PCSK9 INHIBITORY POLYPOLYPEPTIDES AND METHODS OF USE

20210162000 · 2021-06-03

    Inventors

    Cpc classification

    International classification

    Abstract

    The present invention relates to PCSK9 inhibitors and methods of use thereof. Specifically, the invention relates to PCSK9 cell-based assay, PCSK9 inhibiting polypeptides and derivatives thereof. The invention includes pharmaceutical compositions comprising a PCSK9 inhibitor polypeptide together with a pharmaceutically acceptable carrier and method for treating cardiovascular disorders, hyperlipidemia, inflammatory diseases or inflammatory response to infection.

    Claims

    1. A method of reducing circulating LDL-cholesterol levels in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of a conjugated polypeptide comprising a contiguous amino acid sequence of at least 20 amino acids in length, wherein the contiguous amino acid sequence is substantially homologous to SEQ. ID. NO. 4, wherein at least part of the contiguous amino acid sequence is exposed after folding of the conjugated polypeptide, wherein the conjugated polypeptide is conjugated to one or more polymer moieties, and wherein the conjugated polypeptide binds to PSCK9.

    2. The method according to claim 1, wherein the polypeptide comprises SEQ. ID. NO. 4.

    3. The method according to claim 1, wherein the polypeptide comprises one of SEQ. ID. NO. 5 and 6.

    4. The method according to claim 1, wherein the polypeptide comprises a polypeptide selected from SEQ. ID NO. 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46 or 48.

    5. The method according to claim 1, wherein the polypeptide consists of SEQ. ID. NO. 4.

    6. The method according to claim 1, wherein the polypeptide consists of one of SEQ. ID. NO. 5, 6 or 7.

    7. The method according to claim 1, wherein the polypeptide consists of a polypeptide selected from SEQ. ID NO. 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, or 48.

    8. The method according to claim 1, wherein the contiguous amino acid sequence is at least 90% homologous with SEQ. ID. NO. 4.

    9. The method according to claim 1, wherein the contiguous amino acid sequence is at least 90% homologous with SEQ. ID. NO. 5, 6, or 7.

    10. The method according to claim 1, wherein the polypeptide consists of a polypeptide having at least 90% sequence homology with a polypeptide selected from SEQ. ID NO. 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 48 or 49.

    11. The method according to claim 1, wherein the polypeptide is conjugated to NH2- group at its C-terminus.

    12. The method according to claim 1, wherein the polypeptide is conjugated to CH3-CO— group at its N-terminus.

    13. The method according to claim 1, wherein the polypeptide is conjugated to an N terminal blocking group selected from a N-acetyl amino acid, a glycosylated amino acid, a pyrrolidone carboxylate group, an acetylated amino acid, a formylated amino acid, myristic acid, and pyroglutamate.

    14. The method according to claim 1 wherein said polymer moiety is conjugated to at least one of the N-terminus, the C-terminus, a lysine side chain, and an arginine side chain.

    15. The method according to claim 1 wherein said polymer moiety is conjugated by means of at least one of an amine bond, a hydroxy succinimide bond, and an aldehyde bond.

    16. The method according to claim 1 wherein said polymer moiety has a molecular weight between 0.6 and 5.0 kDa.

    17. The method according to claim 1 wherein said polymer moiety is polyethylene glycol.

    18. The method according to claim 1 wherein said polymer moiety comprises a contiguous amino acid sequence having 3 to 35 amino acids, wherein said contiguous amino acid sequence is at least 90% homologous with a contiguous sequence of SEQ. ID. NO. 61, 62 or 63.

    19. The method according to claim 1 wherein one or more polypeptide bonds are replaced with a polypeptide bond isostere selected from: —CH2-NH— or —C(═O)—NR—wherein the amide group is alkylated with a R group selected from: methyl, ethyl, n-propyl, isopropyl, cyclopropyl, n-butyl, isobutyl, sec-butyl or tert-butyl; —C(═O)—NH—CH2-, CH2-S—, CH2-S(O)n- (where n is 1 or 2); —CH2-CH2-, —CH═CH—, —CH(CN)—NH—; —CH(OH)—CH2-, —O—C(—O)—NH—; and —NHC(═O)NH—.

    20. The method according to claim 1, wherein said pharmaceutically effective amount is between 0.0001 to 1.0 milligrams per kilogram.

    21. The method according to claim 1, wherein the polypeptide has a sequence set forth in SEQ. ID. 4 or has sequence set forth SEQ. ID. 4 in which one or more of the substitutions set forth in TABLE 2 for SEQ. ID. 4 have been made.

    22. (canceled)

    23. The method according to claim 1, wherein the polypeptide is between 27 and 169 amino acids in length.

    24. The method according to claim 1, wherein the subject has hyperlipidemia.

    25. The method according to claim 1, wherein the conjugated polypeptide is a competitive inhibitor of proprotein convertase subtilisin/kexin type 9 (PCSK9) binding to low-density lipoprotein receptors (LDLR).

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0057] FIG. 1: Identification of GRP94 as a new PCSK9 interacting protein. (a) Endogenous PCSK9 was immunoprecipated from HepG2 cell lysates in RIPA buffer (IP: PCSK9). Pre-immune serum was used as a control. Precipitated protein samples were separated by SDS-PAGE electrophoresis and revealed by silver staining. Excised bands were analyzed by mass spectrometry. (b) Huh-7 and HepG2 cells were transfected without (IRES-V5) or with plasmids encoding either PCSK9-V5 or PCSK9-L455X-V5. PCSK9 (SEQ. ID. NO. 1) was immune-precipitated using mAb-V5 antibody, proteins were separated by SDS-PAGE and revealed by silver staining. GRP94 (SEQ. ID. NO. 3) and GRP78 were identified by mass spectrometry from excised bands. (c) HepG2 cells were transfected without (IRES-V5) or with plasmids encoding various V5-tagged PCSK9 (PCSK9-V5, PCSK9-L455X-V5, PCSK9-CHRD-V5) or human LDLR-V5. V5-tagged proteins were immune-precipitated from cell lysates (IP: V5) and immune-blotted (IB) for GRP94 and V5. Total input GRP94 protein levels were also analyzed by immune-blotting and herein used as a control. (d) HepG2 cells were transfected with PCSK9-V5. GRP94 was immune-precipitated from cell lysates and co-immuno-precipitated PCSK9 was revealed using a mAb-V5 antibody. (e) Subcellular co-localization of PCSK9 and GRP94 in Huh-7 cells was visualized by confocal microscopy. Data are representative of at least three independent experiments.

    [0058] FIG. 2: Mapping of the PCSK9-GRP94 interacting domain. (a-b) HEK293 cells were transfected without (−) or with (+) PCSK9-V5 or SEQ ID NO. 66, 64 or 65. A PCSK9 V5 epitope-tag fusion protein (PCSK9-V5) was immune-precipitated from cell lysates using mAb-V5 antibody (IP:V5) and immune-blotted as indicated. Total GRP94 (SEQ. ID. NO. 3) and PCSK9 (SEQ. ID. NO. 1) protein levels were analyzed by immune-blotting in cell lysates (input) and conditioned media. (c) Left panel; HEK293 cells were transfected without (−) or with (+) PCSK9-V5, SEQ. ID. NO. 66 or 46. PCSK9-V5 was immune-precipitated for cell lysates (IP: V5) and immune-blotted (IB) as indicated. Total GRP94 and PCSK9 protein levels were also analyzed by immune-blotting and herein used as a control (input). Right panel; GRP94 homodimer (gray and yellow) crystal structure was determined from PDB file #201V using MacPymol software. This work demonstrates the importance of SEQ ID NO. 6 in which critical residues for PCSK9 binding determined in (b) are indicated in blue for SEQ. ID. NO. 64 and red for SEQ. ID. NO. 65. Data are representative of at least three independent experiments.

    [0059] FIG. 3: GRP94 is not a chaperone for PCSK9. (a) HepG2 cells were incubated overnight without (DMSO) or with 1 or 5 μM Geldanamycin. Total LDLR (SEQ. ID. NO. 2), PCSK9 (SEQ. ID. NO. 1) and β-actin (herein used as control) protein levels in cell lysates and conditioned media were analyzed by immune-blotting as indicated. (b) Left panel; At day 0, HEK293 cells were transfected either with a non-targeting siRNA (−) or with siRNAs against GRP94 (+). Eight hours later, cells were transfected without (pIRES-V5) or with plasmids encoding for PCSK9-V5 or PCSK9-D374Y-V5. At day 2, cells were washed and incubated overnight in conditioned media (DMEM; Cond. Media). PCSK9 was immune-precipitated from cell lysates using mAb-V5 antibody (IP: V5) and immune-blotted (IB) as indicated. Total GRP94, PCSK9, LDLR and β-actin protein levels were analyzed by immune-blotting in cell lysates (input) and conditioned media. Right panel; HepG2 cells were incubated for 24 h in conditioned media derived from HEK293 cells (left panel). Total LDLR, PCSK9-V5 and β-actin protein levels were analyzed by immune-blotting as indicated. Data are representative of at least three to four independent experiments.

    [0060] FIG. 4: Knockdown of GRP94 increases LDLR degradation by PCSK9. At day 0, HEK293 cells were transfected either with a non-targeting siRNA (−) or with siRNAs against GRP94 (+). At day 1, cells were transfected with an empty vector (−) or with plasmids encoding for LDLR-EGFP (SEQ. ID. NO. 69) alone or in combination with PCSK9-mCherry (SEQ. ID. NO. 70). At day 2, cells were washed and incubated overnight with DMSO (−) or 5 μM MG132 overnight in complete media. (a) Total LDLR-EGFP, PCSK9-mCherry, GRP94 and β-actin protein levels were analyzed by immune-blotting in cell lysates as indicated. (b) LDLR-GFP and PCSK9-mCherry were visualized in live cells by confocal microscopy as conditions described above. Data are representative of at least three independent experiments.

    [0061] FIG. 5: SEQ ID NO. 67 blocks PCSK9 internalization and LDLR degradation. Recombinant SEQ ID NO. 67 was added to conditioned media obtained from HEK293 transfected with PCSK9-mCherry or in DMEM together with recombinant human PCSK9, rotated 4 h at 4° C. and added overnight on HepG2 cells as indicated. (a) Following 24 h post-transfection with LDLR-EGFP cDNA (SEQ. ID. NO. 69), HepG2 cells were incubated with PCSK9-mCherry without (−) or with 10 nM SEQ ID NO. 67. Fluorescent proteins were visualized in fixed cells by confocal microscopy. (b) Cells were incubated without or with 25 nM PCSK9 alone or with 0, 10, 25 or 100 nM SEQ ID NO. 67. Total LDLR, SEQ ID NO. 67, PCSK9 and β-actin protein levels were analyzed by immunoblotting in cell lysates and conditioned media as indicated. Data are representative of at least three independent experiments.

    [0062] FIG. 6: SEQ ID NO. 6 reduces PCSK9 binding to LDLR in vitro. Left; Coomassie staining of His.sub.6 tag purified recombinant SEQ ID NO. 6 and PCSK9 produced as described in Material and Methods. Right; PCSK9-V5-His.sub.6 (1 μg) was incubated without (−) or with (+) recombinant SEQ ID NO. 6 (2 μg) in 500 μl of immune-precipitation (IP) buffer (PBS, 1 mM CaCl.sub.2, 1% Tween-20 and protease inhibitors) for 4 h at 4° C. on a rotator. Following incubation, 1 μg of recombinant human LDLR ectodomain was added together with 50 μl of A/G-agarose beads and 1 μg of mAb-V5 antibody and incubated with rotation overnight. Samples were then centrifuged at 3,000×g for 5 min and pellets washed three times with 1 ml IP buffer and rotated for 10 min 4° C. and resuspended in 2× Laemmli loading buffer. Samples were separated by SDS-PAGE and immune-blotted as indicated. Data are representative of two independent experiments.

    [0063] FIG. 7: SEQ ID NO. 6 prevents PCSK9-induced LDLR degradation. (a) Left; Coomassie staining of purified recombinant SEQ ID NO. 6 and PCSK9 separated by SDS-PAGE is shown. Right; HepG2 cells were incubated in DMEM without or with 0, 25, 100 or 250 nM SEQ ID NO. 6 alone or in presence of recombinant PCSK9. (b) HepG2 cells were transfected without (−) or with PCSK9-V5 in absence (−) or presence SEQ ID NO. 66 or SEQ ID NO. 46. Total LDLR, PCSK9, SEQ ID NO. 66, SEQ ID NO. 46 and β-actin protein levels were analyzed by immunoblotting in cell lysates and conditioned media as indicated. Data are representative of at least three independent experiments.

    [0064] FIG. 8: Lldr protein levels are strongly decreased in cGrp94.sup.f/f mice. (a) Relative mRNA levels of Ldlr were measured by quantitative RT-PCR in 2 months-old wild-type littermates (WT) and hepatocyte-specific Grp94 knockout male mice (cGrp94.sup.f/f. (b) Total LDLR, Grp94 and β-actin protein levels were analyzed by immune-blotting in livers of WT and cGrp94.sup.f/f mice. (c) Circulating Pcsk9 was immune-precipitated and relative circulating levels were determined by immune-blotting in WT and cGrp94.sup.f/f mice. Plasma from Pcsk9.sup.−/− mice was used as negative control. (d) Plasma LDL-Cholesterol levels were measured in WT, cGrp94.sup.f/f and Pcsk9.sup.−/− mice a normalized to that of WT littermates. Data and error bars are representative of n=6 animals/group analyzed in duplicate.

    [0065] FIG. 9: Proposed model for the role of GRP94 in the regulation of LDLR by PCSK9. Left; In the absence or GRP94, proPCSK9 (SEQ. ID. NO. 70) or mature PCSK9 might be more bioavailable for binding LDLR thus leading to enhance degradation and high circulating LDL-C. Right; In the presence of GRP94, LDLR protein levels are elevated most probably by preventing early binding of PCSK9 to LDLR and its subsequent intracellular degradation. Addition of exogenous full-length GRP94 or its CBD-CT in circulation may efficiently be used to reduce circulating LDL-Cholesterol or other PCSK9-related diseases. ER; endoplasmic reticulum, TGN; trans-Golgi network, LE/LY; late endosomes/lysosomes, B; apolipoprotein B, PCSK9; proprotein convertase subtilisin/kexin 9, LDLR; low-density lipoprotein receptor, LDL; low-density lipoprotein, GRP94; Glucose-regulated protein 94.

    [0066] FIG. 10: Crystal structure of the SEQ ID NO. 4 interacting with PCSK9. Structure of the SEQ ID NO. 4 was determined by MacPymol and derived from SEQ ID NO. 3 homodimer crystal (PDB #201V).

    [0067] FIG. 11: LC-MS analysis of excised bands. Raw data of polypeptides identified by mass spectrometry following as described in FIG. 1a.

    [0068] FIG. 12: LC-MS analysis of excised bands. Raw data of polypeptides identified by mass spectrometry following as described in FIG. 1b.

    [0069] FIG. 13: Oligonucleotides used for plasmid constructions for PCSK9 fluorescent protein conjugate and LDLR fluorescent protein conjugate.

    [0070] FIG. 14: The inhibitory effect of SEQ ID NO. 6 on PCSK9-LDLR (EGF-AB) binding was analyzed by in vitro competitive assay. Recombinant human SEQ ID NO. 6 was purified and inhibits PCSK9 binding to LDLR (EGF-AB domain) with an IC50 of .sup.˜113 nM). Coomassie staining of SEQ ID NO. 6 is shown. Data represent means of two independent experiments analyzed in duplicate ±S.D. *p<0.05; **p<0.01; ***p<0.001.

    [0071] FIG. 15: Dual fluorescence cell-based assay using PCSK9-WT-mCherry (SEQ. ID. NO. 75) or PCSK9-D374Y-mCherry (SEQ. ID. NO. 76) and LDLR-EGFP (SEQ. ID. NO. 77). Schematic representation of different readouts that could be obtained from PCSK9-mC and LDLR-EGFP co-expressing cells is shown (higher panels). HEK293 were transfected with LDLR-EGFP and incubated for 4 h with WT or D374Y PCSK9-mC containing media obtained from transfected cells without or with 4 nM PCSK9 neutralizing antibody pre-incubated overnight. Selected regions (dashed squares) were 5× zoomed numerically (MAG). Data are representative of at least three independent experiments.

    [0072] FIG. 16: A peptide including SEQ. ID. NO. 4. inhibits binding of PCSK9 to the LDLR EGFA domain.

    DETAILED DESCRIPTION

    [0073] Unless indicated or defined otherwise, all terms used have their usual meaning in the art to which the present invention relates. Reference is for example made to the standard handbooks, such as Sambrook et al., “Molecular Cloning: A Laboratory Manual”, 4th. Ed. Cold Spring Harbor Laboratory Press (2012); F. Ausubel et al., eds., “Current protocols in molecular biology”, Wiley Interscience, (2012); Lewin, “Genes C”, Jones & Bartlett Learning (2011); and Janeway et al., “Immunobiology” (7th Ed.), Garland Science (2008). The terminology used herein is for the purpose of describing particular embodiments only and is not intended to be limiting.

    [0074] Throughout this disclosure, various publications, patents and published patent specifications are referenced by an identifying citation. The disclosures of these publications, patents and published patent specifications are hereby incorporated by reference into the present disclosure to more fully describe the state of the art to which this invention pertains. Are also hereby incorporated by reference U.S. provisional patent applications 62/135,668 filed Mar. 19, 2015 and 62/259,621 filed Nov. 24, 2015 from which the present application claims priority. The present application hereby incorporates by reference the material in the text file 20111-185_SEQList 19Mar16_ST25.txt created on Mar. 19, 2016 of size 143,187 bytes and filed concurrently herewith. This text file contains all the sequences mentioned in the present application.

    Definitions

    [0075] Throughout this specification, unless the context requires otherwise, the word “comprise”, or variations such as “comprises” or “comprising”, will be understood to imply the inclusion of a stated element or integer or group of elements, such as a contiguous amino acid sequence within a polypeptide, or integers but not the exclusion of any other element or integer or group of elements or integers.

    [0076] As used herein the singular forms “a”, “an” and “the” include plural aspects unless the context clearly dictates otherwise. Thus, for example, reference to “a cell” includes a single cell, as well as two or more cells; reference to “an agent” includes one agent, as well as two or more agents; and so forth.

    [0077] Unless otherwise indicated all methods steps and techniques mentioned herein can be performed in a manner known per se, as will be clear to the skilled person.

    [0078] Amino acid residues will be indicated according to the standard three-letter or one-letter code, as mentioned in Table 1. Except were specified to the contrary, the amino acids used in the polypeptides of the invention described herein are D stereoisomer's and not L stereoisomers.

    TABLE-US-00001 TABLE 1 3-letter 1-letter Characteristics Amino Acid code code Non-polar uncharged Alanine Ala A at pH 6.0-7.0 Valine Val V Leucine Leu L Isoleucine Ile I Phenylalanine Phe F Methionine Met M Tryptophan Typ W Proline Pro P Polar uncharged Glycine Gly G at pH 6.0-7.0 Serine Ser S Threonine Thr T Cysteine Cys C Asparagine Asn N Glutamine Gln Q Tyrosine Tyr Y Polar charged Lysine Lys K at pH 6.0-7.0 Arginine Arg R Histidine His H Aspartate Asp D GlutamateG Glu E Synthetic, non Norleucine Nle Z natural amino acids Citrulline Cit Homocysteine Hey Ornithine Orn

    [0079] For the purposes of comparing two or more polypeptide sequences, percentage of “sequence identity” between a first amino acid sequence and a second amino acid sequence (also referred to herein as “amino acid identity” or “sequence homology”) may be calculated by dividing [the number of amino acid residues in the first amino acid sequence that are identical to the amino acid residues at the corresponding positions in the second amino acid sequence] by [the total number of amino acid residues in the first amino acid sequence] and multiplying by [100%]. Each deletion, insertion, substitution or addition of an amino acid residue in the second amino acid sequence—compared to the first amino acid sequence—is considered as a difference at a single amino acid residue (position). Usually, for the purpose of determining the percentage of “sequence identity” between two amino acid sequences in accordance with the calculation method outlined hereinabove, the amino acid sequence with the greatest number of amino acid residues will be taken as the “first” amino acid sequence, and the other amino acid sequence will be taken as the “second” amino acid sequence.

    [0080] Many algorithms exist to determine the degree of identity, homology or similarity between two polypeptides. Usually, the homology can be determined by means of the Lasergene software of the company DNA star Inc., Madison, Wis. (USA), using the CLUSTAL method (Higgins et al, 1989, Comput. Appl. Biosci., 5 (2), 151). Other programs that a skilled person can use for the comparison of sequences and that are based on algorithms are, e.g., the algorithms of Needleman and Wunsch or Smith and Water-man. Further useful programs are the Pile Aupa program (J. MoT Evolution. (1987), 25, 351-360; Higgins et al., (1989), Cabgos, 5, 151-153) or the Gap and Best Fit program (Needleman and Wunsch, (1970), J. MoT Biol, 48, 443-453, as well as Smith and Waterman (1981), Adv., Appl. Math., 2, 482-489) or the programs of the GCG software package of the Genetics Computer Group (575 Science Drive, Madi-son, Wisconsin, USA 53711). Sequence alignments can also be performed with the ClustalW program from the internet page http://www.ebi.ac.uk/clustalw or with the NCBI Blast Sequence alignment program from the internet page www.ncbi.nlm.nih.gov/BLAST/or www.ncbi.nlm.nih.gov/blast/b12seq/wblast2.cgi. Also, the skilled person is aware of the techniques which allow him to isolate homologous sequences from other organisms. He can perform homology comparisons (via CLUSTAL, BLAST, NCBI) and then isolate the identified homologous nucleotide or amino acid sequences by means of standard laboratory methods, e.g. primer design, PCR, hybridisation or screening of cDNA libraries with adequate probes (cf. e.g. Sambrook and Russell (2001) Molecular Cloning: A Laboratory Manual, 3. edition, Cold Spring Harbour Laboratory Press, Cold Spring Harbour, N.Y., USA). The function of the identified proteins can then be determined by the method described herein.

    [0081] In determining the degree of sequence identity or percent homology between two amino acid sequences, the skilled person may take into account so-called “conservative” amino acid substitutions, which can generally be described as amino acid substitutions in which an amino acid residue is replaced with another amino acid residue of similar chemical structure and which has little or essentially no influence on the function, activity or other biological properties of the polypeptide. Such conservative amino acid substitutions are well known in the art, for example from WO 04/037999, GB-A-3 357 768, WO 98/49185, WO 00/46383 and WO 01/09300; and (preferred) types and/or combinations of such substitutions may be selected on the basis of the pertinent teachings from WO 04/037999 as well as WO 98/49185 and from the further references cited therein. Such conservative substitutions preferably are substitutions in which one amino acid within the following groups (a)-(e) is substituted by another amino acid residue within the same group: (a) small aliphatic, nonpolar or slightly polar residues: Ala, Ser, Thr, Pro and Gly; (b) polar, negatively charged residues and their (uncharged) amides: Asp, Asn, Glu and Gln; (c) polar, positively charged residues: His, Arg and Lys; (d) large aliphatic, nonpolar residues: Met, Leu, Ile, Val and Cys; and (e) aromatic residues: Phe, Tyr and Trp. In Particular preferred conservative substitutions are as follows: Ala into Gly or into Ser; Arg into Lys; Asn into Gln or into His; Asp into Glu; Cys into Ser; Gln into Asn; Glu into Asp; Gly into Ala or into Pro; His into Asn or into Gln; Ile into Len or into Val; Leu into Ile or into Val; Lys into Arg, into Gln or into Glu; Met into Leu, into Tyr or into Ile; Phe into Met, into Leu or into Tyr; Ser into Thr; Thr into Ser; Trp into Tyr; Tyr into Trp; and/or Phe into Val, into Ile or into Leu.

    [0082] Alternately amino acid substitutions applied to the polypeptides described herein may also be based on the analysis of the frequencies of amino acid variations between homologous proteins of different species developed by Schulz et al., Principles of Protein Structure, Springer-Verlag, 1978, on the analyses of structure forming potentials developed by Chou and Fasman, Biochemistry 13: 211, 1974 and Adv. Enzymol., 47: 45-149, 1978, and on the analysis of hydrophobicity patterns in proteins developed by Eisenberg et al., Proc. Nad. Acad. Sci. USA 81: 140-144, 1984; Kyte & Doolittle; J. Molec. Biol. 157: 105-132, 198 I, and Goldman et al., Aim. Rev. Biophys. Chem. 15: 321-353, 1986, all incorporated herein in their entirety by reference.

    [0083] “amino acid” refers to either natural and/or non-natural or synthetic amino acids, including glycine and both the D or L optical isomers, and amino acid analogs and peptidomimetics.

    [0084] Peptides of the invention e.g. a polypeptide of 27 to 169 amino acids in length comprising a contiguous amino acid sequence of at least 20 amino acids in length, wherein the contiguous sequence is substantially homologous to SEQ. ID. NO. 4. can be referred to as “PCSK9 modulator” or “PCSK9 binding polypeptide” or “GRP94 polypeptide analogue”.

    [0085] Polypeptides of the invention bind to PCSK9 or a PCSK9-LDLR conjugate in vitro or in vivo and after binding function to prevent or slow internalization of PCSK9 or PCSK9-LDLR from the plasma membrane of hepatic cells into the cell. By virtue of this function peptides of the invention thereby increase cell surface levels of LDLR.

    [0086] “Anti-atherosclerotic agent” means a polypeptide or a composition or formulation thereof that has an anti-atherosclerotic effect in vivo.

    [0087] The term “antibody” is used herein in the broadest sense and specifically covers intact monoclonal antibodies, polyclonal antibodies, multi-specific antibodies (e.g. bi-specific antibodies) formed from at least two intact antibodies, and antibody fragments. “Antibody fragments” comprise only a portion of an intact antibody, generally including an antigen binding site of the intact antibody and thus retaining the ability to bind antigen. The term “monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed usually against a single antigen.

    [0088] “anti-inflammatory agent” means an polypeptide or a composition or formulation thereof that has an anti-inflammatory effect in vivo

    [0089] “Atherogenesis” as used herein means the development process of atheromatous plaques characterized by remodelling of arteries leading to sub-endothelial accumulation of fatty substances or plaques containing excess fat, collagen and elastin. This process involves inflammation and the formation of atheromatous plaques in the region of the vessel wall located between the endothelium and the tunica media. The early stages of atherogenesis are characterized by adhesion of circulating monocytes to the vascular endothelium, migration of these monocytes into the sub-endothelial space and activation of monocyte-derived macrophages. The key driver of this process is oxidized lipoprotein particles such as low-density lipoprotein (LDL) residing within the endothelial wall of the vessel. Active atherogenesis can be present in a subject either at risk of atherosclerosis or with atherosclerosis. When active atherogenesis is detected in a subject, it may indicate either risk of atherosclerosis or with atherosclerosis. Distinguish between risk of atherosclerosis or a diagnosis of atherosclerosis, based on a variety of well-known diagnostic measures and atherosclerosis risk factors, is within the current skill in the art of cardiovascular medical care. Identifying the presence of active atherogenesis in a subject and can facilitate early diagnosis, prevention or treatment of atherosclerosis.

    [0090] “Atherosclerosis” also known as arteriosclerotic vascular disease (ASVD) is characterized by a thickening of an arterial wall as a result of the accumulation of fatty materials such as cholesterol and triglyceride occurring due to atherogenesis. Atherosclerosis is a chronic disease that is asymptomatic for decades. Atherosclerotic plaques can be either stable or unstable (also called vulnerable). Stable plaques are typically asymptomatic. Unstable plaques are prone to rupture leading to intra-luminal thrombi, occluded arteries, coronary occlusion and stroke. The complications of advanced atherosclerosis are chronic, slowly progressive and cumulative. Commonly, vulnerable plaques can suddenly rupture, causing the formation of a thrombus that will rapidly slow or stop blood flow, quickly leading to death of the tissues fed by the blocked artery. This event is called an infarction, such as a myocardial infarction. Atherosclerosis can affect any part of the arterial system, but primarily occurs in larger, high-pressure vessels such as the coronary, renal, femoral, cerebral, and carotid arteries.

    [0091] A “control” is an alternative subject or sample used in an experiment for comparison purpose. A control can be “positive” or “negative”. For example, where the purpose of the experiment is to determine a correlation of an altered expression level of a gene with atherosclerosis or atherogenesis, it is generally preferable to use a positive control (a subject or a sample from a subject, carrying such alteration and exhibiting syndromes characteristic of atherosclerosis or atherogenesis), and a negative control (a subject or a sample from a subject lacking the altered expression and syndromes characteristic of atherosclerosis or atherogenesis).

    [0092] An “expression vector” is a polynucleotide which, when introduced into an appropriate host cell, can be transcribed and translated into one or more polypeptide(s). An “expression system” usually connotes a suitable host cell comprised of an expression vector that can function to yield a desired expression product e.g. cloning of SEQ. ID. NO. 5, 6 or 7 into pET24b+ bacterial expression vector, which is transferred into appropriate bacterial cells (e.g. E. Coli), induction with IPTG and subsequent purification by chromatography).

    [0093] “Half-life” or “serum half-life” means the time taken for the serum concentration of a polypeptide to be reduced by 50%, in vivo, for example due to the degradation, cleavage, clearance or sequestration of the polypeptide by natural mechanisms. The in vivo half-life of an amino acid sequence, compound or polypeptide of the invention can be determined in any manner known per se, such as by pharmacokinetic analysis. Suitable techniques will be clear to the person skilled in the art, and may for example generally involve the steps of suitably administering to a warm-blooded animal (i.e. to a human or to another suitable mammal, such as a mouse, rabbit, rat, pig, dog or a primate, for example monkeys from the genus Macaca (such as, and in particular, cynomologus monkeys (Macaca fascicularis) and/or rhesus monkeys (Macaca mulatta)) and baboon (Papio ursinus)) a suitable dose of the amino acid sequence, compound or polypeptide of the invention; collecting blood samples or other samples from said animal; determining the level or concentration of the amino acid sequence, compound or polypeptide of the invention in said blood sample; and calculating, from (a plot of) the data thus obtained, the time until the level or concentration of the amino acid sequence, compound or polypeptide of the invention has been reduced by 50% compared to the initial level upon dosing. Reference is for example made to the Experimental Part below, as well as to Dennis et al., J. Biol. Chem. 277:35035-42 (2002), and to the standard handbooks, such as Kenneth, A et al: Chemical Stability of Pharmaceuticals: A Handbook for Pharmacists and Peters et al, Pharmacokinete analysis: A Practical Approach (1996). Reference is also made to “Pharmacokinetics”, M Gibaldi & D Perron, published by Marcel Dekker, 2nd Rev. Edition (1982). As will also be clear to the skilled person (see for example pages 6 and 7 of WO 04/003019 and in the further references cited therein), the half-life can be expressed using parameters such as the t1/2-alpha, t1/2-beta and the area under the curve (AUC). In the present specification, an “increase in half-life” refers to an increase in any one of these parameters, such as any two of these parameters, or essentially all three these parameters. As used herein “increase in half-life” or “increased half-life” in particular refers to an increase in the t1/2-beta, either with or without an increase in the t1/2-alpha and/or the AUC or both. For example, the half-life of an amino acid sequence or polypeptide of the invention may be determined by means of a pharmacokinetic study, performed in a rodent or non-human primate model, as follows. Groups of animals (n=2-10) are given an intravenous bolus injection of 1 mg/kg or 10 mg/kg 2D3-17D12 fusion protein. Plasma samples are obtained via a vein at different time-points after dosing (eg. 1, 2, 4, 6, 8, 12, 24, 48, 144, 192, 240, 288 and 336 h after dosing) and analyzed for the presence of the 2D3-17D12 fusion protein by ELISA. Plasma concentration versus time is fitted to a two-compartment elimination model. The pharmacokinetic parameters of clearance, V1, steady state volume (Vss), T½, AUC, and AUC corrected for actual dose administered (AUC/dose) are averaged for each treatment group. Differences between groups are determined by analysis of variance.

    [0094] “Inhibition of PCSK9 expression” as used herein means a decrease or absence in the level of PCSK9 protein and/or PCSK9/LDLR complex formation. The consequences of this inhibition can be confirmed by examination of the outward properties of the cell or organism or by biochemical techniques such as antibody binding, enzyme linked immune-sorbent assay (ELISA), western blotting, radioimmunoassay (RIA), other immunoassays, fluorescence activated cell analysis (FACS), Dil-LDL internalization. Differential expression at the protein level can be determined using agents that specifically bind to the encoded protein product, in e.g., an immunoassay. PCSK9 or PCSK9-LDLR activity, its biological effects on endothelial cells, arteries, skeletal muscle, adipocytes, heart, or liver can be determined using the methods described herein as well as by methods known by those skilled in the art. In determining a reduction in the internalization of PCSK9 or PCSK9-LDLR complex mediated by a polypeptide of the present invention, measurements of PM PCSK9 or PCSK9-LDLR levels made after administration a polypeptide of the invention are compared to measurements made in the same subject before administration of a polypeptide of the invention, or are compared to a corresponding normal or pathological range of levels.

    [0095] “Modulating” PCSK9 or PCSK9-LDLR complex using a polypeptide of the invention may also involve effecting a change (which may either be an increase or a decrease) in affinity, avidity, specificity and/or selectivity of PCSK9 for one or more of its ligands, binding partners, partners affecting PCKS9 association with a homomultimeric or heteromultimeric form, or substrates; and/or effecting a change in the sensitivity of PCSK9 to one or more conditions (such as pH, ion strength, the presence of co-factors, etc.), compared to the same conditions in the absence of a polypeptide of the invention (e.g. a polypeptide of 27 to 169 amino acids in length comprising a contiguous amino acid sequence of at least 20 amino acids in length, wherein the contiguous sequence is substantially homologous to SEQ. ID. NO. 4.). “Modulating” PCSK9 or PCSK9-LDLR complex using a polypeptide of the invention also refers to effecting a change with respect to one or more biological or physiological mechanisms, effects, responses, functions, or activities in which PCSK9 is involved, in particular those related to internalization of PCSK9 through clathrin pits, PCSK9 binding to LDLR. Again, as will be clear to the skilled person, the change effected may be determined in any suitable manner and/or using any suitable (in vitro and usually cellular or in vivo assay) assay known per se. In particular, the intended biological or physiological activity affected is increased or decreased, respectively, by at least 1%, preferably at least 5%, such as at least 10% or at least 25%, for example by at least 50%, at least 60%, at least 70%, at least 80%, or 90% or more, compared to the biological or physiological activity in the same assay under the same conditions but without the presence of the construct of the invention. Modulating may also involve allosteric modulation of PCSK9; thereby reducing the binding of PCSK9 to binding ligand or partner i.e. LDLR, ApoER2, VLDLR, in particular preventing PCSK9 binding with LDLR, ApoER2, VLDLR.

    [0096] “Non-natural amino acids” are analogues of the naturally occurring amino acids (Table 1) in that they are derived from a naturally amino acid by chemical variation of the side chain of a standard amino acid. A polypeptide of the present invention (e.g. a polypeptide of 27 to 169 amino acids in length comprising a contiguous amino acid sequence of at least 20 amino acids in length, wherein the contiguous sequence is substantially homologous to SEQ. ID. NO. 4) may contain conservative substitutions of amino acid residues including equivalent non-natural amino acids. Non-natural amino acids encompass a variety of substances and examples for nonstandard amino acids include but are not limited to molecules selected from the group consisting of O-methyl-L-tyrosine, L-3-(2-naphthyl)alanine, 3-methyl-phenylalanine, O-4-allyl-L-tyrosine, 4-propyl-L-tyrosine, tri-O-acetyl-GlcNAcP-serine, an L-Dopa, a fluorinated phenylalanine, isopropyl-L-phenylalanine, p-azido-L-phenylalanine, p-acyl-L-phenylalanine, p-benzoyl-L-phenylalanine, L-phospho-serine, phosphonoserine, phosphonotyrosine, p-iodo-phenylalanine, homopropar-gylglycine, azidohomoalanine, p-bromophenylalanine, p-amino-L-phenylalanine and isopropyl-L-phenylalanine. Additionally, other examples of non-natural amino acids optionally include but are not limited to an non-natural analogue of a tyrosine amino acid; an non-natural analogue of a glutamine amino acid, an non-natural analogue of a phenylalanine amino acid, an non-natural analogue of a serine, an non-natural analogue of a threonine, an non-natural analogue of an arginine analogue, an non-natural analogue of an asparagine, an non-natural analogue of a glycine, an non-natural analogue of a valine, an non-natural analogue of a methionine, an non-natural analogue of a lysine, an non-natural analogue of a glutamine, an alkyl, aryl, acyl, azido, cyano, halo, hydrazine, hydrazide, hydroxyl, alkenyl, alkynl, ether, thiol, sulfonyl, seleno, ester, thio-acid, borate, boronate, phospho, phosphono, phosphine, heterocyclic, enone, imine, aldehyde, hydroxylamine, keto, or amino substituted amino acid, or any combination thereof.

    [0097] Amino acids of the polypeptide of the invention can also be conjugated with a photo-activatable cross-linker; a spin-labeled amino acid; a fluorescent amino acid; an amino acid with a novel functional group; an amino acid that covalently or non-covalently interacts with another molecule; a metal binding amino acid; a metal-containing amino acid; a radioactive amino acid; a photocaged amino acid; a photoisomerizable amino acid; a biotin or biotin-analogue, preferably at the C- or N-terminus of the polypeptide. Polypeptides of the invention may be conjugated to containing a glycosylated or carbohydrate modified amino acid; a keto containing amino acid; an amino acid comprising polyethylene glycol; an amino acid comprising polyether; a heavy atom substituted amino acid; a chemically cleavable or photocleavable amino acid; an amino acid with an elongated side chain; an amino acid containing a toxic group; a sugar substituted amino acid, e.g., a sugar substituted serine or the like; a carbon-linked sugar-containing amino acid; a redox-active amino acid; an a-hydroxy containing acid; an amino thio acid containing amino acid; an α,α-disubstituted amino acid; a β-amino acid; and a cyclic amino acid other than pro-line. Further examples and more information can be taken for example from “Engineering the genetic code” by Budisa (2005, Wiley-VCH, Weinheim, Germany) or from US 2011/027867.

    [0098] The terms “polynucleotide”, or “oligonucleotide” as used herein refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, analogs or modified forms thereof. Polynucleotides may have any three-dimensional structure, and may perform any function, known or unknown. The following are non-limiting examples of polynucleotides: coding or non-coding regions of a gene or gene fragment, loci (locus) defined from linkage analysis, exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, ribozymes, cDNA, recombinant polynucleotides as well as plasmids, vectors comprising a nucleic acid encoding a polypeptide of the invention. A polynucleotide may comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs. If present, modifications to the nucleotide structure may be imparted before or after assembly of the polymer. The sequence of nucleotides may be interrupted by non-nucleotide components. A polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component.

    [0099] “Substantially homologous nucleotides” “substantially homologous oligonucleotides” or “substantially homologous polynucleotides” are at least about 80% identical with each other, after alignment of the homologous regions. Preferably, the sequences are at least about 85% identical; more preferably, they are at least about 90% identical; more preferably, they are at least about 95% identical; still more preferably, the sequences are 100% identical. Sequence alignment and homology searches can be determined with the aid of computer methods. A variety of software programs are available in the art. Non-limiting examples of these programs are Blast, Fasta (Genetics Computing Group package, Madison, Wis.), DNA Star, MegAlign, Tera-BLAST (Timelogic) and GeneJocky. Any sequence databases that contains DNA sequences corresponding to a target gene or a segment thereof can be used for sequence analysis. Commonly employed databases include but are not limited to GenBank, EMBL, DDBJ, PDB, SWISS-PROT, EST, STS, GSS, and HTGS. Common parameters for determining the extent of homology set forth by one or more of the aforementioned alignment programs include p value and percent sequence identity. P value is the probability that the alignment is produced by chance. For a single alignment, the p value can be calculated according to Karlin et al. (1990) Proc. Natl. Acad. Sci 87: 2246. For multiple alignments, the p value can be calculated using a heuristic approach such as the one programmed in Blast. Percent sequence identity is defined by the ratio of the number of nucleotide matches between the query sequence and the known sequence when the two are optimally aligned. To determine that nucleotide sequences are substantially homologous, it is useful to first establish the lowest temperature at which only homologous hybridization occurs with a particular concentration of salt (e.g., SSC or SSPE). Then, assuming that 1% mismatching results in a 1° C. decrease in the Tm, the temperature of the final wash in the hybridization reaction is reduced accordingly (for example, if sequences having >95% identity are sought, the final wash temperature is decreased by 5° C.). In practice, the change in Tm can be between 0.5° C. and 1.5° C. per 1% mismatch.

    [0100] The term “polypeptide” and “peptide” are used interchangeably herein. Also encompassed by this definition of “polypeptide” are substantially homologous homologs thereof, wherein homologs have sustainably similar functional properties and biological activity. For example as used herein a “polypeptide of the invention e.g. SEQ. ID. NO. 10” includes polypeptides that are substantially homologous to SEQ. ID. NO. 10, in particular a polypeptide that is at least 90% homologous, and has the same functional properties or biological activity as SEQ. ID. NO. 10. Polypeptides of the invention may be produced by any technique known in the art, such as without limitation, any chemical, biological, genetic or enzymatic technique, either alone or in combination(s). Knowing the amino acid sequence of the desired sequence, one skilled in the art can readily produce said polypeptides, by standard techniques for production of polypeptides. For instance, they can be synthesized using well-known solid phase method, preferably using a commercially available polypeptide synthesis apparatus (such as that made by Applied Biosystems, Foster City, Calif.) and following the manufacturer's instructions. Alternatively, the polypeptides of the invention can be synthesized by recombinant DNA techniques as is now well-known in the art. For example, these fragments can be obtained as DNA expression products after incorporation of DNA sequences encoding the desired polypeptide into expression vectors and introduction of such vectors into suitable eukaryotic or prokaryotic host cells, transfection of a host cell. A transfected host cell, preferably a bacterial or mammalian cell will express the desired polypeptide, from which they can be later isolated using well-known techniques. An expressed polypeptide may be linear or branched polymer, it may comprise modified amino acids, and it may be interrupted by non-natural amino acids. The term “polypeptide” also encompass an amino acid polymer that has been modified; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation, such as conjugation with a labeling component.

    [0101] The term “sample” includes any biological sample taken from a patient or individual including a cell, tissue sample or body fluid. For example, a sample may include blood, biopsy sample, sinovial fluid or ceribralspinal fluid. A sample can include, without limitation, a single cell, multiple cells, fragments of cells, an aliquot of a body fluid, whole blood, platelets, serum, plasma, red blood cells, white blood cells, endothelial cells, tissue biopsies, synovial fluid and lymphatic fluid.

    [0102] The term “subject” includes, without limitation, humans and non-human primates, animal models, knock-out mice, livestock animals, companion animals, laboratory test animals, captive wild animals, reptiles and amphibians, fish, birds, and any other organism. The most preferred subject of the present invention is a human. A subject, regardless of whether it is a human or non-human organism may be referred to as an individual or subject.

    [0103] Polypeptides of the invention also include any one of the polypeptide sequences described herein further comprising one or more of modifications to the N terminus, as described herein. Polypeptides of the invention also include any one of the polypeptide sequences described herein further comprising a modification to one or more amino acid side chains e.g. pegylation as described herein. Polypeptide variants or substantially homologous polypeptides may include 1, 2, 3 or more conservative amino acid substitutions, according to Table 2 herein, of a reference polypeptide e.g. SEQ. ID. NO. 4, 5, 6 or 7 and having substantially similar binding, and biological effects compared to the reference polypeptide. In such cases, the polypeptide variant and the reference polypeptide (e.g. SEQ. ID. NO. 4, 5, 6 or 7) are substantially homologous. A conservative change may include a substitution, addition or deletion. A conservative substitution is the substitution of an amino acid for another amino acid with similar chemical properties, similar size, charge, polarity. Basic amino acids—histidine (His or H), arginine (Arg or R), and lysine (Lys or K)—are hydrophilic amino acids with a side chain PK value greater than 7 which is typically positively charged a physiological pH. Polar hydrophilic amino acids—serine, threonine, cysteine, tyrosine, asparagine, and glutamine—are hydrophilic having a side chain that is uncharged at physiological pH. Hydrophobic non-polar amino acids—proline (Pro or P), isoleucine (Ile or I), phenylalanine (Phe of F), valine (Val or V), leucine (Leu or L), tryptophan (Trp or W), methionine (Met or M), alanine (Ala or A) and glycine (Gly or G)—exhibit a hydrophobicity of greater than zero. Acidic amino acids—glutamate (Glu or E) and aspartate (Asp or D)—have a side chain PK value less than 7 and are typically negatively charged a physiological pH. The position of conservative substitutions of SEQ. ID. NO. 10, 12 and 13 is provided in Table 2.

    [0104] The term “therapeutically effective amount” refers to an amount of a pharmaceutical composition effective to treat a disease or condition in a subject. A therapeutically effective amount of a polypeptide of the invention can be used to effectively treat or to prevent atherosclerosis at a reasonable benefit/risk ratio applicable to any medical treatment. A therapeutically effective amount of a polypeptide of the invention can reduce atherosclerotic plaque burden or slow its evolution as well as reduce the inflammatory load of a subject. These measures of efficacy against atherosclerosis can be measured using methods well known in the art. It is within the capabilities of a skilled medical practitioner to determine the appropriate dosage for an individual patient in view of the patent's size, age, sex, weight, general health, disease progression and previous or current experience of side effects.

    [0105] “Treatment of” or “to treat” a patient in the sense of the invention are to be understood according to its meaning in the art, in particular according to its meaning in medicine and pharmacy and include both treating a patient suffering from a condition or disease associated with chronic or excessive lipid association inflammation or atherogenesis or preventing lipid association inflammation or atherogenesis.

    [0106] “Fluorophore” or “fluorescent protein” or “fluorescent protein conjugate” as used herein refers to a fluorescent protein moiety conjugated directly to PCSK-9 or LDLR that can be expressed by a cell in vitro as a single transcript following transformation of the cell with a plasmid or vector encoding the conjugate protein. In the methods and assay system of the invention one type of fluorophore is conjugated to the C-terminus of PCSK9, preferably m-Cherry or any similar photostable fluorophore that can be used to provide a dual signal in a cell-based assay. A dual signal meaning each of the 2 fusion proteins provides a distinct fluorescent signal. A PCSK9 fluorophore conjugate is referred to herein as “PCSK9 fluorescent conjugate” or “PCSK9 fusion protein”. In one embodiment PCSK9 is conjugated to mCherry providing a PCSK9 fluorescent conjugate. A second fluorophore is conjugated to the intracellular C-terminus of LDLR. In one embodiment LDLR is conjugated to eGFP providing a “LDLR fluorescent conjugate” or a “LDLR fusion protein”.

    [0107] Examples of combinations of fluorescent PCSK9 conjugate (PCSK9 fusion proteins) and fluorescent LDLR conjugates (LDLR fusion proteins) that could be used to provide a dual signal in the assay of the invention include: PCSK9-mCherry/LDLR-EGFP and PCSK9-DsRed/LDLR-EGFP; PCSK9-mCherry/LDLR-YFP and PCSK9-DsRed/LDLR-YFP; PCSK9-EGFP/LDLR-mCherry and PCSK9-EGFP/LDLR-DsRed; PCSK9-YFP/LDLR-mCherry and PCSK9-YFP/LDLR-DsRed. Sequences corresponding to fluorophores for use in the invention as described include those corresponding to Green fluorescent protein (NCBI Accession: P42212.1, GI: 1169893), GFP-like fluorescent chromoprotein FP538; AltName: Full=zFP538; Contains: RecName: Full=GFP-like fluorescent chromoprotein FP538 chain 1; Contains: RecName: Full=GFP-like fluorescent chromoprotein FP538 chain 2 (NCBI Accession: Q9U6Y4.1 GI: 56749101), Yellow fluorescent protein; Short=YFP (NCBI Accession: P21578.1, GI:126535), GFP-like fluorescent chromoprotein FP506; AltName: Full=zFP506 (Accession: Q9U6Y5.1 GI: 56749102), or GFP-like non-fluorescent chromoprotein; AltName: Full=Non-fluorescent pocilloporin; AltName: Full=Rtms 5 (NCBI Accession: P83690.2 GI: 55976263).

    [0108] As used herein “agent” means a small molecule, antibody or other biological molecule that has or could have effects on the binding of PCSK9 to LDLR or internalization of PCSK9-LDLR complex either in vivo or in an in vitro cell-based assay. One type of agent is a ‘test compound’ or ‘test agent’. ‘Test compound’ or ‘test agent’ refers to an agent screened in an in vitro assay.

    [0109] As used herein “dual signalling” or “dual fluorescent signalling” refers to a detection of multiple distinct fluorescent signals in a cell based assay such as: a signal corresponding to a 1.sup.st fluorophore conjugated to PCSK9, a signal corresponding to a 2.sup.nd fluorophore conjugated to PCSK9 and a 3.sup.rd distinct type of signal corresponding to a signal derived from both a first and second fluorophore in combination wherein the first and second fluorophore emission wave lengths are different.

    [0110] “PCKS9 inhibitor” as used herein refers to any small molecule compound, polypeptide, antibody, antibody fragment or other biologic that inhibits either directly or indirectly binding of PCSK9 to LDLR or internalization (e.g. into a hepatic cell) of PCSK9 following binding to LDLR. Examples of PCSK9 inhibitors include anti-PCSK9 antibodies, adnectin, Repatha®/Evolocumab (Amgen); Praluent®/Alirocumab (Regeneron-Sanofi); Bococizumab (Pfizer, Phase III); LGT209 (Novartis, Phase II); RG7652 (Roche/Genentech, Phase II); BMS-972476 (BMS; Adnectin, pre-clinical).

    [0111] “PCSK9 protein” or “PCSK9 molecule” as used herein means a mammalian PCSK9 protein or any genetic variant thereof including both naturally occurring variants or man-made designed variants or fragments of a mature PCSK9 protein sequence. In the assay methods and systems of the invention PCSK9 is conjugated to a fluorescent protein such that a fluorescent, biologically active PCSK9 protein conjugate is created. Such conjugates are referred to herein as a fluorescent PCSK9 conjugate protein or a PCSK9 fusion protein. A variety of PCSK9 variant proteins are known in the art including but not limited to the sequences corresponding to the PCSK9 protein sequences provided in UniProtKB—Q8NBP7, these sequences are herein incorporated by reference. PCSK9 proteins include PCSK9 variant sequences including but not limited to those corresponding to corresponding to rs28942111, rs28942112, wild-type human PCSK9 (UniProtKB-Q8NBP7) GOF variants hypercholesterolemia (HCHOLA3): S127R (VAR_017199), D129G (VAR_058524), R215H (VAR_058526), F216L (VAR_017200), R218S (VAR_058527), R357H (VAR_058530), D374H (VAR_058531), D374Y (VAR_058532), R496W (VAR_058534).

    [0112] “LDLR protein” or “LDLR molecule” as used herein means a mammalian LDLR protein or any genetic variant thereof including both naturally occurring variants or man-made designed variants or fragments of a mature LDLR protein sequence. In the assay methods and systems of the invention LDLR is conjugated to a fluorescent protein such that a fluorescent, biologically active LDLR protein conjugate is created. Such conjugates are referred to herein as a fluorescent LDLR conjugate protein or a LDLR fusion protein. A variety of LDLR variant proteins are known in the art including but not limited to the sequences corresponding to Low-density lipoprotein receptor; e.g. Short=LDL receptor; Precursor (NCBI Accession: P01130.1, GI: 126073) or a biologically active fragment or variant thereof. Other proteins similar to LDLR in function including but not limited to: Very low-density lipoprotein receptor; Short=VLDL receptor; Short=VLDL-R; Flags: Precursor (NCBI Accession: P98156.1 GI: 1730112) a biologically active variant or fragment thereof; Low-density lipoprotein receptor-related protein 8; Short=LRP-8; AltName: Full=Apolipoprotein E receptor 2; Flags: Precursor (NCBI: Accession: Q14114.4, GI: 259016389) a biologically active variant or fragment thereof, Lysosome membrane protein 2; AltName: Full=85 kDa lysosomal membrane sialoglycoprotein; Short=LGP85; AltName: Full=CD36 antigen-like 2; AltName: Full=Lysosome membrane protein II; OR Short=LIMP II; AltName: Full=Scavenger receptor class B member 2; AltName: CD_antigen=CD36 (NCBI: Accession: Q14108.2 GI: 2498525) a biologically active variant or fragment thereof, can be used in the assays method, systems and kits of the invention in a manner analogous to LDLR, as described herein.

    Polypeptides of the Invention

    [0113] The endoplasmic reticulum (ER) plays a central role in the production, assembly, and modification of cholesterol, lipids, cell surface receptors and secretory proteins. Under physiological or stress conditions, ER function maintains cellular integrity with the help of crucial factors such as calnexin/calreticulin, GRP78, GRP94, PDI, etc. Glucose-regulated protein 94 (SEQ. ID NO. 2; GRP94) is a highly abundant ER-resident protein well known to function as a molecular chaperone with a restricted number of client proteins, including PCSK9 (Lee, 2014; McLaughlin and Vandenbroeck, 2011). GRP94 (SEQ. ID. NO. 3) also known as heat shock protein 90 (HSP90) is also major luminal calcium-binding protein in the ER (Macer and Koch, 1988). As compared to GRP78, (Jorgensen et al., 2000) GRP94 does not directly bind to LDLR (Pena et al., 2010; Weekes et al., 2012). The polypeptides of the present invention are derived from the GRP94 CDB-CT domain (SEQ. ID. NO. 6). While the polypeptides of the invention could hypothetically occur intracellularily during degradation of GRP94, do not occur outside the cell (extracellularily) and do not naturally function to bind plasma membrane located LDLR and block LDLR internalization.

    [0114] Polypeptides of the invention range from 27 to 169 amino acids in length comprising a contiguous amino acid sequence of at least 20 amino acids in length, wherein the contiguous sequence is substantially homologous to SEQ. ID. NO. 4.

    [0115] Polypeptides of the invention include substantially homologous polypeptides of as described herein. In one embodiment a substantially homologous polypeptides may comprise 1, 2 or 3 conservative amino acid substitutions selected from those provided in Table 2 below. Possible conservative substitutions, that can be included in a polypeptide of the invention, are indicated in Table 2. Amino acids are indicated using the one letter code according to Table 1 herein.

    TABLE-US-00002 TABLE 2 Possible Conservative Amino Acid Substitutions of the Polypeptides of the Invention Position Position Position Conc. on SEQ. on SEQ. on SEQ. Sequence Subst ID. NO. 6 ID. NO. 5 ID. NO. 4 M M/Z 1 R R/K 2 A A/V 3 L L/I 4 W 5 V V/A 6 L L/I 7 G 8 L L/I 9 C 10 C 11 V V/A 12 L L/I 13 L L/I 14 T T/S 15 F 16 G 17 S S/T 18 V V/A 19 R R/K 20 A A/V 21 Y 1 22 1 G 2 23 2 W 3 24 3 S S/T 4 25 4 G 5 26 5 N 6 27 6 M M/Z 7 28 7 E 8 29 8 R R/K 9 30 9 I I/L 10 31 10 M M/Z 11 32 11 K 12 33 12 A A/V 13 34 13 Q Q/D 14 35 14 A 15 36 15 Y 16 37 16 Q Q/D 17 38 17 T 18 39 18 G 19 40 19 K K/R 20 41 20 D 21 42 21 I I/L 22 43 22 S S/T 23 44 23 T T/S 24 45 24 N 25 46 25 Y 26 47 26 Y 27 48 27 A A/V 28 S S/T 29 Q Q/D 30 K K/R 31 K K/R 32 T T 33 F F 34 E E 35 I I/L 36 N N 37 P P 38 R R/K 39 H H 40 P P 41 L L/I 42 I I/L 43 R R/K 44 D D/Q 45 M M/Z 46 L L/I 47 R R/K 48 R R/K 49 I I/L 50 K K/R 51 E E 52 D D/Q 53 E E 54 D D/Q 55 D D/Q 56 K K/R 57 T T 58 V V/A 59 L L/I 60 D D/Q 61 L L/I 62 A A/V 63 V V/A 64 V V/A 65 L L/I 66 F F 67 E E 68 T T 69 A A/V 70 T T 71 L L/I 72 R R/K 73 S S/T 74 G G 75 Y Y 76 L L/I 77 L L/I 78 P P 79 D D/Q 80 T T 81 K K/R 82 A A/V 83 Y Y 84 G G 85 D D/Q 86 R R/K 87 I I/L 88 E E 89 R R/K 90 M M/Z 91 L L/I 92 R R/K 93 L L/I 94 S S/T 95 L L/I 96 N N 97 I I/L 98 D D/Q 99 P P 100 D D/Q 101 A A/V 102 K K/R 103 V V/A 104 E E 105 E E 106 E E 107 P P 108 E E 109 E E 110 E E 111 P P 112 E E 113 E E 114 T T 115 A A/V 116 E E 117 D D/Q 118 T T 119 T T 120 E E 121 D D/Q 122 T T 123 E E 124 Q Q/D 125 D D/Q 126 E E 127 D D/Q 128 E E 129 E E 130 M M/Z 131 D D/Q 132 V V/A 133 G G 134 T T 135 D D/Q 136 E E 137 E E 138 E E 139 E E 140 T T 141 A A/V 142 K K/R 143 E E 144 S S/T 145 T T 146 A A/V 147 E E 148

    [0116] Exemplary polypeptides of the invention include a polypeptide according to SEQ. ID. NO. 4, 5, 6, 7, 37, 38, 39, 40, 42, 43, 44, or 45 and having 1, 2 or 3 conservative amino acid substitutions selected from those provided in Table 2.

    [0117] Substantially homologous polypeptides of the invention include a variant of SEQ. ID. NO. 4, 5, 6 or 7 having one or two conservative amino acid substitutions selected from: substitution of Ile.sub.10 for Leu, Ile.sub.22 for Leu, substitution of Ala.sub.13 for Val, substitution of Gln.sub.14 for Asp, Gln.sub.17 for Asp, substitution of Met.sub.7 for Nle, substitution of Met.sub.11 for Nle substitution of Ser.sub.4 for Thr, substitution of Lys.sub.20 to Arg, substitution of Ser.sub.23 to Thr, substitution of Thr.sub.24 to Ser, substitution of Asn.sub.25 to Gln.

    [0118] In one embodiment, the polypeptides of the invention are acetylated at the N-terminal and amindated at the C-terminal as illustrated for a polypeptide according to SEQ. ID. 4 below:

    [0119] CH3-CO—NH-Tyr.sub.1-Gly.sub.2-Trp.sub.3-Ser.sub.4-Gly.sub.5-Asn.sub.6-Met.sub.7-Glu.sub.8-Arg.sub.9-Ile.sub.10-Met.sub.11-Lys.sub.12-Ala.sub.13-Gln.sub.14-Ala.sub.15-Tyr.sub.16-Gln.sub.17-Thr.sub.18-Gly.sub.19-Lys.sub.20-Asp.sub.21-Ile.sub.22-Ser.sub.23-Thr.sub.24-Asn.sub.25-Tyr.sub.26-Tyr.sub.27-CO—NH2

    [0120] In other embodiments polypeptides of the invention can be acetylated at the polypeptide N-terminus. In one embodiment a polypeptide, according to SEQ. ID. NO. 4, is acetylated at the N-terminus and amidated at the C-terminal having a molecular weight of 3176.5, a chemical formula C.sub.143H.sub.209N.sub.37O.sub.44S.sub.2, and an isoelectric point of 8.34.

    [0121] Polypeptides of the invention may additionally include N-terminal blocking groups including but not limited to: a N-acetyl amino acid, a glycosylated amino acid, a pyrrolidone carboxylate group, an acetylated amino acid, a formylated amino acid, myristic acid, a pyroglutamate conjugated amino acid. Polypeptides of the invention may additionally include a C-terminal blocking groups such as an amidated amino acid. Other N-terminal or C-terminal blocking groups are known to a person skilled in the art and can be used to modify the polypeptides of the invention as described in Davies (2006, Royal Society of Chemistry, London, UK), “Biochemistry” by Garrett and Grisham (2010, Cengage Learning, Andover, UK) and WO 97/3903.

    [0122] The polypeptides of the invention can be modified to increase their molecular weight and improve their serum half-life while retaining their therapeutic functional property i.e. reducing PCSK9 binding to LDLR or PCSK9-LDLR internalization at the PM thereby increasing PM levels of LDLR. Bulkier polypeptides have an increased resistance to cleavage by neutral endopeptidase (NEP) and to clearance via naturetic polypeptide receptor C (NPR-C). NEP preferably recognizes substrates smaller than 3 kDa (Oefner, J Mol Biol. 2000; 296:341-349). By adding 0.6 to about 5.0 kDa of amino acids, hydrophilic or water-soluble polymers, hydrophobic acids (including fatty acids) or carbohydrates the serum half-life of a small polypeptide, like those of the invention, can be improved. A longer serum half-life improves the therapeutic benefits of administration of a polypeptide of the invention SEQ. ID. NOs 4-32. In one embodiment, a polypeptide of the invention is conjugated to additional amino acids or other types of natural or synthetic polymeric groups to the polypeptide sequence at the C terminus, N terminus or side chain(s) to increase its size from about 1.4 kDa or 1.6 kDa to about 4.0 kDa, 4.4 KDa, 4.6 KDa, 4.8 KDa, 5 KDa, 5.2 KDa, 5.4 KDa, 5.6 KDa, 5.8 KDa, 6 KDa, 6.2 KDa, 6.4 KDa, or to about 7 KDa, 7.2 KDa or about 8.2 kDa. Polypeptides of the invention include a polypeptide according to Formula 2, 3 or 4 below:

    TABLE-US-00003 FORMULA 2 custom-character - YGWSGNMERIMKAQAYQTGKDISTNYY-CO-U FORMULA 3 custom-character - MRALWVLGLCCVLLTFGSVRAYGWSGNME RIMKAQAYQTGKDISTNYY-CO-custom-character FORMULA 4 custom-character -YGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFE INPRHPLIRDMLRRIKEDEDDKTVLDLAVVLF-ETAT LRSGYLLPDTKAYGDRIERMLRLSLNIDPDAKVEEEP EEEPEETAEDTTEDTEQDEDEEMDVGTDEEEETAKES TAE-CO-custom-character

    [0123] Wherein (X) and (U) maybe independently absent or present and are selected from a synthetic or natural polymeric group, or combination thereof. A non-limiting example of a synthetic polymeric group is polyethylene glycol (PEG). A non-limiting example of a natural polymeric group is an amino acid sequence containing from 1-35 amino acids derived from a naturetic polypeptide e.g. naturetic polypeptide precursor C (NPPC) SEQ. ID. NO. 61 or A naturetic peptide (ANP) SEQ. ID. NO. 63, or variants thereof with substitutions and/or deletions or derived from brain naturetic protein, serum albumin, IgG, histadine-rich glycoprotein, fibronectin, fibrogen, zinc finger-containing polypeptides, osteocrin or fibroblast growth factor 2.

    [0124] Polypeptides of the invention further include a polypeptide according to Formula 2 having one or more conservative amino acid substitutions.

    [0125] Substantially homologous variants of the polypeptides of the invention, containing 1, 2, 3 or 4 conservative amino acid substitutions, can also be modified to increase serum half-life, by conjugated a polymer group, as described above, either the C-terminus or N-terminus or both the C-terminus and N-terminus.

    [0126] It is to be understood that a reference to a particular amino acid position, according to the formula shown herein, refers to the same position, with reference to a particular sequence even when the length of the polypeptide has changed due to the addition of a sequence either to the C- or N-terminus of the polypeptide.

    [0127] In a preferred embodiment PEG polymer of about 0.6 kDa to 1.2 kDa is conjugated to the N-terminus of a polypeptide of the invention or a substantially identical derivative as described herein. Hydrophilic polymers (e.g. PEG) may vary in type (e.g. homopolymer or copolymer, random, alternating or block polymer, linear or branched, mono-dispersed or poly-dispersed); linkage (e.g. hydrolysable, or stable linkage such as aminde, imine, aminal, alkylene, or ester bond); conjugation site (N-terminus, C-terminus or internal site) and length (e.g. from about 0.2, 0.4, 0.6 to 1 kDa). Such polymers can be conjugated to a polypeptide by means of a N-hydroxy succinimide (NHS)- or aldhyde based chemistry or other chemistry as is known in the art. In a further embodiment the polypeptides of the invention can be conjugated to PEG, or a similar hydrophilic polymer, at an internal sit such as at Gln.sub.4 or Gln.sub.8.

    [0128] The susceptibility of a polypeptide, including those of the invention, to peptidase cleavage can also be beneficially reduced by substituting one or more polypeptide bonds of the polypeptide with a polypeptide bond isostere including but not limited to: —CH.sub.2—NH— or —C(═O)—NR—wherein the amide group is alkylated with a R group selected from: methyl, ethyl, n-propyl, isopropyl, cyclopropyl, n-butyl, isobutyl, sec-butyl or tert-butyl, —C(═O)—NH—CH.sub.2—, CH.sub.2—S—, CH.sub.2—S(O)n- (where n is 1 or 2), —CH.sub.2—CH.sub.2—, —CH═CH—, —CH(CN)—NH—, —CH(OH)—CH.sub.2—, —O—C(—O)—NH—, and —NHC(═O)NH—. The polypeptides of the invention include derivatives comprising one or more polypeptide bond isosteres.

    [0129] The polypeptides of the invention can be conjugated with a detectable label or other signal-generating moieties. Suitable labels and techniques for attaching, using and detecting labeled polypeptides are well known in the art. Labels for use with the polypeptide of the invention include fluorescent labels (e.g. fluorescein, isothiocyanate, rhodamine, phycoerythrin, allophycocyanin, o-phthaldehyde, flourescamine, fluorescent metals, phosphorescent labels, chemi-luminescent labels or bioluminescent labels (e.g. luminal, isoluminol, theromatic acridinium ester), radio-isotope labels (e.g. .sup.3H, .sup.125I, .sup.32P, .sup.35S, .sup.14C, .sup.51Cr, .sup.36Cl, .sup.57Co, .sup.58Co, .sup.59Fe and .sup.75Se), metals, metal chelates or metallic cations (e.g. .sup.99mTc, .sup.123I, .sup.111In, .sup.131I, .sup.97Ru, .sup.67Cu, .sup.67Ga, .sup.68Ga, .sup.157Gd, .sup.55Mn, .sup.162Dy, .sup.52Cr and .sup.56Fe). Other suitable labels will be clear to the skilled person such as moieties that can be detected using NMR or ESR spectroscopy. Labelled derivatives can be used for in vitro assays or for in vivo imaging or diagnostic purposes. Such labels are preferably conjugated to the C- or N-terminus of the polypeptides of the invention or polypeptide variant thereof.

    [0130] Another useful modification of the polypeptides of the invention includes conjugation with a member of a binding pair such as biotin and streptavidin. Such binding pairs may be useful for binding a polypeptide of the invention to a pharmaceutical carrier such as in some liposomal formulations known in the art (Swaminathan J, Ehrhardt C. Expert Opin Drug Deliv. 2012; 9:1489-1503).

    Encoding Polynucleotides and Vectors

    [0131] The invention further includes polynucleotides encoding a polypeptide of the invention e.g. SEQ. ID. NO. 33, 34, 35, or 36, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59 or 60, a fragment or variant thereof. Exemplary polynucleotides of the invention include SEQ. ID. NO. 33, 34, 35, or 36, a fragment or variant thereof. The invention also includes vectors comprising SEQ. ID. NO. 33, 34, 35, or 36, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59 or 60 which are useful for producing a polypeptide of the invention (e.g. using pcDNA3.1 or pIRES for mammalian expression into media or pET24b+ for recombinant bacterial expression).

    [0132] Compositions comprising one or more of the polypeptides of the invention can be used to treat acute or chronic conditions, in particular conditions causally associated with biological responses to circulating lipids that bind to LDL or to prevent a pathology associated circulating lipids that bind to LDL e.g. atherosclerosis and cardiovascular diseases.

    Pharmaceutical Formulations

    [0133] Polypeptides of the present invention may be combined with pharmaceutically acceptable excipients, and optionally sustained-release matrices, such as biodegradable polymers, to form therapeutic compositions. The pharmaceutical compositions of the present invention contain an active agent, a polypeptide, alone or in combination with another active agent. The therapeutic compositions of the invention can be administered in a unit administration form, as a mixture with conventional pharmaceutical supports, to animals and human beings. Suitable unit administration forms comprise oral-route forms such as tablets, gel capsules, powders, granules and oral suspensions or solutions, sublingual and buccal administration forms, aerosols, implants, subcutaneous, transdermal, topical, intra-peritoneal, intra-muscular, intravenous, subdermal, transdermal, intrathecal and intranasal administration forms and rectal administration forms.

    [0134] Preferably, the pharmaceutical compositions and formulations for injection contain vehicle, which is pharmaceutically acceptable. These may be in particular isotonic, sterile, saline solutions (monosodium or disodium phosphate, sodium, potassium, calcium or magnesium chloride and the like or mixtures of such salts), or dry, especially freeze-dried compositions which upon addition, depending on the case, of sterilized water or physiological saline, permit the constitution of injectable solutions. Pharmaceutical forms suitable for injectable use include sterile aqueous solutions or dispersions; formulations including sesame oil, peanut oil or aqueous propylene glycol; and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions. In all cases, the form must be sterile and must be fluid to the extent that easy syringability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms, such as bacteria and fungi.

    [0135] Solutions comprising polypeptides as a free base or pharmacologically acceptable salts can be prepared in water suitably mixed with a surfactant, such as hydroxypropylcellulose. Dispersions can also be prepared in glycerol, liquid polyethylene glycols, and mixtures thereof and in oils. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms.

    [0136] Polypeptides of the invention can be formulated into a composition in a neutral or salt form. Pharmaceutically acceptable salts include the acid addition salts (formed with the free amino groups of the protein) and which are formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric, mandelic, and the like. Salts formed with the free carboxyl groups can also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, histidine, procaine and the like. The carrier can also be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), suitable mixtures thereof, and vegetables oils. The proper fluidity can be maintained, for example, by the use of a coating, such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. The prevention of the action of microorganisms can be brought about by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like. In many cases, it will be preferable to include isotonic agents, for example, sugars or sodium chloride. Prolonged absorption of the injectable compositions can be brought about by the use in the compositions of agents delaying absorption, for example, aluminium-monostearate and gelatin.

    Oral Formulations

    [0137] Polypeptides of the invention can be used in formulations for oral administration of polypeptides such as those described in Renukuntla et al., International Journal of Pharmaceutics 447 (2013) 75-93, herein incorporated by reference. Formulations known in the art for oral delivery of polypeptides and for use in pharmaceutical formulations of the polypeptides of the invention include: absorption enhancers, enzyme inhibitors, hydrogels, muco adhesive systems, liposomes, nanoparticles microparticles, cylodextrins, and prodrug derivatization.

    [0138] Polypeptides of the invention may also be co-administered or administered in series with enzyme inhibitors that reduce proteolytic cleavage of the polypeptide in vivo. Inhibitors such as aprotinin (trypsin/chymotrypsin inhibitor), amastatin, bestatin, boroleucine, and puromycin (aminopeptidase inhibitors) have been widely employed to improve formulations therapeutic polypeptide formulations. Other protease inhibitors include: sodium glycocholate, camostat, mesilate, bacitracin, and soybean trypsin inhibitor.

    [0139] Hydrogel formulations, comprising polypeptides encapsulated in a polymer network are useful in the formulations of the present invention. Hydrogel formulations are well known in the art as described in (Ichikawa and Peppas, 2003; Peppas et al., 2000; Ridgley and Wilkins, 1991). Hydrogels can be classified info neutral hydrogels and ionic hydrogels. Hydrogels can respond physically to the environment such as temperature, ionic strength and pH. Hydrogels can be made of either synthetic or natural polymers and are biodegradable. The polymer network can be comprised of either homopolymers or copolymers. Monomers widely used for preparation of hydrogels for protein or polypeptide delivery include 2-hydroxyethyl methacrylate, ethylene glycol dimethacrylate, N-isopropyl acrylamide, acrylic acid and methacrylic acid, Poly(ethylene glycol) (PEG), poly[methacrylic acid-grafted-poly (ethylene glycol)] and poly(vinyl alcohol).

    [0140] Muco-adhesive polymers are also useful in the preparation of hydrogen polypeptide formulations for oral delivery. Muco-adhesive polymers included in polypeptide formulations bind to the mucosal membranes and improve the oral bioavailability of polypeptides. Muco-adhesive polymers can also reduce the rate of clearance of the polypeptide from the mucosal membrane and prolong absorption time. In this way they are useful for controlled release polypeptide formulations. Muco-adhesive polymers are generally classified into synthetic or semi-natural. Synthetic bioadhesive polymers are either polyacrylic acid or cellulose derivatives. Polyacrylic acid-based polymers include carbopol, polycarbophil, polyacrylic acid, polyacrylate, poly(methylvinylether-co-methacrylic acid), poly(2-hydroxyethyl methacrylate), poly(methacrylate), poly(alkylcyanoacrylate), poly(isohexylcyanoacrylate) and poly(isobutylcyanoacrylate). Examples of cellulose derivatives are carboxymethyl cellulose, hydroxyethyl cellulose, hydroxypropyl cellulose, sodium carboxymethyl cellulose, methyl cellulose, and methylhydroxyethyl cellulose. Chitosan and various gums such as guar, xanthan, crylamide-acrylate polymer (PHPA), poly (vinylpyrrolidone), and poly (vinyl alcohol) constitute semi-natural bioadhesive polymers.

    [0141] The polypeptides of the present invention can be formulated as part of polymeric micro/nanoparticles or liposomes compositions using methods known in the art or oral administration or injection. Liposome formulations comprising polypeptides are also useful in the present invention. Methods for preparing small uni-lamellar vesicles (SUV) of 10-100 nm, large uni-lamellar vesicles (LUV) of 100-300 nm and multi-lamellar vesicles are well known in the art such as described in U.S. Pat. Application 20130251783A1 and U.S. Pat. Application 20120039990 A1. Liposome formulations have proven beneficial for therapeutic delivery of polypeptides. Such vesicles are made of naturally derived phospholipids such as egg phosphatidylethanolamine or dioleoylphosphatidylethanolamine (DOPE), phosphotidyl choline or phosphotidyl inositol (Dharma et al., 1986). In particular dehydrated-rehydrated vesicles are useful for delivery of the polypeptides of the invention.

    [0142] Nanoparticles or colloidal carriers with a size ranging between 1 and 100 nm are also useful for delivery of the polypeptides of the present invention. Formulations comprising the polypeptides of the invention as part of either nanocapsules or nanospheres are contemplated herein. Nanoparticles are a preferred delivery method as they are stable in the GI environment, can be tailed for controlled or targeted release as described in Panyam and Labhastwar, 2003.

    [0143] Absorption enhancers act to enable mucosal (i.e. Intestinal mucosa or nasal mucosa) absorption of a polypeptide by disrupting the structural integrity of the mucosal membrane, decreasing mucus viscosity, opening tight junctions or increasing membrane fluidity (Aungst, 2012; Checkoway et al., 2012; Jitendra et al., 2011; Williams and Barry, 2004). Absorption enhancers include: (i) surfactants; such as sodium lauryl sulfate, laureth-9, sodium dodecylsulfate, sodium taurodihydrofusidate, poly oxyethylene ethers; (ii) chelating agents such as edta, citric acid, salicylates; (iii) bile salts such as sodium deoxycholate, sodium taurocholate, sodium glycodeoxycholate, sodium taurodihydrofusidate, sodium glycodihydrofudisate; (iv) cationic polymers such as chitosan and its derivatives; (v) anionic polymers such as carbopol and polyacrylic acid; acylcarnitines such as lauroyl-l-carnitine chloride, palmitoylcarnitine chloride; fatty acids such as oleic acid, linoleic acid, caprylic acid, capric acid, acylcarnitines, mono and di-glycerides; and their derivatives.

    [0144] Nasal or intranasal delivery is effective for small polypeptides such as those of the present invention, weighing between 1.5-4 kDa. Nasal delivery is a good route of administration for the Polypeptides of the invention as it provides a direct route, which circumvents liver metabolism and the harsh conditions of the gastrointestinal system. The pharmaceutical compositions of the invention may be in the form of a nasal spray, nose drops, nose ointment, nose powder or nose oil. Liquid compositions for nasal administration typically include water as a carrier with the polypeptide dispersed in water or ringer solution.

    [0145] Compositions comprising a polypeptide of the invention in the form of an oil-in-water, water-in-oil emulsions are also contemplated. Such compositions may additionally include absorption enhancers or promoters such as those disclosed in U.S. Pat. No. 5,023,252. Absorption promoters for formulation with the polypeptides of the invention for nasal administration include surfactants or chelators. Other strategies for nasal delivery of polypeptide include powder formulations as described in European Pat. Nos. 2,359 and 122,023 and admixtures of mucosa-absorptive substances and powered polypeptide as disclosed in U.S. Pat. No. 4,250,163. Various other strategies including PEG-polypeptide conjugates and micro-particles as described in detail in U.S. Pat. No. 6,506,730. The pH of a pharmaceutical composition comprising a polypeptide, for nasal delivery is preferably in the range from 6.0 to 8.0, or 6.5 to 8.0, or preferably 7.0 to 7.5.

    [0146] Emulsifying agents for use in emulsions of the polypeptides of the invention include acacia, tragacanth, agar, pectin, carrageenan, gelatine, lanolin, cholesterol, lecithin, methylcellulose, carboxymethylcellulose, acrylic emulsifying agents, such as carbomers and combinations thereof. In general the emulsifying agent is present in the emulsion at a ratio of 0.001:5% weight emulsifying agent:composition, or at a ratio of 0.001:5% weight emulsifying agent:composition, or at a ratio of 0.1:2% weight emulsifying agent:composition.

    [0147] Sterile injectable solutions are prepared by incorporating the active polypeptides in the required amount in the appropriate solvent with several of the other ingredients enumerated above, as required, followed by filtered sterilization. Generally, dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum-drying and freeze-drying techniques which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.

    [0148] Polypeptides of the invention maybe formulated for parenteral administration, such as intravenous or intramuscular injection, other pharmaceutically acceptable forms include, e.g. tablets or other solids for oral administration; liposomal formulations; time release capsules; and any other form currently used. For parenteral administration in an aqueous solution, for example, the solution should be suitably buffered if necessary and the liquid diluent first rendered isotonic with sufficient saline or glucose. These particular aqueous solutions are especially suitable for intravenous, intramuscular, subcutaneous and intraperitoneal administration. For example, one dosage could be dissolved in 1 ml of isotonic NaCl solution and either added to 1000 ml of hypodermoclysis fluid or injected at the proposed site of infusion. Some variation in dosage will necessarily occur depending on the condition of the subject being treated. Upon formulation, solutions will be administered in a manner compatible with the dosage formulation and in such amount as is therapeutically effective. The formulations are easily administered in a variety of dosage forms, such as the type of injectable solutions described above, but drug release capsules and the like can also be employed. The polypeptides of the invention may be formulated within a therapeutic mixture to comprise about 0.0001 to 1.0 milligrams, or about 0.001 to 0.1 milligrams, or about 0.1 to 1.0 or even about 10 milligrams per kilogram per dose or so. Multiple doses can also be administered.

    [0149] Co Administration with Other Drugs and Combination Therapies

    [0150] The polypeptides of the invention may also be used in combination with other therapeutic agents, for instance. HMG-CoA reductase inhibitors such as statins; PCSK9 monoclonal antibodies, PCSK9 immunizing polypeptides, PCSK9 siRNA, niacin; cholesterol absorption-inhibiting supplements such as ezetimibe and fibrates; CETP inhibitors such as evacetrapib, anacetrapib, dalcetrapib; HDL-mimetics, angiotensin-converting enzyme inhibitors such as perindopril, captopril, enalapril, lisinopril, and ramipril; angiotensin receptor antagonists such aslosartan, candesartan, telmisartan, valsartan; beta-blocker drugs such as bisoprolol, carvedilol and sustained-release metoprolol; cardio tonic agents such as ivabradine; calcium channel blockers such as amlodipine, aranidipine, azelnidipine, barnidipine, benidipine, cilnidipin, clevidipine, isradipine, efonidipine; folic acid, aspirin, anti-inflammatory drugs or other drugs commonly used in standard cardiovascular care are likely to be co-administered with the polypeptides of the invention in the treatment of patients with cardiovascular or coronary artery disease. Steroids, non-nonsteroidal anti-inflammatory drugs (NSAIDS), Immune Selective Anti-Inflammatory Derivatives (ImSAIDs) and other types of anti-inflammatory drugs known in the art are commonly used in the treatment of inflammatory diseases and are likely to be co-administered with the polypeptides of the invention, in patients with inflammatory disease, for example arthritis. Moreover when the polypeptides of the invention are co-administered with another drug, if they are contained in different pharmaceutical compositions, said compositions may be administered to the patient at the same time or successively. The foregoing therapeutically active agents are listed by way of example and are not meant to be limiting. Other therapeutically active agents which are currently available or that may be developed in the future are equally applicable to the methods of the present invention.

    [0151] The therapeutic efficacy of the polypeptides of the invention, and of compositions comprising the same, can be tested using any suitable in vitro assay, cell based assay or in vivo assay and/or animal model known or in any combination thereof. Exemplary assays include solid phase binding assays, lipid-lowering effect (LDL-Cholesterol measurements), LDL internalisation, competitive in vitro PCSK9 binding to LDLR, intravascular ultrasound (IVUS); in vivo atherogenesis assay, as well as the in vivo and in vitro assay method described in the methods section included herein.

    [0152] Anti-inflammatory activities may be detected or monitored in vivo through measures of known inflammation biomarkers including: cytokines such as TNF-α, IL6, IL1 and measures of adhesion molecules such as P-selectin, ICAM1. Measures for use in the invention include expression of such inflammatory biomarkers by cells comprising or within arteries or measures circulating levels of cytokines or adhesion molecules in blood, serum or plasma. Pro-atherogenesis activities measured as part of the screening methods of the present invention include: measures of the evolution of the atherosclerotic plaque size through time, measure of the burden of oxidative stress using the measure of 4-HNE, isoprostane, nitrosylated proteins and the like as well as measure of the macrophage load in the atherosclerotic plaque.

    [0153] The anti-inflammatory activities of the polypeptides of the invention can be evaluated by measuring: the level of cytokines such as TNF-α, IL6, IL1 and measures of adhesion molecules such as P-selectin, ICAM1.

    [0154] Pro-atherogenesis activities of the polypeptides of the invention can be evaluated by measuring of the evolution of the atherosclerotic plaque size through time, measure of the burden of oxidative stress using the measure of 4-HNE, isoprostane, nitrosylated proteins and the like as well as measure of the macrophage load in the atherosclerotic plaque, as further described herein. Methods for measuring isoprostane are known in the art and described in Leblond F, et al. Pflugers Arch. 2013; 465:197-208, herein incorporated by reference. Methods for measuring 4-HNE are known in the art and described in Voghel G, et al. Mech Ageing Dev. 2008; 129:261-270, herein incorporated by reference. Methods for measuring nitrosylated proteins are known in the art and described in Qin Y, et al. Methods Enzymol. 2013; 522:409-25, herein incorporated by reference.

    [0155] A level of PCSK9 protein and LDL-Cholesterol in a biological sample may be determined by known methods. Protein levels can be assayed in a biological sample using an Enzyme-linked immunosorbent assay (ELISA) or using a mass spectrometry based assay. The methods and technologies for Indirect ELISA (Biochemistry. 7th edition. Berg J M, Tymoczko J L, Stryer L. New York: W H Freeman; 2012), Sandwich ELISA, Competitive ELISA as well as Multiple and Portable ELISA assays (U.S. Pat. No. 7,510,687; European Patent EP1499894) are well known in the art and widely used

    [0156] Determining a protein level in a sample typically involves a) contacting the polypeptides contained in the biological sample with an agent that specifically binds a PCSK9 polypeptide; and (b) detecting any agent:polypeptide complex formed. In one aspect of the invention, the agent that specifically binds PCSK9 is a polypeptide of the present invention or an antibody targeting PCSK9-polypeptide interaction, preferably a monoclonal antibody. The formation of an agent:polypeptide complex can be detected directly or indirectly according to standard procedures known in the art. In the direct detection method, the agents are supplied with a detectable label and unreacted agents may be removed from the complex; the amount of remaining label thereby indicating the amount of complex formed. In the alternative, an indirect detection procedure requires the agent to contain a label introduced either chemically or enzymatically, that can be detected by affinity cytochemistry. A desirable label generally does not interfere with binding or the stability of the resulting agent:polypeptide complex. However, the label is typically designed to be accessible to an antibody for an effective binding and hence generating a detectable signal. A wide variety of labels are known in the art. Non-limiting examples of the types of labels that can be used in the present invention include radioisotopes, enzymes, colloidal metals, fluorescent compounds, bioluminescent compounds, and chemiluminescent compounds.

    [0157] A variety of techniques for protein analysis are available in the art. They include but are not limited to radioimmunoassays, ELISA (enzyme linked immunoradiometric assays), “sandwich” immunoassays, immuno-radiometric assays, in situ immunoassays (using e.g., colloidal gold, enzyme or radioisotope labels), western blot analysis, immuno-precipitation assays, immuno-fluorescent assays, and SDS-PAGE. In addition, cell sorting analysis can be employed to detect cell surface antigens. Such analysis involves labelling target cells with antibodies coupled to a detectable agent, and then separating the labelled cells from the unlabeled ones in a cell sorter. A sophisticated cell separation method is fluorescence-activated cell sorting (FACS). Cells traveling in single file in a fine stream are passed through a laser beam, and the fluorescence of each cell bound by the fluorescently labelled antibodies is then measured. Antibodies that specifically recognize and bind to the protein products of interest are required for conducting the aforementioned protein analyses. These antibodies may be purchased from commercial vendors or generated and screened using methods described herein.

    [0158] In some embodiments of the invention subjects at risk of atherosclerosis are treated with a polypeptide of the present invention. Risk factors for atherosclerosis include: unhealthy blood cholesterol levels, high LDL-C or low HDL; high blood triglyceride levels; high blood pressure; Smoking; insulin resistance; diabetes; overweight or obesity; family history of early coronary artery disease; lack of physical activity; high levels of C-reactive protein (CRP) in blood; heart attack; chronic inflammation and diseases associated with chronic inflammation; sleep apnea; stress and alcoholism or heavy drinking. Other risk factors include high circulating levels of PCSK9, ICAM-1, P-Selectin and ANGPTL2. Elevated plasma level of one or more of ICAM-1, P-Selectin, ANGPTL2 and PCSK9 possibly indicate the presence of active atherogenesis in a subject and constitute an atherosclerosis risk factor or diagnostic measure. These risk factors can be used in combination with the diagnostic and treatment selection methods described herein to identify subjects at risk of atherosclerosis.

    Screening Assays and Assay Systems

    [0159] Assay systems of the invention are comprised of: (i) cultured cells transformed to stably express a fluorescent LDLR conjugate protein at the cell surface and (ii) extracellular fluorescently labelled PCSK9 conjugate under physiological conditions.

    [0160] The cell-based assay of the invention can be used to evaluate the effect of variants or mutations in PCSK9 on binding of PCSK9 to cell surface LDLR and internalization of PCSK9-LDLR complex. Such variant PCSK9 sequences can be conjugated to a fluorescent protein and used in the assay methods or systems described herein. The approach can be used for identification or comparison of the effect of gain-of-function or loss-of-function PCSK9 mutations compared to wild type PCSK9.

    [0161] The assay system and methods of the invention can be used to identify PCSK9 inhibitors (either small molecule or biological), small molecule compounds or biologics that bind to LDLR and block the interaction between LDLR and PCSK9 or compounds (small molecules or biologics) that modulate the PCSK-9-LDLR interaction through a different mechanism of action.

    [0162] In one aspect the assay can be used to determine map the functional impacts of mutations or polymorphisms in PCSK9, LDLR or any other protein that modifies the PCSK9-LDLR interaction by binding to PCSK9 or LDLR. Such studies can be based on screening of CRISPR-Cas9 sgRNA-mediated knockout libraries in large functional screens.

    [0163] Additional assay components for cell based assays are well known in the art. These include without limitation diluents, salts, buffers, chelating agents, preservatives, drying agents, antimicrobials, growth factors, needles, syringes, packaging materials, tubes, bottles, flasks, beakers, and the like.

    [0164] The assay system of the invention may be in the form of an assay kit comprising one or more components selected from: vectors or plasmids encoding a fluorescent PCSK9 fusion protein e.g. SEQ ID NO. 70 or 68, vectors or plasmids encoding LDLR fluorescent fusion protein e.g. SEQ ID NO. 69, or PCSK9 fluorescent fusion protein e.g. SEQ. NO. 74 or 75. Kit components are in a container, stored and shipped at room temperature, chilled, in liquid nitrogen or on dry ice. Instructions may include instructions for culturing, using, modifying, mixing, diluting, preserving, assembling or storing the cell samples and/or other components according to the assay methods and systems described herein. The instructions may also include instructions for a specific assay to be performed with the cell samples, e.g. their use in screening assay. Instructions may be also be in the form of directions to a website, they may also contain links to computer systems and/or computer memory storage devices.

    [0165] The invention will be further illustrated by the following figures and examples. However, these examples and figures should not be interpreted in any way as limiting the scope of the present invention.

    [0166] In yet other embodiments, assay systems of the invention are comprised of: cultured cells transformed to stably express a fluorescent LDLR conjugate protein at the cell surface and also stably express and excrete extracellular fluorescently labelled PCSK9 conjugate protein.

    EXAMPLES

    [0167] From a screening experiment design to identify new PCSK9 (SEQ. ID. NO. 1) interacting proteins, this invention is based on the identification of GRP94 (SEQ. ID. NO. 3) as a new specific binding partner of PCSK9. A secretable form of human GRP94 (lacking its C-terminal KDEL sequence; GRP94-AKDEL; SEQ. ID NO. 66) was shown to specifically binds to PCSK9 within the cells and can be used as a binding protein for pharmacological treatments or screening assays as described herein. Overexpression of SEQ. ID. NO. 66 or incubation of cells with recombinant GRP94 block PCSK9 internalization and have inhibitory effects on PCSK9-induced LDLR degradation.

    Alanine Scanning

    [0168] Alanine-scanning mutations within the client-binding domain (CBD) of GRP94 (aa652-678), identified as AA1 (.sup.652YAASAAAAAIMKAQAYQTGKDISTNYY; SEQ. ID NO. 78) and AA2 (.sup.652YGWSGNMERIMKAQAYATGKAISTNAA; SEQ. ID NO. 79), (Wu et al., 2012)), abolished PCSK9 binding to GRP94.

    [0169] Domain mapping revealed that neither GRP94 N-Terminal domain (aa22-651), nor PCSK9 C-Terminal domain (aa456-692) participate in complex formation.

    Experimental Methods

    Chemicals and Plasmids

    [0170] Geldanamycin (Cat. #BML-EI280) was purchased from Enzo Life Sciences. Full-length human V5-tagged PCSK9 and LDLR were subcloned into pIRES2-EGFP (Cat. #6029-1, Clonetech) vector as described (Poirier et al., 2014). Plasmids encoding truncated PCSK9 cDNAs PCSK9-L455X (amino acids; aa 1-455) and PCSK9-CHRD (aa 1-33(Q31N)-405-692) were kindly provided by Dr. N. Seidah (Clinical Research Institute of Montreal). Plasmid encoding His-tagged human PCSK9 (pIRES-hPCSK9-V5-His.sub.6) was generated by overlapping PCR. SEQ ID. NO. 2 (Cat. #HsCD00339553; pCMV-SPORT6-hHSP90B1, Accession BC066656) was obtained from DF/HCC DNA Resource Core (Harvard Medical School). SEQ ID. NO. 3 (aa 800-803) sequence was PCR amplified and fused at its C-terminus with the human influenza hemagglutinin (HA) epitope tag (YPYDVPDYA) using the Phusion High-Fidelity DNA polymerase (Cat. #M0530S, New England Biolabs) and subcloned into pCMV-SPORT6 vector at EcoRV/XhoI (New England Biolabs) endonuclease sites. Alanine-scanning mutants (AA1: .sup.652YAASAAAAAIMKAQAYQTGKDISTNYY, SEQ ID. NO. 78 and AA2: .sup.652YGWSGNMERIMKAQAYATGKAISTNAA SEQ ID. NO. 79; (Wu et al., 2012)) were generated by PCR amplification using SEQ ID. NO. 66 as template and inserted into PmlI/XhoI sites. SEQ ID. NO. 46 comprising its signal polypeptide (SP; aa 1-21), client-binding domain (CBD; aa 652-678) and C-terminal domain (aa 679-799) lacking its KDEL terminal sequence was PCR amplified and subcloned into pcDNA3.1neo+ vector (Invitrogen) at BamHI/XhoI restriction sites as described (Aimiuwu et al., 2012).

    [0171] The monomeric fluorescent Cherry coding cDNA was fused to PCSK9 C-terminus using pCMV-Cav1-mCherry as a template (Cat. #27705, Addgene). Prior to subcloned human PCSK9 in frame at the AgeI cloning site, one nucleotide deletion was performed by QuickChange II site-directed mutagenesis (Cat. #200523, Agilent) using the following oligonucleotides: 5′-CAGACCGGTCGC-CACATGGTGAGCAAGG; 5′-CCTTGCTCACCATGTGGCGACCGGTCTG. The caveolin-1 cassette was then replaced by human PCSK9 cDNA at the BglII/AgeI cloning sites. Enhanced green fluorescence protein (EGFP) was fused to LDLR cDNA at its C-terminal (pCMV-hLDLR-GFP) by PCR amplification and subcloned at AgeI/NotI into pIRES-hLDLR-V5 resulting in deletion of the V5-tag sequence and the internal ribosomal entry site (IRES).

    Cell Culture and Transfections

    [0172] Human hepatoma cell lines HepG2 and Huh-7 were routinely cultivated in Dulbecco's modified Eagle's medium (DMEM; Cat. #319-005-CL, Wisent) supplemented with 10% Fetal Bovine Serum (FBS; Cat. #080-350, Wisent). Human embryonic kidney 293 (HEK293 and HEK293T) cells were cultivated in complete DMEM without sodium pyruvate (Cat. #319-015-CL, Wisent). HepG2 were transfected with Lipofectamine 3000 (Cat. #L3000008, Life Technologies) according to the manufacturer's recommendations. Small interfering RNAs (siGenome Non-Targeting pool; Cat. #D-001206-14-05 and siGenome SMART pool; HSP90B1, Cat. #M-006417-02) were obtained from GE HealthCare Dharmacon and were transfected using Lipofectamine RNAiMax reagent (Cat. #13778075, Life Technologies). HEK293 and HEK293T cells were transfected with linear polyethylenimine MW 25,000 (PEI; Cat. #23966, Polysciences) at ratio of 0.8:0.2 PEI (μg):DNA (μg) per cm.sup.2 of cell surface area.

    Immunoprecipitation and Western Blot Analysis

    [0173] For identification of novel PCSK9 interactors, HepG2 or Huh-7 cells (55 cm2) were washed three times in phosphate-buffered saline (PBS) and incubated with 1 mM dithiobis[succinimidylpropionate] (DSP; Cat. #22585, Thermo Scientific), a thiol-cleavable cross-linking reagent, for 30 min at room temperature and subsequently switch for 15 min into a stop solution (15 mM Tris, pH 7.5). Cells were then lysed in complete radio-immune precipitation assay (RIPA) buffer (50 mM Tris/HCl, pH 8.0, 1% (v/v) Nonidet P40, 0.5% sodium deoxycholate, 150 mM NaCl and 0.1% (v/v) sodium dodecyl sulfate (SDS)) supplemented with a complete protease inhibitor mixture (Cat. #11 697 498 001, Roche Applied Science), passed 25 times through a 22-gauge needle and centrifuged at 11,000 g for 15 min at 4° C. Supernatants were incubated and rotated overnight with pre-immune serum, rabbit anti-hPCSK9 (amino acids 31-454) (1:250; Dr. Nabil Seidah, Clinical Research Institute of Montreal) or mouse anti-V5-tag (1:500; Cat. #R96025, Life Technologies) together with 50 μl protein A/G PLUS-agarose (Cat. #sc-2003, Santa Cruz). Following overnight incubation, beads were washed six times in RIPA buffer and resuspended in 75 μl Laemmli sample buffer. Co-immunoprecipitated (Co-IP) proteins were separated by 8% SDS-polyacrylamide gel electrophoresis and visualized using the Pierce silver stain kit (Cat. #24600, Thermo Scientific) according the manufacturer's instructions. All other Co-IP experiments were performed as described without the cross-linking step and in SDS-deprived RIPA buffer. HA-tagged proteins and GRP94 were immunoprecipitated with mouse anti-HA-tag (1:500; Cat. #H3663, Sigma-Aldrich) or rat anti-Grp94 (9G10, 1:1000; Cat. #ADI-SPA-850, Enzo Life Sciences).

    [0174] For Western blot analyses, SDS-polyacrylamide gels were blotted on nitrocellulose membranes (Cat. #162-0115, Bio-Rad), and blocked for 1 h in Tris-Buffered Saline-Tween 20 (TBS-T; 50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 0.1% Tween 20) containing 5% non-fat dry milk. Membranes were then incubated overnight in TBS-T supplemented with 1% non-fat milk and indicated antibodies: rabbit anti-PCSK9 (1:2500, custom made, GenScript), goat anti-human or anti-mouse LDLR (1:1000; Cat. #AF2148 or #A2255, R&D Systems), rat anti-Grp94 (1:30,000), rabbit anti-GRP78 (1:2500; Cat. #ab21685, Abcam), rabbit anti-GFP (1:2000; Cat. #A11122, Life Sciences), mouse anti-V5-tag (1:5000; Cat. #A00641, GenScript), mouse anti-HA-tag (1:5000), rabbit anti-β-actin (1:5000; Cat. #A2066, Sigma-Aldrich). Appropriate HRP-conjugated secondary antibodies (1:10,000, GE healthcare) were used for detection using the Western Lightning Ultra chemiluminescence kit (Cat. #NE1112001EA, PerkinElmer) and BioFlex EC Films (Cat. #CLEC810, InterScience).

    Mass Spectrometry Analysis

    [0175] Following electrophoresis, selected gel lanes were excised into 1 mm.sup.3 pieces and protein complexes were identified by LC-MS/MS as described previously (Cloutier et al., 2009). Briefly, bands were extensively washed, destained and re-hydrated at 4° C. for 40 min in trypsin solution (6 ng/μl; Cat. #V5111, Promega, 25 mM ammonium bicarbonate). Protein digestions were performed at 58° C. for 1 h and stopped with 1% formic acid/2% acetonitrile (ACN) solution and polypeptides were extracted from supernatants with 1% formic acid/50% ACN and dried until LC-MS/MS analyses. Resuspended polypeptides were run on a C18 reversed phase column mounted on a nanoLC-2D system (Eksigent) coupled to the LTQ Orbitrap (ThermoFisher Scientific). LC-MS/MS acquisitions were accomplished using a four-scan event cycle enabling high resolution/high mass accuracy. Protein database searching was performed with Mascot 2.1 (Matrix Science) against the human NCBInr protein database.

    Immunocytochemistry and Confocal Microscopy Analysis

    [0176] Huh-7 cells were washed three times with PBS, fixed with Bouin's solution (0.9% picric acid, 9% paraformaldehyde, 5% acetic acid/PBS) for 15 min. Following extensive PBS washes, cells were permeabilized with 0.1% Triton X-100/PBS for 10 min and incubated with 150 mM glycine to stabilize the aldehydes. The cells were then incubated for 30 min with 1% BSA (Fraction V; Cat. #BP1605, Sigma) containing 0.1% Triton X-100, followed by overnight incubation at 4° C. with rabbit anti-human PCSK9 (1:250) and rat anti-Grp94 (9G10, 1:1000; Cat. #ADI-SPA-850, Enzo Life Sciences). Afterward, cells were incubated for 60 min with corresponding Alexa Fluor-conjugated secondary antibodies (Molecular Probes) and mounted in 90% glycerol containing 5% 1,4-diazabicyclo[2.2.2]octane (DABCO; Cat. #D27802, Sigma). For PCSK9-mCherry (SEQ. ID. NO. 75 or 76) and LDLR-GFP (SEQ. ID. NO. 77) subcellular visualization, cells were transfected with corresponding plasmids or swapped with conditioned media containing PCSK9-mCherry. Twenty to forty-hours post-treatments, cells were washed three times with PBS and fixed with 4% paraformaldehyde/PBS for 15 min. Immunofluorescence analyses were performed with an Olympus FluoView FV10i confocal microscope.

    Reverse Transcription and Quantitative Real-Time PCR

    [0177] The integrity of total RNA samples, isolated using TRIzol (Cat. #15596026, Invitrogen), was verified by agarose gel electrophoresis or by an Agilent 2100 Bioanalyzer profile. Afterwards, cDNA was prepared using the SuperScript II Reverse transcriptase according the manufacturer's instructions (Cat. #18064-014, Invitrogen). Quantitative Real-Time PCR was performed with the MX3000p real-time thermal cycler (Agilent) using the PerfeCTa SYBR Green SuperMix, UNG, Low ROX (Cat. #95070-100, Quanta Biosciences). For each gene of interest, dissociation curves and agarose gel electrophoresis were performed to ensure unique PCR product. Arbitrary unit was determined from PCR duplicates for each sample using the ribosomal protein S16 as a normalizer. Oligonucleotides sequences used were: mouse Ldlr (5′-GGAGATGCACTTGCCATCCT, 5′-AGGCTGTCCCCCCAAGAC), mouse S16 (5′-AGGAGCGATTTGCTGGTGTGG; 5′-GCTACCAGGGCCTTTGAGATG).

    Recombinant Protein Production and Purification

    [0178] Full-length recombinant SEQ ID. NO. 67 (Cat. #ADI-SPP-766) was obtained from Enzo Life Sciences. For recombinant SEQ ID. NO. 43, the coding sequence of human GRP94 (aa 652-799) was PCR amplified and cloned into NheI/XhoI sites of pET24b(+) T7-inducible vector (Cat. #69750, EMD Millipore). SHuffle T7 Competent E. Coli (Cat. #C3026H, New England Biolabs) bearing the resulting pET24b(+)-SEQ ID. NO. 43 plasmid were grown at 30° C. in DYT media under Kanamycin selection to an A.sub.600 of 0.6 at which protein production was induced by addition of 1 mM isopropyl-β-D-thiogalactopyranoside (IPTG; Cat. #IPT001.5, BioShop) and kept growing for an additional 5 h. Following centrifugation at 6,000 g for 15 min, bacterial pellet was resuspended and sonicated in 60 ml of Buffer A (20 mM sodium phosphate, 500 mM NaCl, pH 7.4) and centrifuged at 11,000 g to remove debris. Resulting supernatant containing SEQ ID. NO. 43 recombinant protein was kept at 4° C. until purification. For human PCSK9 recombinant production, HEK293T cells (20×75 cm.sup.2) were transiently transfected with pIRES-hPCSK9-V5-His.sub.6 using PEI for which media was replaced 7 h post-transfection. Thirty hours post-transfection, each plate was replenished with 40 ml DMEM for 24 h. The following day, media was collected and fresh DMEM was added for another 24 h. A total of .sup.˜1.5 L of conditioned media were filter sterilized (0.45 μm; Cat. #83.1822, Sarstedt) in which imidazole was added at a final concentration of 5 mM. After equilibration in Buffer A, conditioned media or bacterial lysate containing SEQ ID. NO. 43 were loaded on a HisTRAP excel column (Cat. #17-3712-05, GE healthcare). Prior to elution, the column was washed with 10 bead volumes of Buffer A containing 5 mM or 40 mM imidazole for PCSK9-V5-His.sub.6 or SEQ ID. NO. 43, respectively. Afterwards, proteins were eluted by a continuous gradient of imidazole ranging from 5 to 500 mM (10 ml) and 500 mM imidazole was maintained for a total 25 ml elution volume. Eluted fractions monitored by absorbance at 280 nm were verified by western blotting and SDS-electrophoresis followed by coomassie staining (0.25% coomassie brilliant blue 250, 45% methanol, 10% acetic acid). Selected fractions were pooled and concentrated using Amicon centrifugal filters (Cat. #UFC500396, #UFC903024, EMD Millipore) down to 100 μl and loaded on a pre-equilibrated Superose 12 10/300 GL column (Cat. #17-5173-01, GE healthcare) for size exclusion chromatography. All FPLC protein purifications were performed using an ÄKTA explorer system (GE healthcare). Purity and specificity of purified recombinant proteins were verify by gel electrophoresis and coomassie staining as well as Western blotting for which pure protein concentration was determined either by using extinction coefficient calculation at A.sub.280 for SEQ ID. NO. 43 (NanoDrop 2000, Thermo Fisher Scientific) or by ELISA for PCSK9-V5-His.sub.6 (CircuLex Human PCSK9 ELISA Kit; Cat. #CY-8079, MBL International) according to the manufacturer's recommendations.

    Animal Studies

    [0179] Hepatocyte-specific Grp94-deficient mice (cGrp94f/f) were obtained by crossing Alb-Cre with Grp94f/f for which littermates lacking Alb-Cre served as WT controls (Chen et al., 2014). Wild-type C57BL/6 male mice were obtained from Charles River and maintained on a standard rodent diet for 3 days in a 12 h light/12 h dark cycle for acclimatization. Pcsk9-deficient male mice (Pcsk9−/−; Jackson Laboratories) were continuously backcrossed to C57BL/6 mice at least six generations prior to experimentations. Animals were anesthetized by isoflurane inhalation, blood was collected by cardiac puncture and dissected livers were snap-frozen in liquid nitrogen for further analyses. Plasma LDL-Cholesterol was measured using L-Type LDL-C Reagents (Cat. #993-00404, -00504, Wako Diagnostics). Circulating mouse Pcsk9 was immunoprecipitated and analyzed by Western blotting, as described previously (Poirier et al., 2014). All animal studies were approved by the Montreal Heart Institute Animal Care and Ethical committee.

    PCSK9 Competitive Assays

    [0180] Solid phase PCSK9-LDLR epidermal growth factor precursor homology domain A and B (LDLR EGF-AB) in vitro competitive binding assay (Circulex; Cat. #CY-8150) was performed with 100 ng (13.46 nM) of recombinant PCSK9-His6 together with increasing amount of recombinant SEQ ID NO. 6 according to manufacturer's recommendations. Using this in vitro competitive assay, SEQ ID NO. 6 was shown to specifically inhibit binding of WT PCSK9 to the LDLR-EGF-AB domain with an IC50 .sup.˜113 nM.

    High-Throughput/content (HT/CS) Assay

    [0181] HEK293 cells or human hepatic cell lines (HepG2 or Huh-7) were stably transformed with a vector comprising the cDNA according to SEQ ID NO. 69 corresponding to the human LDLR-EGFP fluorescent conjugated protein. [0182] HEK293 cells were transformed with a vector comprising the cDNA according to SEQ ID NO. 68 or 74) corresponding to the PCSK9-WT-mCherry (SEQ. ID. NO. 75) or PCSK9-D374Y-mCherry (SEQ. ID NO. 76) fluorescent fusion protein. Prepare PCSK9-D374Y-mCherry conditioned media from stably expressing HEK293_PCSK9-D374Y-mCherry cells by plating 12×T75 flasks. At >80% confluence, remove media and add 10 ml DMEM without phenol red (Cat. #319-050-CL, Wisent) to each flask (total 120 ml). [0183] Following overnight incubation, vacuum filter media (0.45 μM filter; Cat. #83.1822, Sarstedt) and keep at 4 C or −20 C. Addition of 10 ml DMEM to each flasks can be done for another day resulting in a total of .sup.˜240 ml of filtered media containing PCSK9-WT- or D374Y-mCherry (enough for 2 runs). Trypsinize HepG2 or HEK293_LDLR-EGFP cells (low passage) from .sup.˜5× confluent T75 flasks (.sup.˜12×10{circumflex over ( )}6 cells/flask) and dilute in DMEM (Cat. #319-005-CL, Wisent) supplemented with 10% FBS (Cat. #080-350, Wisent) to a final concentration of 4×10{circumflex over ( )}5 cells/ml. Plate HepG2 cells at density of 4×10{circumflex over ( )}4/well (100 μl/well from 4×105 cells/ml suspension).

    [0184] The assay could also be performed on cells co-expressing SEQ ID NO. 69 together with SEQ ID NO. 68 or 74 corresponding to human LDLR-EGFP and PCSK9-wt-mCherry and PCSK9-D374Y-mCherry fluorescent conjugated proteins.

    [0185] The effect of negative and positive control solutions on PCSK9-LDLR binding or PCSK9 internalization were tested by incubating the transformed HEK239 cells as follows: [0186] Negative Control: 10 μl DMSO 2% (stock 2 μl in 100 μl DMEM)+190 μl DMEM (final conc. DMSO 0.1%). Positive Ctrl: 4 nM (10×IC50) of PCSK9 neutralizing antibody (1.6 μg, 2.5 μl of 0.67 mg/ml; Cat. #71297, lot #121204-D, BPS Bioscience) in 1 ml of conditioned media obtained from HEK293 stably expressing PCSK9-D374Y-mCherry. [0187] The effect of negative and positive control solutions on PCSK9-LDLR binding or PCSK9 internalization were tested by incubating the transformed HEK239 cells as follows: [0188] Typical inhibitory assay experiment using the dual fluorescent cell-based assay. [0189] Forty-eight hours after plating of HEK293-LDLR-EGFP of HepG2-LDLR-EGFP expressing cells, remove the media, wash 3× with 150 μl of DMEM without serum and without phenol red (to wash residual endogenous PCSK9 in the media; only case for hepatic cell lines) and add 190 μl of DMEM_PCSK9-WT-mCherry or PCSK9-D374Y-mCherry+10 μl of 20× compounds, polypeptides, etc. to be tested to each well and mix gently. Also add negative (0.1% DMSO), positive (1.6 μg neutralizing Ab). Following 4-6 hours incubation, analyze LDLR-EGFP+PCSK9-mCherry residual fluorescence.

    Validation of Dual Fluorescent PCSK9-LDLR Cell-Based Assay

    [0190] As reference readout, ineffective inhibitors, removal of irrelevant proteins (not modulators of PCSK9-LDLR interaction), or variation/mutations in participating proteins with no functional impact, will result in low LDLR-EGFP levels and high PCSK9-mC (FIG. 15; top panel) and a red fluorescent signal will be detected. The predominant signal detected will be from the fluorophore conjugated to PCSK9 in this example m-Cherry, however any other suitable fluorophore that would function in the same way as m-Cherry could be used.

    [0191] In the case of blockade of PCSK9 internalization and degradation by the hepatic cells but not PCSK9 binding to LDLR, a yellow signal i.e. composite signal of extracellular LDLR conjugated GFP and intracellular PCSK9 conjugated mCherry. A yellow signal indicates cell surface and intracellular localization of PCSK9-mC-LDLR-EGFP complex without degradation (FIG. 15; top panel). In this case any combination of fluorophores can be used that will provide a composite signal that can be reliably distinguished from the signal derived either from a PCSK9 conjugated fluorophore or a LDLR conjugate fluorophore alone.

    [0192] In a third scenario, a potent PCSK9 inhibitor or removal of critical protein (on that modulates the LDLR-PCSK9 interaction) will give high LDLR-EGFP and low PCSK9-mC levels i.e. a green signal (FIG. 15; top panel). This result would indicate a potential for the compound tested to have lipid-lowering effects in vivo. The predominant signal detected will be from the fluorophore conjugated to LDLR. To validate the dual fluorescence PCSK9-LDLR cell-based assay, it was tested with WT PCSK9-mC (SEQ ID NO 75), or PCSK9-mC with a gain of function (GOF) D374Y mutant (SEQ ID NO 76). The assay comprising each of these 2 PCSK9 variants and LDLR-EGFP expressing HEK293 cells was validated without or with a PCSK9-LDLR neutralizing antibody. Confocal microscopy data clearly showed that the PCSK9 neutralizing antibody strongly prevent binding of WT and D374Y PCSK9-mC (FIG. 15; lower left panels) to LDLR-EGFP and protect LDLR from PCSK9-induced degradation (FIG. 15; lower middle left panels, green), enabling PCSK9-mC and LDLR-EGFP as a simple, specific and cost-effective cell-based assay.

    Identification of GRP94 as a New PCSK9 Binding Protein

    [0193] This study was designed to identify new PCSK9 interacting proteins. Accordingly, we selected the human hepatic HepG2 cell line, which has been commonly used to study LDLR degradation by PCSK9 as it endogenously expresses both proteins. Confluent HepG2 cells from 100 mm.sup.2 plates were washed three times in PBS and incubated with 1 mM DSP (dithiobis[succinimidylpropionate]), a thiol-cleavable and cell-permeable cross-linking reagent as described in Materials and Methods. Co-interacting PCSK9 proteins were immunoprecipitated (IP) with anti-PCSK9 polyclonal antibody and separated by SDS-PAGE electrophoresis under reducing conditions (FIG. 1a). Following silver staining, we identified a .sup.˜100 kDa band co-IP with PCSK9 that was undetectable in cell lysate incubated with the pre-immune serum (−), herein used as a control. Mass spectrometry data from the excised bands revealed SEQ ID. NO. 2 (GRP94/gp96) as the .sup.˜100 kDa migrating protein in complex with PCSK9 (Table 1). To further substantiate this interaction, human hepatic Huh-7 and HepG2 cells were transfected with either an empty vector (IRES-V5) or with cDNAs encoding V5-tagged human PCSK9 (PCSK9-V5; FIG. 1b). Forty-eight hours post-transfection, cells were cross-linked, proteins IP with mAb-V5 antibody and separated under reducing conditions. More intensely than in HepG2 cells, silver staining highlighted the .sup.˜100 kDa band co-IP with PCSK9-V5 in addition to .sup.˜76 kDa extra bands (FIG. 1b). Mass spectrometry data confirmed the presence of GRP94 in complex with PCSK9 together with GRP78 (also known as the ER stress-related molecular chaperone BiP; FIG. 1b and Table 2), the latter most likely due to overexpressing conditions. PCSK9 was also found by mass spectrometry at .sup.˜76 kDa corresponding to proPCSK9, the uncleaved PCSK9 form present within the ER. (Seidah et al., 2003) Interestingly, the .sup.˜100 kDa band was also detected in HepG2 and Huh-7 cells upon IP of PCSK9 lacking its Cys/His-rich C-terminal domain (CHRD; PCSK9-L455X-V5; FIG. 1b). In parallel experiments, immunoblotting confirmed that PCSK9-V5 and PCSK9-L455X-V5 specifically interact in complex with SEQ ID. NO. 3 (FIG. 1c). SEQ ID. NO. 3 was barely detectable in lysates IP with mAb-V5 overexpressing either the CHRD alone (PCSK9-CHRD-V5) or human LDLR-V5 (FIG. 1c). Conversely, we showed that both proPCSK9 and mature PCSK9-V5 were IP using anti-GRP94 (FIG. 1d) and that endogenous PCSK9 and GRP94 were highly co-localized in Huh-7 (FIG. 1d), suggesting the ER as a major subcellular interacting compartment. Therefore, we have identified GRP94 as a new PCSK9 intracellular binding protein in human hepatic cell lines both under overexpression and at endogenous levels.

    Critical Role of the SEQ ID. NO. 4 for PCSK9 Interaction

    [0194] We next decided to map GRP94 domain(s) important for PCSK9 protein-protein interaction. The overall domain structure of GRP94 includes a signal polypeptide (amino acids; aa1-21) followed by a N-terminal enzymatic ATP-binding domain (aa22-651), client-binding domain (CBD; aa652-678), C-terminal dimerization domain (aa679-799) and a KDEL polypeptide sequence (aa800-803) allowing retention of GRP94 in the endoplasmic reticulum. (Dollins et al., 2007; Maki et al., 1990; Wu et al., 2012) Thus, we first generated cDNA constructs encoding secretable HA-tagged forms of human GRP94 lacking its C-terminal KDEL polypeptide (SEQ ID. NO. 66; FIG. 2). HEK293 cells were transfected without or with SEQ ID. NO. 66 in absence or presence of PCSK9-V5 (FIG. 2a). Immunoblot analysis revealed that SEQ ID. NO. 66 is well expressed (Input; IB: HA) and secreted into media and that SEQ ID. NO. 66 interacts in complex with PCSK9 following immunoprecipitation (IP: V5; FIG. 2b). Therefore, we conclude that has endogenous GRP94 (FIG. 1), truncation of the KDEL did not impair interaction with PCSK9 (FIG. 2a), which was subsequently used as screening template. It was reported that a 27 aa C-terminal hydrophobic loop structure within GRP94 client-binding domain (CBD, amino acids aa652-678; .sup.652YGWSGNMERIMKAQAYQTGKDISTNYY, SEQ ID. NO. 4) was important for folding and interaction with Toll-like receptors and integrins. (Wu et al., 2012) Deletion or alanine-scan mutations in SEQ ID. NO. 4 region of GRP94 was shown to not alter its overall structure nor its N-terminal ATPase activity and binding to co-chaperone CNPY3 but prevented interaction with its client proteins. (Wu et al., 2012) Similarly, we generated two mutated constructs in which critical residues within the GRP94-CBD domain where mutated into alanine (AA1: .sup.652YAASAAAAAIMKAQAYQTGKDISTNYY, SEQ ID. NO. 78 and AA2: .sup.652YGWSGNMERIMKAQAYATGKAISTNAA, SEQ ID. NO. 79). HEK293 cells were transfected with either an empty vector (−) or with SEQ ID. NO. 66, 64 or 65 constructs in presence or absence of PCSK9-V5 (FIG. 2b). Although SEQ ID. NO. 64 and 65 are expressed at similar levels as GRP94 (FIG. 2b; Input), mutations within the region of SEQ ID. NO. 4 abrogate binding to PCSK9 (IP: V5), demonstrating that interaction of PCSK9 with GRP94 require a functional CBD domain. Thence, we truncated the N-terminal enzymatic domain (aa 22-651) encoding a secretable .sup.˜20 kDa HA-tagged (SEQ ID. NO. 66) protein containing the CDB and C-terminal domains (CBD-CT; SEQ ID. NO. 46), which have been shown to be sufficient for interaction with client proteins. (Wu et al., 2012) HEK293 cells were transfected with either an empty vector (−), SEQ ID. NO. 66 or SEQ ID. NO. 46 in absence (−) or presence of PCSK9-V5 (+) and protein lysates IP with mAb-HA antibody and immunoblotted for PCSK9 (IB: V5; FIG. 2c, left panel). Slot blot analysis revealed that PCSK9 did not affect intra- or extracellular protein levels of SEQ ID. NO. 66 (IB: HA, FIG. 2c, Input). Whereas that SEQ ID. NO. 7 was .sup.˜5-fold less produced as compared to SEQ ID. NO. 66, truncation of the N-terminal domain of GRP94 significantly enhanced its interaction to PCSK9 (FIG. 2c). These data are consistent with the identification of important residues within the solvent exposed 27-aa stretch SEQ ID. NO. 4 (highlighted in red and blue from SEQ ID. NO. 64 and SEQ ID. NO. 65; FIGS. 2b and 2c, right panel), which reinforce the direct implication of SEQ ID. NO. 4 as an important PCSK9 modulating polypeptide.

    GRP94 is not a Molecular Chaperone for PCSK9

    [0195] It has been demonstrated that proper folding and functions of GRP94 client proteins directly corroborate with their CBD binding. (Wu et al., 2012) Despite its limited number of client proteins, (McLaughlin and Vandenbroeck, 2011) we next wanted to determine whether GRP94 is a direct molecular chaperone for PCSK9. HepG2 cells were incubated for 24 h with vehicle (DMSO) or with 1 or 5 μM Geldanamycin (GA), a small molecule competitive inhibitor of the N-terminal ATP binding site of GRP94 (also known as HSP90b1) and its cytosolic paralog Hsp90. (Dollins et al., 2007; McLaughlin and Vandenbroeck, 2011; Stebbins et al., 1997) Immunoblot analysis revealed that geldanamycin treatment did not affect PCSK9 and LDLR total protein levels, proPCSK9 to PCSK9 autocatalytic activation, and PCSK9 secretion in the media (FIG. 3a), eliminating a role for GRP94 as a PCSK9 direct chaperone. To further substantiate those observations, HEK293 cells were transfected with either non-targeting siRNA (−) or with siRNAs against human GRP94 (+) alone or together with wild-type PCSK9-V5 or its high LDLR affinity gain-of-function D374Y mutant (FIG. 3b). (Poirier and Mayer, 2013) Forty-hours later, cells were washed, incubated in DMEM for 24 h and PCSK9 immunoprecipiated from cell lysates 72 h post-transfection with mAb-V5 antibody. Immunoblotting revealed efficient siRNA-mediated knockdown (KD) of endogenous GRP94, which clearly demonstrated the specificity of GRP94-PCSK9 interaction by the almost undetectable signal of GRP94 followed PCSK9 IP (FIG. 3b; IP:V5, IB:GRP94). Interestingly, both WT and PCSK9-D374Y mutant were comparably co-IP in complex with GRP94 and were able to induce intracellular LDLR degradation even in absence of GRP94 in HEK293 cells (FIG. 3b; Input, left panel) or following media swap on naïve HepG2 cells (FIG. 3b; Input, right panel). Consistent with enzymatic inhibition of GRP94 (FIG. 3a), KD of GRP94 did not alter PCSK9 total protein levels, autocatalytically (proPCSK9->PCSK9) and furin-regulated processing (PCSK9-ΔN.sub.218)(Benjannet et al., 2006), nor its secretion (FIG. 3b; IB: V5, Cond. Media) maintaining its full capacity to induce LDLR degradation both via intra- and extracellular pathways (FIG. 3b). This suggests that binding of PCSK9 to GRP94-CBD (FIG. 2) would not correlated with its chaperoning function in the ER but (FIG. 3), according to our knowledge, would rather be the first evidence of a role as an interacting protein.

    GRP94 KD Increase Sensitivity to PCSK9-Induced LDLR Degradation

    [0196] To decipher the role of GRP94 on PCSK9, we took advantage of HEK293 cells, as they are easily transfectable in addition to be PCSK9-negative. (Seidah et al., 2003) Cells were transfected with either non-targeting siRNA (−) or with siRNAs against human GRP94 (+) and 24 h later without (−) or plasmids encoding for fluorescent PCSK9-mCherry or LDLR-EGFP (FIG. 4). Twenty-hours post cDNA transfections, cells were incubated either with vehicle (DMSO) or 5 μM MG132, a proteasome inhibitor. As shown in FIG. 4a, C-terminal fusion of either EGFP to LDLR (lane 2) or mCherry to PCSK9 (lane 3) are well tolerated upon transfection in HEK293 cells and that PCSK9-mCherry preserve its capacity to induced LDLR-EGFP degradation (lane 3). Interestingly, immunoblot (FIG. 4a, lane 5) and confocal microscopy (FIG. 4b, top panels) analyses revealed that KD of GRP94 renders LDLR much more sensitive to PCSK9-induce degradation that was not blocked by addition of the proteasome inhibitor MG132 similar as previously described. (Maxwell et al., 2005) These data suggest that, while not being involved in chaperoning of PCSK9, GRP94-PCSK9 complex formation could prevent early PCSK9 binding to LDLR and thus limiting its subsequent degradation.

    SEQ ID. NO. 4 Reduces PCSK9 Internalization and LDLR Degradation

    [0197] To validate this hypothesis, we therefore first tested the effect of extracellular SEQ ID. NO. 67 on PCSK9 internalization. Recombinant SEQ ID. NO. 67 was added to conditioned media obtained from HEK293 cells transfected with PCSK9-mCherry and incubated by rotation 4 h at 4° C. and incubated overnight on HepG2 cells transiently transfected with LDLR-EGFP (FIG. 5a). Confocal microscopy analysis revealed that PCSK9-mCherry internalization was significantly reduced in LDLR-EGFP expressing cells in the presence of extracellular (+ rcGRP94, SEQ ID. NO. 67) as compared to control (− rcGRP94, SEQ ID. NO. 67; FIG. 5a). Thereafter, we wanted to study the impact of extracellular SEQ ID. NO. 67 on PCSK9-induced LDLR degradation. HepG2 cells were incubated overnight without or with recombinant PCSK9 in presence of an increasing amount of rcGRP94 (SEQ ID. NO.67; FIG. 5b). Immunoblot data revealed that PCSK9 significantly induces LDLR degradation, which can be reverted in a dose-dependent manner by exogenous addition of SEQ ID. NO. 67. We also noted that HepG2 cells endogenously secrete .sup.˜5 nM SEQ ID. NO. 3 that has not prevented LDLR degradation following addition of 25 nM PCSK9 (FIG. 5b; lane 2) but rather might be sufficient under PCSK9 endogenous conditions. Those data demonstrated that exogenous addition of SEQ ID. NO. 67 inhibits PCSK9-induced LDLR degradation by blocking its internalization by the LDLR.

    In Vitro Competitive Assay of SEQ ID. NO. 6 on PCSK9-LDLR Binding

    [0198] Biochemical and crystallographic studies demonstrated that surface of PCSK9 catalytic domain directly binds to the extracellular EGF-A domain of LDLR. (Kwon et al., 2008; Zhang et al., 2007) By co-IP experiments, we showed that PCSK9-GRP94 complex formation involves the PCSK9 proregion-catalytic domains (FIG. 1c) and the SEQ ID. NO. 6 (FIG. 2), suggesting that the inhibitory effect of SEQ ID. NO. 3 might be due to direct competition for PCSK9 binding to the LDLR. To test this hypothesis, we subcloned the SEQ ID. NO. 6 into the pET-24 bacterial expressing vector of which recombinant protein were retrieved from E. coli and purified by metal affinity and size exclusion chromatography. The homogeneity of purified SEQ ID. NO. 6(.sup.˜20 kDa) and recombinant PCSK9 purified from conditioned media of HEK293 transfected cells were assessed by SDS-PAGE and coomassie staining (FIG. 6; left panels). For in vitro PCSK9-LDLR competitive assays, 1 μg PCSK9 was prior incubated without (−) or with 1 μg of SEQ ID. NO. 6 for 4 h and incubated by rotation overnight at 4° C. with 1 μg LDLR together with mAb-V5 antibody and A/G-agarose beads. Immunoblot analysis showed that LDLR was specifically pull-down with PCSK9 that can be partially inhibited in the presence of SEQ ID. NO. 6 (FIG. 6; right panel, lane 2).

    SEQ ID. NO. 10 Inhibits PCSK9-Induced LDLR Degradation

    [0199] We next tested whether SEQ ID. NO. 6 could alter the capacity of PCSK9 to induce LDLR degradation. HepG2 cells were incubated overnight with an increasing amount of recombinant SEQ ID. NO. 6 in absence or presence of exogenous PCSK9 (FIG. 7a). Immunoblot revealed that extracellular addition of SEQ ID. NO. 6 significantly increases total LDLR protein levels, for which maximum effect was already saturated at 25 nM. Although that SEQ ID. NO. 6 appears to significantly block endogenously secreted PCSK9, 250 nM SEQ ID. NO. 6 was not sufficient to block exogenously added PCSK9 (.sup.˜6-fold endogenous levels; FIG. 7a). (Poirier et al., 2009) As PCSK9 was also shown to induce LDLR degradation via an intracellular pathway, (Poirier et al., 2009) we evaluated to ability of SEQ ID. NO. 66 or SEQ ID. NO. 46 to neutralize PCSK9 in HepG2 cells following co-expression (FIG. 7b). Similar to the extracellular pathway (FIGS. 5b and 7a), both SEQ ID. NO. 66 and SEQ ID. NO. 46 significantly block LDLR degradation induced by overexpression of PCSK9 in HEK293 cells (FIG. 7b). Overall, these data demonstrated that SEQ ID. NO. 66 and specifically SEQ ID. NO. 46 as inhibitory effect on PCSK9 binding to LDLR and its subsequent degradation most likely via a direct protein-protein interaction.

    Hepatic Grp94 Controls Circulating LDL-C by Maintaining LDLR Protein Levels

    [0200] We next wanted to extend our observations and study the role of Grp94 in vivo. The liver plays a major role in the regulation of circulating LDL-Cholesterol through cell surface LDLR in addition to be the far most abundant tissue expressing Pcsk9, exclusively secreted in plasma by hepatocytes. (Goldstein and Brown, 1987; Seidah et al., 2003; Zaid et al., 2008) Accordingly, floxed-Grp94 mice were crossed with albumin-Cre transgenic mice to generate hepatocyte-specific Grp94 deficient mice therefore named cGrp94f/f. (Chen et al., 2014) While Ldlr mRNA levels were not affected by the absence of Grp94 (FIG. 8a), we observed a severe decrease in total Ldlr protein levels in livers of cGrp94f/f reminiscent of PCSK9-overexpressing transgenic mice (FIG. 8b). (Zaid et al., 2008) Similar to Ldlr-deficient mice, we also noticed that total and furin-cleaved circulating Pcsk9 levels were elevated in plasma of cGrp94f/f mice (FIG. 8c). As observed in our ex vivo GRP94 KD experiments (FIG. 3b), we confirmed that Grp94 is not a direct chaperone of Pcsk9 as reflected by its large amount secreted into the plasma of cGrp94f/f mice (FIG. 8c). In agreement with low Ldlr levels in cGrp94f/f mice livers, we measured a significant .sup.˜50% increase in circulating LDL-Cholesterol (FIG. 8d). Interestingly, this difference is similar to the reduction observed in Pcsk9-deficient mice (FIG. 8d; Pcsk9−/−). Those cumulative data revealed that GRP94 is a master regulator of LDL-C and LDLR protein levels both ex vivo and in vivo, likely by preventing PCSK9 binding to the LDLR.

    Proposed Model for GRP94 Inhibitory Effect on PCSK9-Induced LDLR Degradation

    [0201] Based on our data, we showed that in absence of GRP94, LDLR total protein levels are severely decreased leading to increase circulating PCSK9 and LDL-C in the plasma (FIG. 9; left panel). This can be explained by the observations that LDLR was much more sensitive to degradation by PCSK9 upon GRP94 KD in HEK293 cells (FIG. 4), suggesting that GRP94 binding to PCSK9 as an underlying mechanism. Conversely, we speculate that in physiological conditions, GRP94 within the ER acts as a protein-protein binding partner to PCSK9 preventing hasty binding to LDLR thus avoiding early degradation of the receptor via intra- or extracellular pathways (FIG. 9; Right panel). This new underline protection mechanism allows the liver to control LDL-C by maintaining LDLR total protein levels without leading to complete degradation within hepatocytes.

    Structure of the SEQ ID. NO. 4 Polypeptide Binding to PCSK9

    [0202] APCSK9 interacting domain of GRP94 was determined from the full-length GRP94 crystal structure PDB #2O1V (FIG. 10). Ribbon structure of the SEQ ID. NO. 4 (aa652-678; .sup.652YYGWSGNMERIMKAQAYQTGKDISTNYY) with side chains are represented and propose to be used as a PCSK9 interacting polypeptide or peptidomimetic template to inhibit PCSK9 activities such in the context of LDLR degradation and/or systemic inflammation.

    Example 2

    [0203] Peptide encoded by SEQ ID. NO. 4 (YGWSGNMERIMKAQAYQTGKDISTNYY) was synthesized on rink amide resin using a Tribute peptide synthesizer (Protein Technologies) by standard Fmoc chemistry. After cleavage from the solid support, crude peptide was precipitated and washed with diethyl ether, recovered by vacuum filtration, and dissolved in distilled water before being lyophilized. Peptide was purified by reverse-phase high performance liquid chromatography (RP-HPLC) on a preparative Luna C18 column (250 mm×21.2 mm, 5 μm, 100 Å, Phenomenex) with a linear gradient of acetonitrile (ACN) in TFA/H2O (0.06% v/v). Collected fractions were analyzed by analytical RP-HPLC using a Kinatex EVO C18 column (150 mm×4.6 mm, 3.6 μm, Phenomenex) and mass-verified by electrospray ionization time-of-flight mass spectrometry (ESI-TOF MS). Fractions containing SEQ 04 at 95% purity or greater as measured by RP-HPLC were pooled and lyophilized. Peptides were stored dry at −20° C.

    [0204] SEQ ID. NO. 4 peptide was dissolved to 10 mM (working dilution) in DMEM media (Wisent Cat. #319-005-CL). In a total of 100 μl reaction buffer (HEPES buffer containing NaCl, CaCl.sub.2), BSA and proclin 300, pH6.1), SEQ ID. NO. 4 were added to a final concentration of 100 or 10 μM together with 100 ng wild-type human recombinant His-tagged PCSK9. Reaction buffer was added to 96 wells coated with recombinant LDLR-EGFA domain (involved in PCSK9-LDLR interaction) and incubated at room temperature for 2 h on an orbital microplate shaker (300 rpm). Following incubation, wells were washed 4 times with wash buffer and biotinylated anti-His-tag monoclonal antibody was added into each well and incubated for 1 h at room temperature. Following incubation wells were washed 4 times, and HRP-conjugated streptatvidin was added to each well and incubated for 20 min. Following 4 washes, 100 μl substrate reagent (TMB, tetra-methylbenzidine) were added for 15 min to each wells and enzymatic reaction stopped by adding 100 μl stop solution (1N NH2SO4). For each well, absorbance at 450 nm and 540 nm was measure and relative PCSK9 binding to LDLR-EGFA was determined according to a standard curve (100 ng to 1.56 ng). Inhibitory activities of SEQ ID. No. 4 was tested in separated triplicates and dose-response for PCSK9-LDLR inhibition (Evolocumab, PCSK9 mAbs; herein used as comparator positive control) was also performed in parallel on each plate. Results are shown in FIG. 16.

    [0205] It has been previously shown that the surface of PCSK9 catalytic domain directly interacts with the EGF-A domain of the low-density lipoprotein receptor (LDLR). Therefore, this underlying mechanism of action was the premise that lead to the development of neutralizing humanized PCSK9 monoclonal antibodies (such as Evolocumab™), currently indicated to treat patients with familial hypercholesterolemia and/or history of atherosclerotic cardiovascular diseases on top of statins. It has been observed clinically that antibodies binding to the surface of PCSK9 catalytic domain result in lowering of circulating LDL Using an in vitro PCSK9-LDLR(EGFA) competitive assay, data showed that peptide encoding SEQ ID. NO. 4 (first 27 aa of SEQ 06) inhibit binding of PCSK9 to the LDLR EGFA domain. Thus, we conclude that similar to Evolocumab, binding of SEQ ID. NO. 4 to PCSK9 is concomitant to its inhibitory effect on PCSK9-LDLR a validated molecular target to reduce circulating LDL-cholesterol. Similarly to Evolocumab, the proposed peptides of the invention will reduce circulating LDL-cholesterol without all the disadvantages related to monoclonal antibody therapy. Of course, peptides shorter or longer than those of SEQ. ID. 4 are usable to reduce circulating LDL-cholesterol, as long as the portion of SEQ. ID. 4 or homologous portions thereof that bind to PCSK9 are exposed after folding of the peptide.

    [0206] In some embodiments, the polypeptide preserves the residues identified in the results of FIG. 2 as reducing binding to PCSK9 when replaced with Ala, optionally with the substitutions set forth in table 2 which are known to have little effect on protein functions. Peptide of the present invention may be less than 40, less than 60, less than 80, less than 100, less than 120, or less than 140 amino acids in length in some embodiments. The structure of such small peptides can be computed before synthesis, which allows to determine a sequence of amino acids that will expose a subsequence having a structure and properties close to those of SEQ. ID. 4, and which therefore will bind to PCSK9. For example, the peptides could include as a subsequence YGWX1GNX2EX3X4X5X6DX7YY Wherein X1 is S or T, X2 is M or Z, X3 is R or K, X4 is IMKAQAY, or any suitable amino acid sequence of between 3 and 10 amino acids in length, X5 is Q or D, X6 is TGK or any suitable amino acid sequence of between 2 and 6 amino acids in length, X7 is ISTN or any suitable amino acid sequence of between 2 and 10 amino acids in length.

    REFERENCES

    [0207] Abifadel, M., Rabes, J. P., Devillers, M., Munnich, A., Erlich, D., Junien, C., Varret, M., and Boileau, C. (2009). Mutations and polymorphisms in the proprotein convertase subtilisin kexin 9 (PCSK9) gene in cholesterol metabolism and disease. Hum. Mutat. 30, 520-529. [0208] Abifadel, M., Varret, M., Rabes, J. P., Allard, D., Ouguerram, K., Devillers, M., Cruaud, C., Benjannet, S., Wickham, L., Erlich, D., et al. (2003). Mutations in PCSK9 cause autosomal dominant hypercholesterolemia. Nat. Genet. 34, 154-156. [0209] Aimiuwu, J., Wang, H., Chen, P., Xie, Z., Wang, J., Liu, S., Klisovic, R., Mims, A., Blum, W., Marcucci, G., et al. (2012). RNA-dependent inhibition of ribonucleotide reductase is a major pathway for 5-azacytidine activity in acute myeloid leukemia. Blood 119, 5229-5238. [0210] Baigent, C., Blackwell, L., Emberson, J., Holland, L. E., Reith, C., Bhala, N., Peto, R., Barnes, E. H., Keech, A., Simes, J., et al. (2010). Efficacy and safety of more intensive lowering of LDL cholesterol: a meta-analysis of data from 170,000 participants in 26 randomised trials. Lancet 376, 1670-1681. [0211] Benjannet, S., Rhainds, D., Essalmani, R., Mayne, J., Wickham, L., Jin, W., Asselin, M. C., Hamelin, J., Varret, M., Allard, D., et al. (2004). NARC-1/PCSK9 and its natural mutants: zymogen cleavage and effects on the low density lipoprotein (LDL) receptor and LDL cholesterol. J. Biol. Chem. 279, 48865-48875. [0212] Benjannet, S., Rhainds, D., Hamelin, J., Nassoury, N., and Seidah, N. G. (2006). The proprotein convertase (PC) PCSK9 is inactivated by furin and/or PC5/6A: functional consequences of natural mutations and post-translational modifications. J. Biol. Chem. 281, 30561-30572. [0213] Berge, K. E., Ose, L., and Leren, T. P. (2006). Missense mutations in the PCSK9 gene are associated with hypocholesterolemia and possibly increased response to statin therapy. Arterioscler. Thromb. Vasc. Biol. 26, 1094-1100. [0214] Brown, M. S., and Goldstein, J. L. (1986). A receptor-mediated pathway for cholesterol homeostasis. Science 232, 34-47. [0215] Bruckert, E., Hayem, G., Dejager, S., Yau, C., and Begaud, B. (2005). Mild to moderate muscular symptoms with high-dosage statin therapy in hyperlipidemic patients—the PRIMO study. Cardiovasc. Drugs Ther. 19, 403-414. [0216] Chan J C, Piper D E, Cao Q et al. A proprotein convertase subtilisin/kexin type 9 neutralizing antibody reduces serum cholesterol in mice and nonhuman primates. Proc Natl Acrid Sci USA. 2009; 106(24):9820-9825. [0217] Chen, W. T., Tseng, C. C., Pfaffenbach, K., Kanel, G., Luo, B., Stiles, B. L., and Lee, A. S. (2014). Liver-specific knockout of GRP94 in mice disrupts cell adhesion, activates liver progenitor cells, and accelerates liver tumorigenesis. Hepatology 59, 947-957. [0218] Cloutier, P., Al-Khoury, R., Lavallee-Adam, M., Faubert, D., Jiang, H., Poitras, C., Bouchard, A., Forget, D., Blanchette, M., and Coulombe, B. (2009). High-resolution mapping of the protein interaction network for the human transcription machinery and affinity purification of RNA polymerase II-associated complexes. Methods 48, 381-386. [0219] Cohen, J., Pertsemlidis, A., Kotowski, I. K., Graham, R., Garcia, C. K., and Hobbs, H. H. (2005). Low LDL cholesterol in individuals of African descent resulting from frequent nonsense mutations in PCSK9. Nat. Genet. 37, 161-165. [0220] Cohen, J. C., Boerwinkle, E., Mosley, T. H., Jr., and Hobbs, H. H. (2006). Sequence variations in PCSK9, low LDL, and protection against coronary heart disease. N. Engl. J. Med. 354, 1264-1272. [0221] Cunningham, D., Danley, D. E., Geoghegan, K. F., Griffor, M. C., Hawkins, J. L., Subashi, T. A., Varghese, A. H., Ammirati, M. J., Culp, J. S., Hoth, L. R., et al. (2007). Structural and biophysical studies of PCSK9 and its mutants linked to familial hypercholesterolemia. Nat Struct Mol Biol 14, 413-419. [0222] Dollins, D. E., Warren, J. J., lmmormino, R. M., and Gewirth, D. T. (2007). Structures of GRP94-nucleotide complexes reveal mechanistic differences between the hsp90 chaperones. Mol. Cell 28, 41-56. [0223] Dubuc, G., Chamberland, A., Wassef, H., Davignon, J., Seidah, N. G., Bernier, L., and Prat, A. (2004). Statins upregulate PCSK9, the gene encoding the proprotein convertase neural apoptosis-regulated convertase-1 implicated in familial hypercholesterolemia. Arterioscler. Thromb. Vasc. Biol. 24, 1454-1459. [0224] Goldstein, J. L., and Brown, M. S. (1987). Regulation of low-density lipoprotein receptors: implications for pathogenesis and therapy of hypercholesterolemia and atherosclerosis. Circulation 76, 504-507. [0225] Heidenreich, P. A., Trogdon, J. G., Khavjou, O. A., Butler, J., Dracup, K., Ezekowitz, M. D., Finkelstein, E. A., Hong, Y., Johnston, S. C., Khera, A., et al. (2011). Forecasting the future of cardiovascular disease in the United States: a policy statement from the American Heart Association. Circulation 123, 933-944. [0226] Hooper, A. J., Marais, A. D., Tanyanyiwa, D. M., and Burnett, J. R. (2007). The C679X mutation in PCSK9 is present and lowers blood cholesterol in a Southern African population. Atherosclerosis 193, 445-448. [0227] Horton, J. D., Shah, N. A., Warrington, J. A., Anderson, N. N., Park, S. W., Brown, M. S., and Goldstein, J. L. (2003). Combined analysis of oligonucleotide microarray data from transgenic and knockout mice identifies direct SREBP target genes. Proc. Natl. Acad. Sci. U.S.A. 100, 12027-12032. [0228] Hou, R., and Goldberg, A. C. (2009). Lowering low-density lipoprotein cholesterol: statins, ezetimibe, bile acid sequestrants, and combinations: comparative efficacy and safety. Endocrinol. Metab. Clin. North Am. 38, 79-97. [0229] Jorgensen, M. M., Jensen, O. N., Holst, H. U., Hansen, J. J., Corydon, T. J., Bross, P., Bolund, L., and Gregersen, N. (2000). Grp78 is involved in retention of mutant low density lipoprotein receptor protein in the endoplasmic reticulum. J. Biol. Chem. 275, 33861-33868. [0230] Kannel, W. B., Dawber, T. R., Kagan, A., Revotskie, N., and Stokes, J., 3rd (1961). Factors of risk in the development of coronary heart disease—six year follow-up experience. The Framingham Study. Ann. Intern. Med. 55, 33-50. [0231] Kapur, N. K., and Musunuru, K. (2008). Clinical efficacy and safety of statins in managing cardiovascular risk. Vasc Health Risk Manag 4, 341-353. [0232] Kwon, H. J., Lagace, T. A., McNutt, M. C., Horton, J. D., and Deisenhofer, J. (2008). Molecular basis for LDL receptor recognition by PCSK9. Proc. Natl. Acad. Sci. U.S.A. 105, 1820-1825. [0233] Lagace, T. A., Curtis, D. E., Garuti, R., McNutt, M. C., Park, S. W., Prather, H. B., Anderson, N. N., Ho, Y. K., Hammer, R. E., and Horton, J. D. (2006). Secreted PCSK9 decreases the number of LDL receptors in hepatocytes and in livers of parabiotic mice. J. Clin. Invest. 116, 2995-3005. [0234] Lee, A. S. (2014). Glucose-regulated proteins in cancer: molecular mechanisms and therapeutic potential. Nature reviews. Cancer 14, 263-276. [0235] Leigh, S. E., Foster, A. H., Whittall, R. A., Hubbart, C. S., and Humphries, S. E. (2008). Update and analysis of the University College London low density lipoprotein receptor familial hypercholesterolemia database. Ann. Hum. Genet. 72, 485-498. [0236] Leigh, S. E., Leren, T. P., and Humphries, S. E. (2009). Commentary PCSK9 variants: A new database. Atherosclerosis 203, 32-33. [0237] Lusis, A. J. (2000). Atherosclerosis. Nature 407, 233-241. [0238] Macer, D. R., and Koch, G. L. (1988). Identification of a set of calcium-binding proteins in reticuloplasm, the luminal content of the endoplasmic reticulum. J. Cell Sci. 91 (Pt 1), 61-70. [0239] Mackay, J., and Mensah, G. A. (2004). The Atlas of Heart Disease and Stroke. World Health Organization, 112p. [0240] Maki, R. G., Old, L. J., and Srivastava, P. K. (1990). Human homologue of murine tumor rejection antigen gp96: 5′-regulatory and coding regions and relationship to stress-induced proteins. Proc. Natl. Acad. Sci. U.S.A. 87, 5658-5662. [0241] Marduel, M., Ouguerram, K., Serre, V., Bonnefont-Rousselot, D., Marques-Pinheiro, A., Erik Berge, K., Devillers, M., Luc, G., Lecerf, J. M., Tosolini, L., et al. (2013). Description of a large family with autosomal dominant hypercholesterolemia associated with the APOE p. Leu167del mutation. Hum. Mutat. 34, 83-87. [0242] Maxwell, K. N., and Breslow, J. L. (2004). Adenoviral-mediated expression of Pcsk9 in mice results in a low-density lipoprotein receptor knockout phenotype. Proc. Natl. Acad. Sci. U.S.A. 101, 7100-7105. [0243] Maxwell, K. N., Fisher, E. A., and Breslow, J. L. (2005). Overexpression of PCSK9 accelerates the degradation of the LDLR in a post-endoplasmic reticulum compartment. Proc. Natl. Acad. Sci. U.S.A. 102, 2069-2074. [0244] Maxwell, K. N., Soccio, R. E., Duncan, E. M., Sehayek, E., and Breslow, J. L. (2003). Novel putative SREBP and LXR target genes identified by microarray analysis in liver of cholesterol-fed mice. J. Lipid Res. 44, 2109-2119. [0245] McLaughlin, M., and Vandenbroeck, K. (2011). The endoplasmic reticulum protein folding factory and its chaperones: new targets for drug discovery? Br. J. Pharmacol. 162, 328-345. [0246] McNutt, M. C., Lagace, T. A., and Horton, J. D. (2007). Catalytic activity is not required for secreted PCSK9 to reduce low density lipoprotein receptors in HepG2 cells. J. Biol. Chem. 282, 20799-20803. [0247] Müller, C. (1938). Xanthoma, hypercholesterolemia, angina pectoris. Acta Med Scand Suppl., 75-84. [0248] Nassoury, N., Blasiole, D. A., Tebon Oler, A., Benjannet, S., Hamelin, J., Poupon, V., McPherson, P. S., Attie, A. D., Prat, A., and Seidah, N. G. (2007). The cellular trafficking of the secretory proprotein convertase PCSK9 and its dependence on the LDLR. Traffic 8, 718-732. [0249] O'Keefe, J. H., Jr., Cordain, L., Harris, W. H., Moe, R. M., and Vogel, R. (2004). Optimal low-density lipoprotein is 50 to 70 mg/dl: lower is better and physiologically normal. J. Am. Coll. Cardiol. 43, 2142-2146. [0250] Park, S. W., Moon, Y. A., and Horton, J. D. (2004). Post-transcriptional regulation of low density lipoprotein receptor protein by proprotein convertase subtilisin/kexin type 9a in mouse liver. J. Biol. Chem. 279, 50630-50638. [0251] Pena, F., Jansens, A., van Zadelhoff, G., and Braakman, I. (2010). Calcium as a crucial cofactor for low density lipoprotein receptor folding in the endoplasmic reticulum. J. Biol. Chem. 285, 8656-8664. [0252] Poirier, S., and Mayer, G. (2013). The biology of PCSK9 from the endoplasmic reticulum to lysosomes: new and emerging therapeutics to control low-density lipoprotein cholesterol. Drug design, development and therapy 7, 1135-1148. [0253] Poirier, S., Mayer, G., Benjannet, S., Bergeron, E., Marcinkiewicz, J., Nassoury, N., Mayer, H., Nimpf, J., Prat, A., and Seidah, N. G. (2008). The proprotein convertase PCSK9 induces the degradation of low density lipoprotein receptor (LDLR) and its closest family members VLDLR and ApoER2. J. Biol. Chem. 283, 2363-2372. [0254] Poirier, S., Mayer, G., Poupon, V., McPherson, P. S., Desjardins, R., Ly, K., Asselin, M. C., Day, R., Duclos, F. J., Witmer, M., et al. (2009). Dissection of the endogenous cellular pathways of PCSK9-induced low density lipoprotein receptor degradation: evidence for an intracellular route. J. Biol. Chem. 284, 28856-28864. [0255] Poirier, S., Samami, S., Mamarbachi, M., Demers, A., Chang, T. Y., Vance, D. E., Hatch, G. M., and Mayer, G. (2014). The epigenetic drug 5-azacytidine interferes with cholesterol and lipid metabolism. J. Biol. Chem. 289, 18736-18751. [0256] Rader, D. J., Cohen, J., and Hobbs, H. H. (2003). Monogenic hypercholesterolemia: new insights in pathogenesis and treatment. J. Clin. Invest. 111, 1795-1803. [0257] Rashid, S., Curtis, D. E., Garuti, R., Anderson, N. N., Bashmakov, Y., Ho, Y. K., Hammer, R. E., Moon, Y. A., and Horton, J. D. (2005). Decreased plasma cholesterol and hypersensitivity to statins in mice lacking Pcsk9. Proc. Natl. Acad. Sci. U.S.A. 102, 5374-5379. [0258] Sabatine M S, Giugliano R P, Wiviott S D, et al. Efficacy and safety of evolocumab in reducing lipids and cardiovascular events. N Engl J Med. 2015; 372(16):1500-1509. [0259] Seidah, N. G., Benjannet, S., Wickham, L., Marcinkiewicz, J., Jasmin, S. B., Stifani, S., Basak, A., Prat, A., and Chretien, M. (2003). The secretory proprotein convertase neural apoptosis-regulated convertase 1 (NARC-1): liver regeneration and neuronal differentiation. Proc. Natl. Acad. Sci. U.S.A. 100, 928-933. [0260] Stebbins, C. E., Russo, A. A., Schneider, C., Rosen, N., Hartl, F. U., and Pavletich, N. P. (1997). Crystal structure of an Hsp90-geldanamycin complex: targeting of a protein chaperone by an antitumor agent. Cell 89, 239-250. [0261] Walley, K. R., Thain, K. R., Russell, J. A., Reilly, M. P., Meyer, N.J., Ferguson, J. F., Christie, J. D., Nakada, T. A., Fjell, C. D., Thair, S. A., et al. (2014). PCSK9 is a critical regulator of the innate immune response and septic shock outcome. Science translational medicine 6, 258ra143. [0262] Wang, Y., Huang, Y., Hobbs, H. H., and Cohen, J. C. (2012). Molecular characterization of proprotein convertase subtilisin/kexin type 9-mediated degradation of the LDLR. J. Lipid Res. 53, 1932-1943. [0263] Weekes, M. P., Antrobus, R., Talbot, S., Hor, S., Simecek, N., Smith, D. L., Bloor, S., Randow, F., and Lehner, P. J. (2012). Proteomic plasma membrane profiling reveals an essential role for gp96 in the cell surface expression of LDLR family members, including the LDL receptor and LRP6. J Proteome Res 11, 1475-1484. [0264] Wenner Moyer, M. The search beyond statins. Nat. Med. 16, 150-153. [0265] Wu, S., Hong, F., Gewirth, D., Guo, B., Liu, B., and Li, Z. (2012). The molecular chaperone gp96/GRP94 interacts with Toll-like receptors and integrins via its C-terminal hydrophobic domain. J. Biol. Chem. 287, 6735-6742. [0266] Yamamoto, T., Lu, C., and Ryan, R. O. (2011). A two-step binding model of PCSK9 interaction with the low density lipoprotein receptor. J. Biol. Chem. 286, 5464-5470. [0267] Yusuf, S., Hawken, S., Ounpuu, S., Dans, T., Avezum, A., Lanas, F., McQueen, M., Budaj, A., Pais, P., Varigos, J., et al. (2004). Effect of potentially modifiable risk factors associated with myocardial infarction in 52 countries (the INTERHEART study): case-control study. Lancet 364, 937-952. [0268] Zaid, A., Roubtsova, A., Essalmani, R., Marcinkiewicz, J., Chamberland, A., Hamelin, J., Tremblay, M., Jacques, H., Jin, W., Davignon, J., et al. (2008). Proprotein convertase subtilisin/kexin type 9 (PCSK9): hepatocyte-specific low-density lipoprotein receptor degradation and critical role in mouse liver regeneration. Hepatology 48, 646-654. [0269] Zhang, D. W., Garuti, R., Tang, W. J., Cohen, J. C., and Hobbs, H. H. (2008). Structural requirements for PCSK9-mediated degradation of the low-density lipoprotein receptor. Proc. Natl. Acad. Sci. U.S.A. 105, 13045-13050. [0270] Zhang, D. W., Lagace, T. A., Garuti, R., Zhao, Z., McDonald, M., Horton, J. D., Cohen, J. C., and Hobbs, H. H. (2007). Binding of proprotein convertase subtilisin/kexin type 9 to epidermal growth factor-like repeat A of low density lipoprotein receptor decreases receptor recycling and increases degradation. J. Biol. Chem. 282, 18602-18612. [0271] Zhao, Z., Tuakli-Wosornu, Y., Lagace, T. A., Kinch, L., Grishin, N. V., Horton, J. D., Cohen, J. C., and Hobbs, H. H. (2006). Molecular characterization of loss-of-function mutations in PCSK9 and identification of a compound heterozygote. Am. J. Hum. Genet. 79, 514-523.