average error Average error Average error 0 177.6 2.0 182.0 2.3 182.2 2.7 182.7 2.9 182.0 1.6 13 210.2 3.4 168.1 3.3 169.1 2.5 168.0 3.0 168.0 1.3 15 209.8 3.1 167.7 3.1 162.4 2.1 167.5 2.9 170.1 2.0 17 212.5 2.7 168.0 3.0 160.5 1.5 168.3 3.0 168.9 1.5 20 216.9 3.7 166.9 3.0 161.6 2.2 169.7 2.8 168.1 1.5 22 218.8 3.1 168.9 3.0 163.5 2.2 171.2 2.6 169.6 1.4 24 218.7 3.5 171.7 2.7 163.7 2.0 174.3 3.7 173.6 1.8 27 220.1 3.7 177.2 2.8 163.4** 2.7 181.7 3.5 180.9 1.8 Compound1-13 Compound1-13 Compound1-13 (3 mg/kg) (10 mg/kg) (30 mg/kg) Standard Standard Standard Days Average error Average error Average error 0 187.0 2.2 181.6 2.2 181.2 2.3 13 169.6 1.4 168.5 2.5 169.3 2.2 15 172.3 1.5 171.1 2.7 174.8 2.2 17 170.9 1.7 175.2 2.7 180.6** 2.4 20 172.8 1.5 179.9 3.3 188.9**** 2.5 22 177.0 1.3 186.3**** 3.5 196.0**** 2.2 24 179.8 1.8 190.1**** 2.5 198.8**** 2.2 27 188.6* 1.7 198.2**** 2.9 206.3**** 2.7 *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001 vs. Solvent control group, one-way ANOVA.
TABLE-US-00017 TABLE 4-7 Pathological Scoring Pathology Scoring (mean value ± standard error) inflammatory cell Pannus articular Bone Group infiltration formation injury resorption Total score Normal group 0.0 ± 0.0 0.0 ± 0.0 0.0 ± 0.0 0.0 ± 0.0 0.0 ± 0.0 Solvent control group 4.0 ± 0.0 4.0 ± 0.0 4.0 ± 0.0 4.0 ± 0.0 16.0 ± 0.0 dexamethasone acetate 1.8 ± 0.2 1.4 ± 0.3 0.6 ± 0.2 0.6 ± 0.2 4.4 ± 9.8**** group (0.3 mg/kg) Filgotinib (30 mg/kg) 4.0 ± 0.0 3.9 ± 0.1 3.7 ± 0.2 3.6 ± 0.2 15.2 ± 0.5 Compound1-13 (1 mg/kg) 3.6 ± 0.3 3.5 ± 0.3 3.3 ± 0.4 2.9 ± 0.5 13.3 ± 1.4 Compound1-13 (3 mg/kg) 3.3 ± 0.3 3.2 ± 0.3 2.5 ± 0.5 2.3 ± 0.5 11.3 ± 1.6* Compound1-13 (10 mg/kg) 1.7 ± 0.3 1.4 ± 0.4 0.8 ± 0.3 0.5 ± 0.3 4.4 ± 1.2**** Compound1-13 (30 mg/kg) 0.6 ± 0.2 0.5 ± 0.2 0.3 ± 0.1 0.2 ± 0.1 1.6 ± 0.5**** *p < 0.05, ****p < 0.001, v.s. Solvent control group, One-way ANOVA.
Conclusion: The rats in the solvent control group showed clinical symptoms of arthritis and continued to worsen. Compared with the solvent control group, compounds 1-13 (1, 3, 10, 30 mg/kg), Filgotinib (30 mg/kg) and dexamethasone (0.3 mg/kg) showed a significant inhibit effect on adjuvant-induced arthritis, which is manifested by delayed onset time, and significantly reduced clinical symptoms and pathological changes, and compound 1-13 has a dose-dependent therapeutic effect on adjuvant-induced arthritis model. The above experimental results show that compound 1-13 has a significant therapeutic effect on adjuvant-induced arthritis in rats and the effect is better than Filgotinib.