CD8a and t cell receptor variants and methods of using same in modulating immune cell responses
10975137 · 2021-04-13
Assignee
Inventors
Cpc classification
A61K35/17
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
International classification
C07K14/705
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
A61K35/17
HUMAN NECESSITIES
Abstract
Novel costimulatory fusion proteins and DNA sequences that enhance T cell responses to weakly immunogenic and/or lowly expressed antigens and that confer T cell resistance against MDSC-mediated suppression are disclosed. The fusion proteins comprise portions of CD4, CD8α or the T cell receptor linked to a specific region of MyD88 or other signaling molecules. These fusion proteins and sequence variants thereof improve T cell activation and responsiveness. Also disclosed is the use of these molecules in host cells as a means to enhance and costimulate responses of immune cells including cytotoxic CD8.sup.+ T cells and the use of these cells to treat cancer, infectious agents and other diseases.
Claims
1. A fusion protein comprising an amino-terminal domain linked to a region of MyD88 lacking the TIR domain, wherein the amino-terminal domain is selected from the group consisting of: (a) extracellular and transmembrane regions of CD8α, (b) a transmembrane region of CD8α, (c) extracellular and transmembrane regions of CD4, and (d) a T cell receptor; and wherein the region of MyD88 lacking the TIR domain corresponds to amino acids 1-155 of human MyD88 (SEQ ID NO:24) plus or minus up to 10 amino acids from either end or from both ends.
2. The fusion protein of claim 1, wherein (a) the extracellular and transmembrane regions of CD8α correspond to amino acids 1-217 of mouse CD8α (SEQ ID NO:16) or amino acids 1-203 of human CD8α (SEQ ID NO:12) and (b) the region of MyD88 lacking the TIR domain corresponds to amino acids 1-155 of human MyD88 (SEQ ID NO:24).
3. The fusion protein of claim 1, wherein the fusion protein comprises mCD8α-hMyD88 as set forth in SEQ ID NO:17 or hCD8α-hMyD88 as set forth in SEQ ID NO:14.
4. The fusion protein of claim 1, wherein the transmembrane region of CD8α corresponds to amino acids 1-83 of SEQ ID NO:18 and the region of MyD88 lacking the TIR domain corresponds to amino acids 1-155 of human MyD88 (SEQ ID NO:24).
5. The fusion protein of claim 1, wherein the fusion protein comprises hCD8αTM-hMyD88 as set forth in SEQ ID NO:18.
6. The fusion protein of claim 1, wherein (a) the extracellular and transmembrane regions of CD4 correspond to amino acids 1-417 of mouse CD4 (amino acids 1-417 of SEQ ID NO:21) or human CD4 (amino acids 1-418 of SEQ ID NO:20) and (b) the region of MyD88 lacking the TIR domain corresponds to amino acids 1-155 of human MyD88 (SEQ ID NO:24).
7. The fusion protein of claim 1, wherein the fusion protein comprises mCD4-hMyD88 as set forth in SEQ ID NO:21 or hCD4-hMyD88 as set forth in SEQ ID NO:20.
8. The fusion protein of claim 1, wherein the TCR is the DMFS TCR having the amino acid sequence of residues 1-603 of SEQ ID NO:22 and the region of MyD88 lacking the TIR domain corresponds to amino acids 1-155 of human MyD88 (SEQ ID NO:24).
9. The fusion protein of claim 1, wherein the fusion protein comprises hTCR-hMyD88 as set forth in SEQ ID NO:22.
10. An isolated population of cells expressing at least one fusion protein of claim 1.
11. The isolated population of cells of claim 10, wherein the isolated population of cells expresses at least one fusion protein selected from the group consisting of mCD8α-hMyD88 (SEQ ID NO:17), hCD8α-hMyD88 (SEQ ID NO:14), hCD8αTM-hMyD88 (SEQ ID NO:18), mCD4-hMyD88 (SEQ ID NO:21), hCD4-hMyD88 (SEQ ID NO:20) and hTCR-hMyD88 (SEQ ID NO:22).
12. A method of treating a subject having cancer or an infectious disease, comprising administering to a subject having cancer or an infectious disease a therapeutically-effective amount of at least one population of cells as defined in claim 10.
13. A method of treating a subject having cancer or an infectious disease, comprising administering to a subject having cancer or an infectious disease a therapeutically-effective amount of at least one population of cells as defined in claim 11.
14. A method of conferring T cell resistance against myeloid derived suppressor cells (MDSC)-mediated suppression, comprising expressing at least one fusion protein of claim 1 in a T cell.
15. The method of claim 14, wherein the fusion protein is selected from the group consisting of mCD8α-hMyD88 (SEQ ID NO:17), hCD8α-hMyD88 (SEQ ID NO:14), hCD8αTM-hMyD88 (SEQ ID NO:18), mCD4-hMyD88 (SEQ ID NO:21), hCD4-hMyD88 (SEQ ID NO:20) and hTCR-hMyD88 (SEQ ID NO:22).
16. A method of enhancing immune cell recognition of an antigen, comprising expressing at least one fusion protein of claim 1 in an immune cell.
17. The method of claim 16, wherein the fusion protein is selected from the group consisting of mCD8α-hMyD88 (SEQ ID NO:17), hCD8α-hMyD88 (SEQ ID NO:14), hCD8αTM-hMyD88 (SEQ ID NO:18), mCD4-hMyD88 (SEQ ID NO:21), hCD4-hMyD88 (SEQ ID NO:20) and hTCR-hMyD88 (SEQ ID NO:22).
18. The method of claim 16, wherein the antigen is present at a low concentration in vitro or in vivo.
19. The method of claim 16, wherein the antigen is a weakly antigenic antigen.
Description
BRIEF DESCRIPTION OF DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
DETAILED DESCRIPTION OF THE INVENTION
I. Definitions
(16) Unless otherwise noted, technical terms are used according to conventional usage. Definitions of common terms in molecular biology may be found, for example, in Benjamin Lewin, Genes VII, published by Oxford University Press, 2000 (ISBN 019879276X); Kendrew et al. (eds.); The Encyclopedia of Molecular Biology, published by Blackwell Publishers, 1994 (ISBN 0632021829); and Robert A. Meyers (ed.), Molecular Biology and Biotechnology: a Comprehensive Desk Reference, published by Wiley, John & Sons, Inc., 1995 (ISBN 0471186341); and other similar technical references.
(17) As used herein, “a” or “an” may mean one or more. As used herein when used in conjunction with the word “comprising,” the words “a” or “an” may mean one or more than one. As used herein “another” may mean at least a second or more. Furthermore, unless otherwise required by context, singular terms include pluralities and plural terms include the singular.
(18) As used herein, “about” refers to a numeric value, including, for example, whole numbers, fractions, and percentages, whether or not explicitly indicated. The term “about” generally refers to a range of numerical values (e.g., +/−5-10% of the recited value) that one of ordinary skill in the art would consider equivalent to the recited value (e.g., having the same function or result). In some instances, the term “about” may include numerical values that are rounded to the nearest significant figure.
II. The Present Invention
(19) The intensity of CD8.sup.+ T cell responses to any given antigen is governed by various molecular interactions that occur between T cells and antigen presenting cells. Such interactions include the interaction between T cell receptors (TCRs) expressed by T cells and MHC molecules expressed by antigen presenting cells, as shown in
(20) Signaling generated by the TCR is modulated in large part by the interaction between the CD8 co-receptor on CD8.sup.+ T cells and the MHC protein on the antigen-presenting cells. As can been seen in
(21) Data presented herein and published reports have also demonstrated that stimulating Toll-like receptor (TLR)-MyD88 signaling directly within CD8.sup.+ and CD4.sup.+ T cells reduces the T cell receptor (TCR) activation threshold to poorly immunogenic antigens and also augments responses to sub-optimal levels of immunodominant antigen presentation. Concomitant activation of TCR and TLR signaling enhances T cell proliferation, increases cytolytic activity, and prolongs survival of effector T cells in tumor-bearing mice. Intriguingly, immune cells from elderly individuals exhibit reduced expression levels of TLRs and are generally hyporesponsive to TLR stimulation.
(22) Together with extensive studies conducted by the inventor, these observations have led to the development of the CD4, CD8 and TCR variants described herein, polypeptides involved in T cell activation that have improved T cell activation and responsiveness.
(23) In particular, it has been found that altering the amino acid sequence of the CD8α subunit and the T cell receptor to include a specified region of human MyD88 protein can have profound effects on T cell activation and responsiveness. This was accomplished by creating synthetic genes that fuse the extracellular and transmembrane regions of CD8α or the TCR to a specific a region of MyD88. CD8.sup.+ T cells were then engineered to express these genes and the CD8α-MyD88 fusion proteins were found to exhibit significantly improved responses over other CD8α vectors as measured by IFN-γ production, T cell proliferation and enhanced cytotoxicity. Thus, changes to the amino acid sequence of the CD8α subunit were found modulate the affinity of CD8 for MHC I and in turn, the nature of the CD8.sup.+ T cell response to a selected antigen. Some of these same results were found when TCR-MyD88 fusion proteins were prepared and tested. This surprising discovery serves as a basis for the novel polypeptides, cells lines, and methods reported and claimed herein.
(24) Some novel features and useful applications of the present invention include: CD8α variants of the invention can be linked together with the soluble TCR (sTCR) or membrane-bound TCR to enhance the TCR affinity to peptide MHC. CD8α variants of the invention can be expressed on T cells to enhance endogenous TCR signals to any given antigen. CD8α variants of the invention can be co-expressed along with transgenic tumor-reactive TCRs (or TCRs specific against other antigens such viral or other intracellular pathogenic antigens). In addition to augmenting T cell activity, the CD8α variants could be used to reduce PD1 and CTLA4-mediated immune suppression by overriding those negative signals (by virtue of the ability of MyD88 to enhance TCR signaling). Mutations in the CD8α or CD8β subunits that alter affinity to MHC I can serve as biomarkers to predict patient T cell responses to vaccines or responses by gene modified T cells. Because mutations can either reduce or enhance CD8 affinity, specific mutations could predict both strong and weak responses. For example, patients with K273A and S53N mutations would be expected to show stronger responses.
(25) Current strategies to enhance T cell responses include: antibody-based approaches to prevent T cells from becoming deactivated or prevent their death; T cells engineered to express high-affinity TCRs; and T cells engineered to expressed chimeric antigen receptors (CAR) that endow T cells with an ability to recognize tumor antigens expressed on the tumor cells surface.
The last two approaches are expensive, time- and labor-intensive processes. The use of high-affinity TCRs could result in the killing of non-cancerous tissues and CAR T cells can only target one antigen. Thus, there is a need for new strategies to enhance T cell responses. The approach described herein avoids the need to identify high-affinity TCRs. Moreover, the CD8α variants of the invention offer the possibility of enhancing the response of T cells carrying low-affinity TCRs, by exploiting the ability of CD8α to amplify TCR signals. Although CAR T cells can only target one antigen, the CD8α variants of the invention could be used as a single platform to enhance the TCR or CAR response against any antigen. Vaccine based approaches, such as with dendritic cells, modified tumor cells, tumor lysates, peptide or protein-based vaccines, bacterial or viral vaccines modified to express tumor antigens and other forms of vaccines intended to elicit T cell response. Tumor infiltrating lymphocytes for immunotherapy
The last two approaches could all benefit from enhancing T cell responses with MyD88 with the invention described herein.
(26) Thus, provided herein are CD8α variants, including but not limited to CD8α-MyD88 fusion proteins and sequence variants thereof, that when introduced into T cells, can serve as TCR co-receptors that augment T cell responses to antigen stimulation. Also provided herein are TCR variants, including but not limited to TCR-MyD88 fusion proteins and sequence variants thereof. These TCR variants can be introduced into T cells to augment T cell responses to weakly immunogenic antigens and/or to further potentiate T cell responses to antigen stimulation.
(27) The present invention is also directed to cells lines expressing the variants and to methods for using the variants and cell lines in vitro and in vivo.
(28) Fusion Proteins
(29) In initial studies it was found that fusing CD8α to the full-length MyD88 protein (or overexpressing MyD88 without CD8α) led to the death of T cells. Without wishing to be bound by theory, it is speculated that this killing occurred in response to chronic and enhanced MyD88 signaling. Because the MyD88 protein contains a region called the TIR domain (Toll/IL-1 receptor domain), which interacts with toll-like receptors (TLR) and IL-1 receptors (IL-1R), it was speculated that removing the TIR domain from MyD88 could prevent clustering to TLRs and IL-1Rs, and thus result in MyD88 activation only upon TCR signaling (or encounter with MHC antigen).
(30) It was further considered that due to the fact that physical interactions between CD8 and MHC I occur through the extracellular domains of CD8, the intracellular portion of the molecule may be less important could potentially be replaced by MyD88 lacking the TIR domain.
(31) As reported below, fusion proteins comprising the extracellular and transmembrane regions of CD8α linked to MyD88 lacking the TIR domain demonstrated excellent properties with respect to increasing T cell proliferation, T cell cytokine and chemokine production, and T cell cytotoxic activity in T cells in which they were expressed. The present invention is directed, in part, to these molecules.
(32) CD8α-MyD88
(33) The present invention thus includes murine and human CD8α variants. In a first aspect the CD8α variants include CD8α-MyD88 fusion proteins comprising extracellular and transmembrane regions of CD8α linked to a region of MyD88 lacking the TIR domain. In a preferred embodiment, these regions are linked as: N-extracellular region of CD8α-transmembrane region of CD8α-MyD88 lacking the TIR domain-C. The CD8α portion of these fusion proteins may be from any mammalian CD8α, including mouse and human. The MyD88 portion of these fusion proteins may also be from any mammalian source, including mouse and human. The extracellular and transmembrane regions of mouse CD8α generally correspond to amino acids 1-217 of mouse CD8α (SEQ ID NO:16; mCD8αΔIC). The extracellular and transmembrane regions of human CD8α generally correspond to amino acids 1-203 of human CD8α (SEQ ID NO:12; hCD8αΔIC). The region of human MyD88 lacking the TIR domain generally corresponds to amino acids 1-155 of human MyD88 (SEQ ID NO:24). Non-limiting examples of these CD8α variants include mCD8α-hMyD88 (SEQ ID NO:17) and hCD8α-hMyD88 (SEQ ID NO:14).
(34) The invention also includes CD8α variants comprising native, full-length CD8α linked to a region of MyD88 lacking the TIR domain. In a preferred embodiment, these regions are linked as: N-CD8α-MyD88 lacking the TIR domain-C. The CD8α portion of these fusion proteins may be any mammalian CD8α, including mouse (SEQ ID NO:15) and human (SEQ ID NO:12). The MyD88 portion of these fusion proteins may also be from any mammalian source, including mouse and human. The region of human MyD88 lacking the TIR domain generally corresponds to amino acids 1-155 of human MyD88 (SEQ ID NO:24).
(35) Each of these CD8α variants may also include more than one of the MyD88 regions lacking the TIR domain linked in tandem, and these MyD88 regions can appear on the N-terminus, the C-terminus, or both the N- and C-termini of the CD8α portion of the fusion proteins.
(36) CD8αTM-MyD88
(37) In a second aspect, the CD8α variants include CD8α-MyD88 fusion proteins comprising only the transmembrane region of CD8α linked to a region of MyD88 lacking the TIR domain. In a preferred embodiment, these regions are linked as: N-transmembrane region of CD8α-MyD88 lacking the TIR domain-C. The CD8α portion of these fusion proteins may be from any mammalian CD8α, including mouse and human. The MyD88 portion of these fusion proteins may also be from any mammalian source, including mouse and human. The transmembrane region of human CD8α generally corresponds to amino acids 128-210 of human CD8α (amino acids 1-83 of SEQ ID NO:18). The region of human MyD88 lacking the TIR domain generally correspond to amino acids 1-155 of human MyD88 (SEQ ID NO:24). A non-limiting example of this CD8α variant includes hCD8αTM-hMyD88 (SEQ ID NO:18).
(38) Each of these CD8α variants may also include more than one of the MyD88 regions lacking the TIR domain linked in tandem, and these MyD88 regions can appear on the N-terminus, the C-terminus, or both the N- and C-termini of the CD8α portion of the fusion proteins.
(39) CD8α-28-137-3
(40) In a third aspect, the CD8α variants include CD8α fusion proteins comprising the extracellular and transmembrane regions of CD8α linked to the intracellular signaling domains of a traditional 3.sup.rd generation CAR: human CD28, CD137 (4-1BB), CD3ξ. In a preferred embodiment, these elements are linked as: N-extracellular region of CD8α-transmembrane region of CD8α-CD28-CD137-CD3ξ-C. The CD8α portion of these fusion proteins may be from any mammalian CD8α, including mouse and human. The CD28, CD137 (4-1BB), and CD3ξ intracellular signaling domains may also be from any mammalian source, including mouse and human. The extracellular and transmembrane regions of mouse CD8α generally correspond to amino acids 1-217 of mouse CD8α (SEQ ID NO:16; mCD8αΔIC). The extracellular and transmembrane regions of human CD8α generally correspond to amino acids 1-203 of human CD8α (SEQ ID NO:12; hCD8αΔIC). Human CD28, CD137 (4-1BB), and CD3ξ generally correspond to amino acids 218-417 of SEQ ID NO:19, where CD28 generally corresponds to amino acids 218-256; CD137 (4-1BB) generally corresponds to amino acids 259-305; CD3ξ generally corresponds to amino acids 308-417. A non-limiting example of this CD8α variant includes mCD8α-28-137-3 (SEQ ID NO:19), also referred to herein in some instances as mCD8α-137-28-3.
(41) Each of these CD8α variants may also include more than one of the CD28, CD137 (4-1BB), and CD3ξ intracellular signaling domains linked in tandem, and these intracellular signaling domains can appear on the N-terminus, the C-terminus, or both the N- and C-termini of the CD8α portion of the fusion proteins.
(42) CD4-MyD88
(43) The present invention also includes murine and human CD4 variants. The CD4 variants include CD4-MyD88 fusion proteins comprising extracellular and transmembrane regions of CD4 linked to a region of MyD88 lacking the TIR domain. In a preferred embodiment, these regions are linked as: N-extracellular region of CD4-transmembrane region of CD4-MyD88 lacking the TIR domain-C. The CD4 portion of these fusion proteins may be from any mammalian CD4, including mouse and human. The MyD88 portion of these fusion proteins may also be from any mammalian source, including mouse and human. The extracellular and transmembrane regions of mouse CD4 generally correspond to amino acids 1-417 of mouse CD4 (amino acids 1-417 of SEQ ID NO:21). The extracellular and transmembrane regions of human CD4 generally correspond to amino acids 1-418 of human CD4 (amino acids 1-418 of SEQ ID NO:20). The region of human MyD88 lacking the TIR domain generally corresponds to amino acids 1-155 of human MyD88 (SEQ ID NO:24). Non-limiting examples of these CD4 variants include mCD4-hMyD88 (SEQ ID NO:21) and hCD4-hMyD88 (SEQ ID NO:20).
(44) The invention also includes CD4 variants comprising native, full-length CD4 linked to a region of MyD88 lacking the TIR domain. In a preferred embodiment, these regions are linked as: N-CD4-MyD88 lacking the TIR domain-C. The CD4 portion of these fusion proteins may be any mammalian CD4, including mouse and human. The MyD88 portion of these fusion proteins may also be from any mammalian source, including mouse and human. The region of human MyD88 lacking the TIR domain generally corresponds to amino acids 1-155 of human MyD88 (SEQ ID NO:24).
(45) Each of these CD4 variants may also include more than one of the MyD88 regions lacking the TIR domain linked in tandem, and these MyD88 regions can appear on the N-terminus, the C-terminus, or both the N- and C-termini of the CD4 portion of the fusion proteins.
(46) TCR-MyD88
(47) The present invention also includes murine and human TCR variants. The TCR variants include TCR-MyD88 fusion proteins comprising TCRs linked to a region of MyD88 lacking the TIR domain. In a preferred embodiment, these elements are linked as: N-TCR-MyD88 lacking the TIR domain-C. The TCR portion of these fusion proteins may be from any mammalian TCR, including mouse and human. The MyD88 portion of these fusion proteins may also be from any mammalian source, including mouse and human. In one example, the TCR is the DMF5 TCR. It comprises amino acids 1-603 of SEQ ID NO:22. The region of human MyD88 lacking the TIR domain generally corresponds to amino acids 1-155 of human MyD88 (SEQ ID NO:24). Non-limiting examples of these TCR variants include hTCR-hMyD88 (SEQ ID NO:22).
(48) Linkers and Spacers
(49) As indicated herein, the variants of the invention include fusion proteins comprised of peptide domains and regions from molecules such as CD8α, CD4, MyD88, TCR CD28, CD137 (4-1BB), and CD3ξ. When these domains and regions are linked in the context of a fusion protein, a short linker or spacer may be desirable to enhance formation of a proper three-dimensional structure or shape. The variants of the invention may thus have short peptide linkers or spacers of up to 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 or more amino acids positioned between the functional peptide domains and regions of the fusions proteins.
(50) Sequence Variants
(51) Variations in Length
(52) It will be apparent that the different peptide domains and regions that comprise the variants of the invention can have some amino acid variability without adversely affecting the activity of the variant. For example, the peptide domains and regions can vary somewhat in their length. Thus, while the mouse CD8α-hMyD88 fusion protein is said to comprise amino acids 1-217 of mouse CD8α (SEQ ID NO:15), the length of this portion of the fusion protein may be extended or reduced by a number of amino acids, e.g., to be amino acids 1-210 of SEQ ID NO:15, or amino acids 1-210 of SEQ ID NO:15, or amino acids 10-215 of SEQ ID NO:15, or amino acids 8-222 of SEQ ID NO:15, as only a few examples.
(53) Thus the invention includes sequence variants wherein, for each of the fusion proteins of the invention, the length of the peptide domains and regions used in the fusion proteins can individually be increased or decreased on the amino terminus, carboxy terminus, or both ends, by up to 60, 55, 50, 45, 40, 35, 30, 25, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1 or 0 amino acids based on the native sequence of the polypeptide from which the domain or region is obtained. These sequence variants, in which the peptide domains and regions differ in length from a specific variant defined herein, will have at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more of the activity of the specific variant upon which they are based. The cytoplasmic domains will generally have 20-1000 amino acids depending on the number of domains and the specific domains to be used. The transmembrane domain will generally have 20-60 amino acids. The extracellular domain will generally have 50-5000 amino acids depending on the number of domains and the specific domains to be used.
(54) Variations in Sequence
(55) It will also be apparent that the variants of the invention can have variability in their amino acid composition without adversely affecting the activity of the variant. For example, the variants can have amino acid additions (conservative and/or non-conservative), deletions and/or substitutions, and any combination thereof. Thus the invention also includes sequence variants having at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 85%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity with a specific variant defined herein, over the entire length of that specific variant. These sequence variants will have at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more of the activity of the specific variant upon which they are based.
(56) As shown in Example 1 below, variations in the amino acid composition of the variants described herein can be expected to alter or change various attributes and characteristics of immune cells expressing the variants, including their responses when contacting antigen-presenting cells. For example, a K73A mutation in mouse CD8α resulted in a CD8α molecule with higher affinity than the native version of the protein. T cells expressing such “high affinity” CD8α (i.e., CD8α bearing the K73A mutation) showed a higher level of activation that T cells expressing other CD8α variants.
(57) Polynucleotide Sequences
(58) The invention also encompasses the polynucleotide sequences encoding each of the fusion proteins and sequence variants of the invention. Specific polynucleotide sequences encompassed within the scope of the invention include the polynucleotide sequences set forth in SEQ ID NO:6 (mCD8α-hMyD88), SEQ ID NO:3 (hCD8α-hMyD88), SEQ ID NO:7 (hCD8αTM-hMyD88), SEQ ID NO:8 (mCD8α-28-137-3), SEQ ID NO:10 (mCD4-hMyD88), SEQ ID NO:9 (hCD4-hMyD88) and SEQ ID NO:11 (hTCR-hMyD88). The skilled artisan will understand that due to the redundancy of the genetic code, there are a large number of different polynucleotide sequences that encode a single polypeptide. The invention includes each polynucleotide sequence encoding a fusion protein or sequence variant of the invention. Thus the invention includes polynucleotide sequences encoding mCD8α-hMyD88 (SEQ ID NO:17), hCD8α-hMyD88 (SEQ ID NO:14), hCD8αTM-hMyD88 (SEQ ID NO:18), mCD8α-28-137-3 (SEQ ID NO:19), mCD4-hMyD88 (SEQ ID NO:21), hCD4-hMyD88 (SEQ ID NO:20) and hTCR-hMyD88 (SEQ ID NO:22), and each of the sequence variants thereof encompassed within the scope of the invention.
(59) Cells
(60) The present invention also encompasses cells engineered to produce the variants (i.e., the fusion proteins and sequence variants) of the invention. The identity of such cells is only limited by the ability of the cell to produce the variant. In preferred aspects, the cell can both produce the variant and express it on the surface of the cell. The cells include mammalian cells, such as human or mouse cells, insect cells, and prokaryotic cells, such as bacterial cells.
(61) The variants include fusion proteins mCD8α-hMyD88 (SEQ ID NO:17), hCD8α-hMyD88 (SEQ ID NO:14), hCD8αTM-hMyD88 (SEQ ID NO:18), mCD8α-28-137-3 (SEQ ID NO:19), mCD4-hMyD88 (SEQ ID NO:21), hCD4-hMyD88 (SEQ ID NO:20) and hTCR-hMyD88 (SEQ ID NO:22), and sequence variants thereof. In another aspect, the variants are encoded by a polynucleotide sequence selected from the polynucleotide sequences set forth in SEQ ID NO:6 (mCD8α-hMyD88), SEQ ID NO:3 (hCD8α-hMyD88), SEQ ID NO:7 (hCD8αTM-hMyD88), SEQ ID NO:8 (mCD8α-28-137-3), SEQ ID NO:10 (mCD4-hMyD88), SEQ ID NO:9 (hCD4-hMyD88) and SEQ ID NO:11 (hTCR-hMyD88), and sequence variants thereof.
(62) In a particular aspect of the invention, these variant-expressing cells may be used in the methods of medical treatment, as discussed herein. Variant-expressing cells used in such methods may be derived from cells autologous, syngeneic or allogeneic to the individual being treated, with the selection dependent on the disease to be treated and the means available to do so. Suitable populations of cells that may be used in the methods include any immune cells with cytolytic activity, such as T cells. Exemplary sub-populations of T cells include, but are not limited to those expressing CD4 such as CD4.sup.+ T cells, those expressing CD8 such as CD8.sup.+ T cells, natural killer T cells (NKT cells), natural killer cells (NK), neutrophils, macrophages, dendritic cells, mast cells, basophils, B cells and other peripheral blood mononuclear cells (PBMC) or other primary or established cell lines including the so-called universal donor cells. The cells may also be isolated from any source, including the blood, lymph node or spleen of a subject, or from a tumor explant of a subject or intratumoral T cells of a subject.
(63) Cells may be engineered to express one or more than one of the variants of the invention. Thus, the invention encompasses populations of cells expressing at least one, two, three or more of the variants of the invention, as well as populations of cells expressing one or more of the variants of the invention.
(64) Cells may be engineered to express the variants of the invention by means readily known to the skilled artisan. Generally, a polynucleotide vector is constructed that encodes the fusion protein or sequence variant and the vector is transfected into a population of cells, such as T cells. The cells are then grown under conditions promoting expression of the fusion protein or sequence variant by the cells. Successful transfection (or transduction which refers to viral-mediated gene integration) and cell-surface display of polypeptides is conducted via conventional means, some of which are disclosed in the Examples herein.
(65) In one aspect, T cells may be engineered to produce the variants by first constructing a retroviral vector encoding a selected fusion protein or sequence variant. An exemplary retroviral vector includes, but is not limited to, the vector backbone pMSGV1-CD8-28BBZ, which is derived from pMSGV (murine stem cell virus-based splice-gag vector). However, other means of gene integration or protein expression, such as nucleofection or transient expression of DNA, RNA or proteins, are also suitable. DNA sequencing can be used to confirm proper construction of the vector before transfection of T cells. Retroviral transduction may be performed using known techniques, such as that of Johnson et al. (Blood 114, 535-546 (2009)). The surface expression of fusion proteins and sequence variants on transduced T cells may be determined, for example, by flow cytometry after staining cells with labeled antibodies.
(66) Immune cells expressing the variants of the present invention have improved attributes in comparison to native immune cells that do not express the variants. For example, expression of the variants in T cells confers T cell resistance to MDSC-mediated suppression. Further, expressing the variants in certain immune cells enhances the ability of those cells to recognize low concentrations of antigens and/or recognize weakly immunogenic antigens. Therefore, the present invention includes methods of conferring resistance in T cells to MDSC-mediated suppression, comprising expressing at least one variant of the present invention in a T cell or population of T cells.
(67) The present invention also includes methods of enhancing the ability of an immune cell to recognize low concentrations of a selected antigen comprising expressing at least one variant of the present invention in an immune cell or population of immune cells. The present invention further includes methods of enhancing the ability of an immune cell to recognize a weakly immunogenic antigen comprising expressing at least one variant of the present invention in an immune cell or population of immune cells. The immune cells include, but are not limited to, T cells (e.g., CD4.sup.+ and CD8.sup.+ T cells), natural killer T cells (NKT cells), natural killer cells (NK), neutrophils, macrophages, dendritic cells, mast cells, basophils, B cells and other peripheral blood mononuclear cells (PBMC) or other primary or established cell lines including the so-called universal donor cells.
(68) Cell Administration
(69) Populations of variant-expressing cells may be formulated for administered to a subject using techniques known to the skilled artisan. Formulations comprising variant-expressing cells may include pharmaceutically acceptable excipient(s). Excipients included in the formulations will have different purposes depending, for example, on the nature of the variant being expressed (e.g., CD8α-MyD88 or TCR-MyD88), the subpopulation of T cells used, and the mode of administration. Examples of generally used excipients include, without limitation: saline, buffered saline, dextrose, water-for-infection, glycerol, ethanol, and combinations thereof, stabilizing agents, solubilizing agents and surfactants, buffers and preservatives, tonicity agents, bulking agents, and lubricating agents. The formulations comprising populations of variant-expressing T cells will typically have been prepared and cultured in the absence of any non-human components, such as animal serum (e.g., bovine serum albumin).
(70) A formulation may include one population of variant-expressing cells, or more than one, such as two, three, four, five, six or more different populations of variant-expressing cells. The different populations of variant-expressing cells can vary based on the identity of the variant, the identity of the subpopulation of T cells, or a combination thereof.
(71) The formulations comprising population(s) of variant-expressing cells may be administered to a subject using modes and techniques known to the skilled artisan. Exemplary modes include, but are not limited to, intravenous injection. Other modes include, without limitation, intratumoral, intradermal, subcutaneous (s.c., s.q., sub-Q, Hypo), intramuscular (i.m.), intraperitoneal (i.p.), intra-arterial, intramedulary, intracardiac, intra-articular (joint), intrasynovial (joint fluid area), intracranial, intraspinal, and intrathecal (spinal fluids). Any known device useful for parenteral injection or infusion of the formulations can be used to effect such administration.
(72) The formulations comprising population(s) of variant-expressing cells that are administered to a subject comprise a number of variant-expressing cells that is effective for the treatment of the specific indication or disease. Thus, therapeutically-effective amounts of formulations comprising population(s) of variant-expressing cells are administered to subjects when the methods of the present invention are practiced. In general, formulations are administered that comprise between about 1×10.sup.3 and about 1×10.sup.10 variant-expressing cells. In most cases, the formulation will comprise between about 1×10.sup.3 and about 1×10.sup.8 variant-expressing cells, from about 5×10.sup.5 to about 5×10.sup.8 variant-expressing cells, or from about 1×10.sup.6 to about 1×10.sup.7 variant-expressing cells. However, the number of variant-expressing cells administered to a subject will vary between wide limits, depending upon the location, source, identity, extent and severity of the disease, the age and condition of the individual to be treated, etc. A physician will ultimately determine appropriate dosages to be used.
(73) Methods
(74) Treatment and Prevention of Cancer
(75) CD8.sup.+ T cells recognize peptides presented on MHC I molecules. Because all nucleated cells including cancer cells express MHC I, virtually any type of cancer can be detected and destroyed by cytotoxic T cells. In some cases, tumor cells can reduce MHC I expression and evade T cell recognition. However, expressing CD8α-MyD88 in T cells offers the advantage of enhancing T cell responses even in the face of low antigen levels or weakly immunogenic antigens.
(76) CD4.sup.+ T cells on the other hand recognize peptides presented in the context of an MHC II molecule. Like CD8, CD4 serves as a TCR co-receptor. It is therefore possible that expressing either CD8α-MyD88 or CD4-MyD88 (in either CD8.sup.+ T cells or CD4.sup.+ T cells, respectively) will augment their responses. Examples of CD4-MyD88 variants are provided herein. It is also possible that since CD8 localizes to the immunological synapse, the area where the TCRs and TCR signaling molecules localize to interact with the MHC on target cells, MyD88 brought to the immunological synapse by any means could also enhance TCR signals. For example, fusing the transmembrane domain of CD8 (or CD4 or any other TCR-signaling related molecule) to the MyD88 can be used to augment T cell responses through localization of MyD88.
(77) The present invention thus encompasses methods of treating a subject having cancer, comprising administering to a subject having cancer a therapeutically-effective amount of a population of cells expressing at least one variant of the present invention. The invention also encompasses methods of treating a subject having cancer, comprising administering to a subject having cancer a therapeutically-effective amount of a formulation comprising at least one population of cells expressing at least one variant of the invention and an excipient.
(78) The present invention also encompasses methods of preventing cancer in a subject, comprising administering to a subject at risk of developing cancer a therapeutically-effective amount of a population of cells expressing at least one variant of the present invention. The invention further encompasses methods of preventing cancer in a subject, comprising administering to a subject at risk of developing cancer a therapeutically-effective amount of a formulation comprising at least one population of cells expressing at least one variant of the invention and an excipient.
(79) The term “cancer” is intended to be broadly interpreted and it encompasses all aspects of abnormal cell growth and/or cell division. Examples include: carcinoma, including but not limited to adenocarcinoma, squamous cell carcinoma, adenosquamous carcinoma, anaplastic carcinoma, large cell carcinoma, small cell carcinoma, and cancer of the skin, breast, prostate, bladder, vagina, cervix, uterus, liver, kidney, pancreas, spleen, lung, trachea, bronchi, colon, small intestine, stomach, esophagus, gall bladder; sarcoma, including but not limited to chondrosarcoma, Ewing's sarcoma, malignant hemangioendothelioma, malignant schwannoma, osteosarcoma, soft tissue sarcoma, and cancers of bone, cartilage, fat, muscle, vascular, and hematopoietic tissues; lymphoma and leukemia, including but not limited to mature B cell neoplasms, such as chronic lymphocytic leukemia/small lymphocytic lymphoma, B-cell prolymphocytic leukemia, lymphomas, and plasma cell neoplasms, mature T cell and natural killer (NK) cell neoplasms, such as T cell prolymphocytic leukemia, T cell large granular lymphocytic leukemia, aggressive NK cell leukemia, and adult T cell leukemia/lymphoma, Hodgkin lymphomas, and immunodeficiency-associated lymphoproliferative disorders; germ cell tumors, including but not limited to testicular and ovarian cancer; blastoma, including but not limited to hepatoblastoma, medulloblastoma, nephroblastoma, neuroblastoma, pancreatoblastoma, leuropulmonary blastoma and retinoblastoma. The term also encompasses benign tumors.
(80) Treatment and Prevention of Infectious Disease
(81) Infectious agents such as viruses and certain bacteria and fungi become internalized by the host cell or by immune cells called professional antigen-presenting cells. The cells process parts of the infectious agents and present them on the cell surface in the context of MHC I, which can then be recognized by T cells. Expressing CD8α-MyD88 in T cells offers the advantage of enhancing T cell responses to any antigen presented on MHC molecules regardless of the source of the antigen. This strategy can be used to augment the immune responses of immunosuppressed individuals, including but not limited to: elderly individuals, patients infected with human immunodeficiency virus (HIV), patients who have been treated with therapies that suppress T cell responses (i.e. steroid therapies, cancer chemotherapies, radiation therapies).
(82) The present invention thus encompasses methods of treating a subject having an infectious disease, comprising administering to a subject having an infectious disease a therapeutically-effective amount of a population of cells expressing at least one variant of the present invention. The invention also encompasses methods of treating a subject having an infectious disease comprising administering to a subject having an infectious disease a therapeutically-effective amount of a formulation comprising at least one population of cells expressing at least one variant of the invention and an excipient.
(83) In addition, the present invention encompasses methods of preventing an infectious disease in a subject, comprising administering to a subject at risk of developing an infectious disease a therapeutically-effective amount of a population of cells expressing at least one variant of the present invention. The invention further encompasses methods of preventing an infectious disease in a subject comprising administering to a subject at risk of developing an infectious disease a therapeutically-effective amount of a formulation comprising at least one population of cells expressing at least one variant of the invention and an excipient.
(84) The identity of the infectious disease is limited only in that antigen-presenting cells have the ability to present antigens derived from the causative agent of the infectious disease on the cell surface in the context of MHC I. Infectious diseases caused by viruses, bacteria and fungi are encompassed within the scope of the invention.
(85) Treatment and Prevention of Autoimmune Disease
(86) The present invention encompasses methods of treating a subject having an autoimmune disorder by targeting for destruction autoreactive cells. Thus included in the invention are methods of treating a subject having an autoimmune disorder, comprising administering to a subject having an autoimmune disorder a therapeutically-effective amount of a population of cells expressing at least one variant of the present invention. The invention also encompasses methods of treating a subject having an autoimmune disorder, comprising administering to a subject having an autoimmune disorder a therapeutically-effective amount of a formulation comprising at least one population of cells expressing at least one variant of the invention and an excipient.
(87) The present invention also encompasses methods for preventing an autoimmune disorder by targeting for destruction autoreactive cells. Thus included in the invention are methods of preventing an autoimmune disorder in a subject, comprising administering to a subject at risk for developing an autoimmune disorder a therapeutically-effective amount of a population of cells expressing at least one variant of the present invention. The invention also encompasses methods of preventing an autoimmune disorder in a subject, comprising administering to a subject at risk of developing an autoimmune disorder a therapeutically-effective amount of a formulation comprising at least one population of cells expressing at least one variant of the invention and an excipient.
(88) The identity of the autoimmune disorder is not limited. However, non-limiting examples include lupus, arthritis, Type I diabetes, multiple sclerosis, Alopecia areata, Celiac disease.
(89) Enhancing Antigen Recognition
(90) The present invention encompasses methods of altering the activity of immune cells, such as T cells, through the engineering of the immune cells to express one or more of the variants of the present invention. For example, expression of the variants in immune cells can provide improvements in the ability of the immune cell to recognize an antigen (e.g., antigens present at a low concentration in a subject or weakly antigenic antigens), including recognition of an antigen in the context of MHC I presentation; activate an effector cell; be activated by an effector cell; remain associated with an antigen-presenting cell; avoid suppression by effector cells, among other examples.
(91) Thus included in the invention are methods of conferring T cell resistance against MDSC-mediated suppression. These methods comprise expressing at least one variant of the present invention in a T cells. In specific aspects, the variants are selected from the group consisting of mCD8α-hMyD88 (SEQ ID NO:17), hCD8α-hMyD88 (SEQ ID NO:14), hCD8αTM-hMyD88 (SEQ ID NO:18), mCD8α-28-137-3 (SEQ ID NO:19), mCD4-hMyD88 (SEQ ID NO:21), hCD4-hMyD88 (SEQ ID NO:20) and hTCR-hMyD88 (SEQ ID NO:22), and sequence variants thereof.
(92) In a related aspect, the invention includes methods of enhancing immune cell recognition of an antigen. These methods comprise expressing at least one variant of the present invention in an immune cell. In specific aspects, the variants are selected from the group consisting of mCD8α-hMyD88 (SEQ ID NO:17), hCD8α-hMyD88 (SEQ ID NO:14), hCD8αTM-hMyD88 (SEQ ID NO:18), mCD8α-28-137-3 (SEQ ID NO:19), mCD4-hMyD88 (SEQ ID NO:21), hCD4-hMyD88 (SEQ ID NO:20) and hTCR-hMyD88 (SEQ ID NO:22), and sequence variants thereof. In certain aspects of this embodiment, the antigen is present at a low concentration in vitro or in vivo, or the antigen is a weakly antigenic antigen, or both.
(93) The immune cells include, but are not limited to, CD4.sup.+ T cells, CD8.sup.+ T cells, natural killer T cells (NKT cells), natural killer cells (NK), neutrophils, macrophages, dendritic cells, mast cells, basophils, B cells and other peripheral blood mononuclear cells (PBMC), tumor infiltrating lymphocytes or other primary or established cell lines including the so-called universal donor cells.
(94) As used herein, the terms “treat”, “treating”, and “treatment” have their ordinary and customary meanings, and include one or more of: blocking, ameliorating, or decreasing in severity and/or frequency a symptom of cancer or an infection in a subject, and/or inhibiting the growth, division, spread, or proliferation of cancer cells, bacterial cells or a virus, or progression of cancer (e.g., emergence of new tumors), a bacterial infection or a viral infection in a subject. Treatment means blocking, ameliorating, decreasing, or inhibiting by about 1% to about 100% versus a subject in which the methods of the present invention have not been practiced. Preferably, the blocking, ameliorating, decreasing, or inhibiting is about 100%, 99%, 98%, 97%, 96%, 95%, 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, 10%, 5% or 1% versus a subject in which the methods of the present invention have not been practiced.
(95) As used herein, the terms “prevent”, “preventing” and “prevention” have their ordinary and customary meanings, and include one or more of, stopping, averting, avoiding, alleviating or blocking development of cancer or an infection in a subject, and/or stopping, averting, avoiding, alleviating or blocking the growth, division, spread, or proliferation of cancer cells, bacterial cells or a virus, or progression of cancer (e.g., emergence of new tumors), a bacterial infection or a viral infection in a subject. Prevention means stopping by at least about 95% versus a subject to which the prevention has not been administered. Preferably, the stopping is about 100%, about 99%, about 98%, about 97%, about 96% or about 95%. The results of the prevention may be permanent or may continue for a period of days (such as 1, 2, 3, 4, 5, 6 or 7 days), weeks (such as 1, 2, 3 or 4 weeks) or months (such as 1, 2, 3, 4, 5, 6 or more months).
(96) Administration frequencies of the formulations comprising populations of variant-expressing cells will vary depending on factors that include the disease or condition being treated, the identity of the variant of the variant-expressing cells, and the mode of administration. Each formulation may be independently administered 4, 3, 2 or once daily, every other day, every third day, every fourth day, every fifth day, every sixth day, once weekly, every eight days, every nine days, every ten days, bi-weekly, monthly and bi-monthly.
(97) The duration of treatment will be based on the disease or condition being treated and will be best determined by the attending physician. However, continuation of treatment is contemplated to last for a number of days, weeks, or months.
(98) The invention also provides a kit comprising one or more containers filled with one or more populations of variant-expressing cells. The kit may also include instructions for use. Associated with the kit may further be a notice in the form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals or biological products, which notice reflects approval by the agency of manufacture, use or sale for human administration.
III. Examples
Example 1
(99) To explore the possibility that altering CD8α affinity to the MEW could increase T cell responses, three mouse CD8α variants were prepared. The first variant was a mouse CD8α construct having a K73A mutation (“high affinity CD8α”; SEQ ID NO:23). The second variant was a mouse CD8α construct comprising the extracellular and transmembrane portion of mouse CD8α linked to the 4-1BB-CD28-CD3 intracellular activation domain (mCD8α-28-137-3; SEQ ID NO:19). The third variant was a mouse CD8α construct in which the intracellular domain was deleted (mCD8αΔIC; SEQ ID NO:16). Melanoma-specific CD8.sup.+ T cells were engineered via retroviral transduction to express one of these three CD8α variants or a GFP vector control. Approximately 50-60% of CD8.sup.+ T cells expressed the vector as indicated by GFP expression (data not shown). IFN-γ production (a measure of T cell activation) was examined after co-culturing T cells with melanoma tumor cells for 24 hours. Upon stimulation, T cells expressing high affinity CD8α (i.e., CD8α bearing the K73A mutation) showed a higher level of activation that T cells expressing the other CD8α variants (
(100) TABLE-US-00001 mCD8α (SEQ ID NO: 23): MASPLTRFLSLNLLLLGESIILGSGEAKPQAPELRIFPKKMDAELGQKVD LVCEVLGSVSQGCSWLFQNSSSALPQPTFVVYMASSHNKITWDEKLNSSK LFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVN STTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIYIWAP LAGICVALLLSLIITLICYHRSRKRVCKCPRPLVRQEGKPRPSEKIV
Example 2
(101) Materials and Methods
(102) Mice and Cell Lines.
(103) C57BL6 mice were purchased from the Jackson Laboratory (Bar Harbor, Me., USA), housed in the University of Maryland, Baltimore, specific pathogen-free animal facility and used as recipients for adoptive immunotherapy. Experiments were reviewed and approved by the University of Maryland, Baltimore, Institutional Animal Care and Use Committee.
(104) The mouse melanoma B16 cell line (ATCC, Manassas, Va.) was maintained in Dulbecco's modified Eagle's medium (DMEM) (GIBCO brand; Invitrogen, Carlsbad, Calif., USA) supplemented with 10% heat inactivated fetal bovine serum (Gemini Bio-Products, West Sacramento, Calif., USA), 2 mM L-glutamine (GIBCO brand; Invitrogen) and 1% penicillin-streptomycin (GIBCO brand; Invitrogen). The Phoenix Ecotropic or Amphtropic packaging cell lines were purchased from Orbigen (San Diego, Calif., USA) and maintained in D10 medium containing DMEM, 10% FBS, 1% sodium pyruvate, 2 mM L-glutamine and 1% penicillin-streptomycin.
(105) Construction of CD8 and TCR Variants.
(106)
(107) T cell receptor (TCR) variants were also produced that comprise of DMF5, a human TCR specific for the MART-1.sub.26-35 peptide from the MART-1 melanoma antigen presented by MHC I, fused to human MyD88 lacking the TIR domain.
(108) Construction of Retroviral Vectors.
(109) The retroviral vector backbone pMSGV1-CD8-28BBZ (Hughes M. S. et al., Transfer of a T-cell receptor (TCR) gene derived from a patient with a marked antitumor response conveys highly active T-cell effector functions. Hum Gene Ther 2005 April; 16(4):457-72) was a kind gift from Dr. Richard Morgan (National Cancer Institute) and is derived from pMSGV (murine stem cell virus-based splice-gag vector).
(110) Mouse CD8α (Genbank NM_001081110.2), human CD8α (Genbank NM_001768.6)
(111) and human MyD88 (Genbank NM_001172567.1) were used in the production of retroviral vectors encoding the CD8α variants. The MyD88 nucleotide sequences used refer to a region lacking the Toll/IL-1 receptor (TIR) domain (NM_001172567.1, nucleotides #224-688). The extracellular and transmembrane region of human CD8α (NM_001768.6, nucleotides #890-1498) or mouse CD8α (NM_001081110.2, nucleotides #247-777) were also used.
(112) For construction of the CD4-MyD88 variants, retroviral vectors encoding human (Genbank NM_000616) or mouse (Genbank NM_013488) CD4 linked to MyD88 lacking the TIR domain were prepared.
(113) For construction of the TCR-MyD88 variant, human MyD88 (lacking the TIR domain) was cloned downstream of the human DMF5 TCRαβ chain (TCR alpha chain—Genbank Accession (3QEU_D) and GI (GI:339717586); TCR beta chain—Genbank Accession (3QEU_E) and GI:339717587; see also Johnson et al., Journal of Immunology. 2006; 177(9):6548-59)) in the retroviral vector. The DMF5 vector was provided by Dr. Laura Johnson (NCI, Bethesda, Md.; Johnson, L A et al. Blood 2009; 114:535-546; Johnson, L A et al. J. Immunol. 2006; 177:6548-6559).
(114) The construct sequences were confirmed by DNA sequencing and are as follows:
(115) TABLE-US-00002 Human CD8α full sequence (hCD8α):gi:225007534:ref:NM_001768.6 (SEQ ID NO: 1): ATGGCCTTACCAGTGACCGCCTTGCTCCTGCCGCTGGCCTTGCTGCTCCACGCCGCCAG GCCGAGCCAGTTCCGGGTGTCGCCGCTGGATCGGACCTGGAACCTGGGCGAGAC AGTGGAGCTGAAGTGCCAGGTGCTGCTGTCCAACCCGACGTCGGGCTGCTCGTGGCT CTTCCAGCCGCGCGGCGCCGCCGCCAGTCCCACCTTCCTCCTATACCTCTCCCAAAA CAAGCCCAAGGCGGCCGAGGGGCTGGACACCCAGCGGTTCTCGGGCAAGAGGTTGG GGGACACCTTCGTCCTCACCCTGAGCGACTTCCGCCGAGAGAACGAGGGCTACTATT TCTGCTCGGCCCTGAGCAACTCCATCATGTACTTCAGCCACTTCGTGCCGGTCTTCCT GCCAGCGAAGCCCACCACGACGCCAGCGCCGCGACCACCAACACCGGCGCCCACCA TCGCGTCGCAGCCCCTGTCCCTGCGCCCAGAGGCGTGCCGGCCAGCGGCGGGGGGC GCAGTGCACACGAGGGGGCTGGACTTCGCCTGTGATATCTACATCTGGGCGCCCTTG GCCGGGACTTGTGGGGTCCTTCTCCTGTCACTGGTTATCACCCTTTACTGCAACCACA GGAACCGAAGACGTGTTTGCAAATGTCCCCGGCCTGTGGTCAAATCGGGAGACAAG CCCAGCCTTTCGGCGAGATACGTC Human CD8α without the intracellular signaling domain (hCD8αΔIC) (SEQ ID NO: 2): ATGGCCTTACCAGTGACCGCCTTGCTCCTGCCGCTGGCCTTGCTGCTCCACGCCGCC AGGCCGAGCCAGTTCCGGGTGTCGCCGCTGGATCGGACCTGGAACCTGGGCGAGAC AGTGGAGCTGAAGTGCCAGGTGCTGCTGTCCAACCCGACGTCGGGCTGCTCGTGGCT CTTCCAGCCGCGCGGCGCCGCCGCCAGTCCCACCTTCCTCCTATACCTCTCCCAAAA CAAGCCCAAGGCGGCCGAGGGGCTGGACACCCAGCGGTTCTCGGGCAAGAGGTTGG GGGACACCTTCGTCCTCACCCTGAGCGACTTCCGCCGAGAGAACGAGGGCTACTATT TCTGCTCGGCCCTGAGCAACTCCATCATGTACTTCAGCCACTTCGTGCCGGTCTTCCT GCCAGCGAAGCCCACCACGACGCCAGCGCCGCGACCACCAACACCGGCGCCCACCA TCGCGTCGCAGCCCCTGTCCCTGCGCCCAGAGGCGTGCCGGCCAGCGGCGGGGGGC GCCGGGACTTGTGGGGTCCTTCTCCTGTCACTGGTTATCACC Human CD8α-MyD88ΔTIR where MyD88 lacks the TIR domain (hCD8α-hMyD88) (SEQ ID NO: 3): The underlined section denotes the MyD88 sequence. ATGGCCTTACCAGTGACCGCCTTGCTCCTGCCGCTGGCCTTGCTGCTCCACGCCGCC AGGCCGAGCCAGTTCCGGGTGTCGCCGCTGGATCGGACCTGGAACCTGGGCGAGAC AGTGGAGCTGAAGTGCCAGGTGCTGCTGTCCAACCCGACGTCGGGCTGCTCGTGGCT CTTCCAGCCGCGCGGCGCCGCCGCCAGTCCCACCTTCCTCCTATACCTCTCCCAAAA CAAGCCCAAGGCGGCCGAGGGGCTGGACACCCAGCGGTTCTCGGGCAAGAGGTTGG GGGACACCTTCGTCCTCACCCTGAGCGACTTCCGCCGAGAGAACGAGGGCTACTATT TCTGCTCGGCCCTGAGCAACTCCATCATGTACTTCAGCCACTTCGTGCCGGTCTTCCT GCCAGCGAAGCCCACCACGACGCCAGCGCCGCGACCACCAACACCGGCGCCCACCA TCGCGTCGCAGCCCCTGTCCCTGCGCCCAGAGGCGTGCCGGCCAGCGGCGGGGGGC GCAGTGCACACGAGGGGGCTGGACTTCGCCTGTGATATCTACATCTGGGCGCCCTTG GCCGGGACTTGTGGGGTCCTTCTCCTGTCACTGGTTATCACCATGGCTGCAGGAGGT CCCGGCGCGGGGTCTGCGGCCCCGGTCTCCTCCACATCCTCCCTTCCCCTGGCTGCTC TCAACATGCGAGTGCGGCGCCGCCTGTCTCTGTTCTTGAACGTGCGGACACAGGTGG CGGCCGACTGGACCGCGCTGGCGGAGGAGATGGACTTTGAGTACTTGGAGATCCGG CAACTGGAGACACAAGCGGACCCACTGGCAGGCTGCTGGACGCCTGGCAGGGACG CCCTGGCGCCTCTGTAGGCCGACTGCTCGAGCTGCTTACCAAGCTGGGCCGCGACGA CGTGCTGCTGGAGCTGGGACCCAGCATTGAGGAGGATTGCCAAAAGTATATCTTGA AGCAGCAGCAGGAGGAGGCTGAGAAGCCTTTACAGGTGGCCGCTGTAGACAGCAGT GTCCCACGGACAGCAGAGCTGGCGGGCATCACCACACTTGATGACCCCCTGGGG Mouse CD8α full sequence (mCD8α):gi:126722839:ref:001081110.2 (SEQ ID NO: 4): ATGGCCTCACCGTTGACCCGCTTTCTGTCGCTGAACCTGCTGCTGCTGGGTGAGTCG ATTATCCTGGGGAGTGGAGAAGCTAAGCCACAGGCACCCGAACTCCGAATCTTTCC AAAGAAAATGGACGCCGAACTTGGTCAGAAGGTGGACCTGGTATGTGAAGTGTTGG GGTCCGTTTCGCAAGGATGCTCTTGGCTCTTCCAGAACTCCAGCTCCAAACTCCCCC AGCCCACCTTCGTTGTCTATATGGCTTCATCCCACAACAAGATAACGTGGGACGAGA AGCTGAATTCGTCGAAACTGTTTTCTGCCATGAGGGACACGAATAATAAGTACGTTC TCACCCTGAACAAGTTCAGCAAGGAAAACGAAGGCTACTATTTCTGCTCAGTCATCA GCAACTCGGTGATGTACTTCAGTTCTGTCGTGCCAGTCCTTCAGAAAGTGAACTCTA CTACTACCAAGCCAGTGCTGCGAACTCCCTCACCTGTGCACCCTACCGGGACATCTC AGCCCCAGAGACCAGAAGATTGTCGGCCCCGTGGCTCAGTGAAGGGGACCGGATTG GACTTCGCCTGTGATATTTACATCTGGGCACCCTTGGCCGGAATCTGCGTGGCCCTTC TGCTGTCCTTGATCATCACTCTCATCTGCTACCACAGGAGCCGAAAGCGTGTTTGCA AATGTCCCAGGCCGCTAGTCAGACAGGAAGGCAAGCCCAGACCTTCAGAGAAAATT GTGTAA Mouse CD8α without the intracellular signaling domain (mCD8αΔIC) (SEQ ID NO: 5): ATGGCCTCACCGTTGACCCGCTTTCTGTCGCTGAACCTGCTGCTGCTGGGTGAGTCG ATTATCCTGGGGAGTGGAGAAGCTAAGCCACAGGCACCCGAACTCCGAATCTTTCC AAAGAAAATGGACGCCGAACTTGGTCAGAAGGTGGACCTGGTATGTGAAGTGTTGG GGTCCGTTTCGCAAGGATGCTCTTGGCTCTTCCAGAACTCCAGCTCCAAACTCCCCC AGCCCACCTTCGTTGTCTATATGGCTTCATCCCACAACAAGATAACGTGGGACGAGA AGCTGAATTCGTCGAAACTGTTTTCTGCCATGAGGGACACGAATAATAAGTACGTTC TCACCCTGAACAAGTTCAGCAAGGAAAACGAAGGCTACTATTTCTGCTCAGTCATCA GCAACTCGGTGATGTACTTCAGTTCTGTCGTGCCAGTCCTTCAGAAAGTGAACTCTA CTACTACCAAGCCAGTGCTGCGAACTCCCTCACCTGTGCACCCTACCGGGACATCTC AGCCCCAGAGACCAGAAGATTGTCGGCCCCGTGGCTCAGTGAAGGGGACCGGATTG GACTTCGCCTGTGATATTTACATCTGGGCACCCTTGGCCGGAATCTGCGTGGCCCTTC TGCTGTCCTTGATCATCACTCTCATC Mouse CD8α-human MyD88ΔTIR where MyD88 lacks TIR domain (mCD8α-hMyD88) (SEQ ID NO: 6): The underlined section denotes the MyD88 sequence. ATGGCCTCACCGTTGACCCGCTTTCTGTCGCTGAACCTGCTGCTGCTGGGTGAGTCG ATTATCCTGGGGAGTGGAGAAGCTAAGCCACAGGCACCCGAACTCCGAATCTTTCC AAAGAAAATGGACGCCGAACTTGGTCAGAAGGTGGACCTGGTATGTGAAGTGTTGG GGTCCGTTTCGCAAGGATGCTCTTGGCTCTTCCAGAACTCCAGCTCCAAACTCCCCC AGCCCACCTTCGTTGTCTATATGGCTTCATCCCACAACAAGATAACGTGGGACGAGA AGCTGAATTCGTCGAAACTGTTTTCTGCCATGAGGGACACGAATAATAAGTACGTTC TCACCCTGAACAAGTTCAGCAAGGAAAACGAAGGCTACTATTTCTGCTCAGTCATCA GCAACTCGGTGATGTACTTCAGTTCTGTCGTGCCAGTCCTTCAGAAAGTGAACTCTA CTACTACCAAGCCAGTGCTGCGAACTCCCTCACCTGTGCACCCTACCGGGACATCTC AGCCCCAGAGACCAGAAGATTGTCGGCCCCGTGGCTCAGTGAAGGGGACCGGATTG GACTTCGCCTGTGATATTTACATCTGGGCACCCTTGGCCGGAATCTGCGTGGCCCTTC TGCTGTCCTTGATCATCACTCTCATCATGGCTGCAGGAGGTCCCGGCGCGGGGTCTG CGGCCCCGGTCTCCTCCACATCCTCCCTTCCCCTGGCTGCTCTCAACATGCGAGTGCG GCGCCGCCTGTCTCTGTTCTTGAACGTGCGGACACAGGTGGCGGCCGACTGGACCGC GCTGGCGGAGGAGATGGACTTTGAGTACTTGGAGATCCGGCAACTGGAGACACAAG CGGACCCCACTGGCAGGCTGCTGGACGCCTGGCAGGGACGCCCTGGCGCCTCTGTA GGCCGACTGCTCGAGCTGCTTACCAAGCTGGGCCGCGACGACGTGCTGCTGGAGCT GGGACCCAGCATTGAGGAGGATTGCCAAAAGTATATCTTGAAGCAGCAGCAGGAGG AGGCTGAGAAGCCTTTACAGGTGGCCGCTGTAGACAGCAGTGTCCCACGGACAGCA GAGCTGGCGGGCATCACCACACTTGATGACCCCCTGGGG Human CD8α TM-MyD88 (hCD8αTM-hMyD88) (SEQ ID NO: 7): This vector lacks the extracellular part of human CD8α but contains the CD8α transmembrane hinge domain, followed by the human MyD88ΔTIR intracellular signaling sequence (underlined). TTCGTGCCGGTCTTCCTGCCAGCGAAGCCCACCACGACGCCAGCGCCGCGACCACCA ACACCGGCGCCCACCATCGCGTCGCAGCCCCTGTCCCTGCGCCCAGAGGCGTGCCG GCCAGCGGCGGGGGGCGCAGTGCACACGAGGGGGCTGGACTTCGCCTGTGATATCT ACATCTGGGCGCCCTTGGCCGGGACTTGTGGGGTCCTTCTCCTGTCACTGGTTATCAC CCTTTACTGCAACCACAGGAACATGGCTGCAGGAGGTCCCGGCGCGGGGTCTGCGG CCCCGGTCTCCTCCACATCCTCCCTTCCCCTGGCTGCTCTCAACATGCGAGTGCGGCG CCGCCTGTCTCTGTTCTTGAACGTGCGGACACAGGTGGCGGCCGACTGGACCGCGCT GGCGGAGGAGATGGACTTTGAGTACTTGGAGATCCGGCAACTGGAGACACAAGCGG ACCCCACTGGCAGGCTGCTGGACGCCTGGCAGGGACGCCCTGGCGCCTCTGTAGGC CGACTGCTCGAGCTGCTTACCAAGCTGGGCCGCGACGACGTGCTGCTGGAGCTGGG ACCCAGCATTGAGGAGGATTGCCAAAAGTATATCTTGAAGCAGCAGCAGGAGGAGG CTGAGAAGCCTTTACAGGTGGCCGCTGTAGACAGCAGTGTCCCACGGACAGCAGAG CTGGCGGGCATCACCACACTTGATGACCCCCTGGGG Mouse CD8α-human CD28-human 41BB-human CD3zeta (mCD8α-28-137-3; in some instances this same construct is term mCD8α-137-28-3) (SEQ ID NO: 8): This vector contains extracellular mouse CD8α and transmembrane hinge domain followed by the human intracellular signaling sequences that activate CD28, CD137 and the CD3 zeta chain. The CD28 is bold, the 41BB is double underlined and the CD3zeta is underlined with dotted line. Linkers are shown with wavy underlines. ATGGCCTCACCGTTGACCCGCTTTCTGTCGCTGAACCTGCTGCTGCTGGGTGAGTCG ATTATCCTGGGGAGTGGAGAAGCTAAGCCACAGGCACCCGAACTCCGAATCTTTCC AAAGAAAATGGACGCCGAACTTGGTCAGAAGGTGGACCTGGTATGTGAAGTGTTGG GGTCCGTTTCGCAAGGATGCTCTTGGCTCTTCCAGAACTCCAGCTCCAAACTCCCCC AGCCCACCTTCGTTGTCTATATGGCTTCATCCCACAACAAGATAACGTGGGACGAGA AGCTGAATTCGTCGAAACTGTTTTCTGCCATGAGGGACACGAATAATAAGTACGTTC TCACCCTGAACAAGTTCAGCAAGGAAAACGAAGGCTACTATTTCTGCTCAGTCATCA GCAACTCGGTGATGTACTTCAGTTCTGTCGTGCCAGTCCTTCAGAAAGTGAACTCTA CTACTACCAAGCCAGTGCTGCGAACTCCCTCACCTGTGCACCCTACCGGGACATCTC AGCCCCAGAGACCAGAAGATTGTCGGCCCCGTGGCTCAGTGAAGGGGACCGGATTG GACTTCGCCTGTGATATTTACATCTGGGCACCCTTGGCCGGAATCTGCGTGGCCCTTC TGCTGTCCTTGATCATCACTCTCATCAGGAGTAAGAGGAGCAGGCTCCTGCACAG TGACTACATGAACATGACTCCCCGCCGCCCCGGGCCCACCCGCAAGCATTACC
(116) Transfection of HEK Cells.
(117) That the mouse CD8α variant could be properly expressed in the cell membrane was confirmed using in human endothelial kidney cells (HEK; ATCC, Manassas, Va.). HEK cells were maintained in Dulbecco's modified Eagle's medium (DMEM) (GIBCO brand; Invitrogen, Carlsbad, Calif., USA) supplemented with 10% heat inactivated fetal bovine serum (Gemini Bio-Products, West Sacramento, Calif., USA), 2 mM L-glutamine (GIBCO brand; Invitrogen) and 1% penicillin-streptomycin (GIBCO brand; Invitrogen). The day before transfection, the cells were trypsinized and counted. 0.5×10.sup.5 cells/ml were plated at a cell density of 50% confluency. Cells were transfected with 2.5 μg of DNA encoding mCD8α in 100 μl of Opti-MEM® I Reduced Serum Media without serum and 0.5 μl of Lipofectamine LTX (LIFE Technologies, Grand Island, N.Y.) according to the manufacturer's protocol. After a 30 minute incubation, 100 μl of the DNA-Lipofectamine LTX Reagent complexes were added directly to each well containing cells and mixed gently by rocking the plate back and forth. 48 hours after transfection the expression of CD8α was determined by flow cytometry.
(118) Retroviral Transduction of T Cells.
(119) Spleen and lymph node—derived mouse pmel T cells (Jackson Laboratory) were activated using plate bound anti-CD3 (5 ug/ml) and anti-CD28 Ab (2.5 ug/ml) (BD Biosciences, Franklin Lakes, N.J., USA) for two days while T cell receptors specific for the mouse gp100.sub.25-33 antigen expression were activated by adding 1 ug/ml of gp100.sub.25-33 peptide. Two days later cells were collected for retroviral transduction. For transduction, 24-well non-tissue culture treated plates (BD Biosciences, Franklin Lakes, N.J., USA) were coated with 0.5 ml per well of 10 μg/ml recombinant human fibronectin fragment (RetroNectin; Takara, Otsu, Shiga, Japan) overnight at 4° C. After incubation, wells were blocked with 1 ml of Hank's balanced salt solution (GIBCO brand; Invitrogen) plus 2.5% human AB serum for 30 min at RT, and washed with Hank's balanced salt solution plus 2.5% N-2-hydroxyethylpiperazine-N′-2-ethanesulfonic acid (HEPES) (GIBCO brand; Invitrogen).
(120) Transductions were conducted as previously described (Johnson et al. Blood 114, 535-546 (2009)). Briefly, approximately 2.5 ml of retroviral supernatant were added to each coated well followed by centrifugation at 2000 g for 2 h at 32° C. 1.5 ml of viral supernatant was removed and 1×10.sup.6 (0.5 ml) activated T cells were added to each well in the presence of 100 U/ml IL-2. Plates were centrifugated at 1000 g for 10 min, and then incubated overnight at 37° C. After transduction, cells were washed and maintained in the presence of IL-2 (100 U/ml) and used in experiments five days after transduction. The transduction efficiencies are determined by evaluating the percentage of T cells positive for green fluorescent protein (GFP+), as the MGSV vector used contains a gene that encodes GFP. The plasmid is referred to as pMIG and was purchased from Addgene (Cambridge, Mass.). The successful transduction of T cells was confirmed by the expression of GFP which is located downstream of the CD8, CD4 and TCR constructs.
(121) For transduction of human T cells, peripheral blood mononuclear cells (PBMC) from healthy donors were purchased from Biological Specialty Corp (Colmar, Pa., USA), and isolated by Ficoll-Pague (GE Healthcare, Piscataway, N.J., USA) density gradient centrifugation. Isolated PBMC were cultured at 3×10.sup.6 per well in 24-well tissue culture plates in AIM V medium (GIBCO brand; Invitrogen) supplemented with 5% human AB serum (Sigma-Aldrich), 1% MEM non-essential amino acids, 1% penicillin-streptomycin and 100 U/ml recombinant human IL-2 (BioLegend, San Diego, Calif., USA), and activated with 50 ng/ml OKT3 (eBioscience, San Diego, Calif., USA). Two days later, cells were collected for retroviral transduction.
(122) For transduction, 24-well non-tissue culture treated plates (BD Biosciences, Franklin Lakes, N.J., USA) were coated with 0.5 ml per well of 10 μg/ml recombinant human fibronectin fragment (RetroNectin; Takara, Otsu, Shiga, Japan) overnight at 4° C. After incubation, wells were blocked with 1 ml of Hank's balanced salt solution (GIBCO brand; Invitrogen) plus 2.5% human AB serum for 30 min at RT, and washed with Hank's balanced salt solution plus 2.5% N-2-hydroxyethylpiperazine-N′-2-ethanesulfonic acid (HEPES) (GIBCO brand; Invitrogen).
(123) Transductions were conducted as previously described (Johnson et al. Blood 114, 535-546 (2009)). Briefly, approximately 2.5 ml of retroviral supernatant were added to each coated well followed by centrifugation at 2000 g for 2 h at 32° C. 1.5 ml of viral supernatant was removed and 1×10.sup.6 (0.5 ml) activated PBMC were added to each well in the presence of 100 U/ml IL-2. Plates were centrifuged at 1000 g for 10 min, and then incubated overnight at 37° C. After transduction, cells were washed and maintained in the presence of IL-2 (100 U/ml) and used in experiments five days after transduction. The surface expression of DMF5 on transduced human T cells was determined by flow cytometry after staining cells with CD8 and MART-1 MHC tetramers.
(124) NF-κB Activation Assay.
(125) TLR4-expressing HEK-Blue cells were cultured in DMEM 10% FBS 1% PenStrep 1×HEK-Blue Solution (InvivoGen). Cells were plated at 1×10.sup.6 cells per well in a 6-well plate in antibiotic-free media and cultured at 37° C./5% CO.sub.2 overnight. Cells were transfected with Lipofectamine 2000 (Invitrogen) with 4 μg DNA. 24 hours later, cells were collected and aliquoted at 50,000 cells per well in a 96-well plate in quadruplicate. 50 ug/mL of LPS (Invitrogen) was used as a positive control. Cell supernatant was collected after 24 hours and combined with QUANTI-Blue reagent (InvivoGen). Absorbance was measured at 620 nm after 3 hours. These cells were used to evaluate the ability of the different CD8 constructs to activate NF-kB and used as a surrogate for CD8 function.
(126) T Cell Proliferation Assay, Cytokine and Chemokine Production Assay.
(127) Three to five days after transduction, 1×10.sup.5 T cells were cultured in 96-well round-bottom plates with B16 tumor cells or with mouse splenocytes pulsed with gp100.sub.25-33 peptide. 1×10.sup.5 effector T cells and 1×10.sup.5 tumor cells were co-cultured in 200 μl of culture volume in 96-well round-bottom plates for 72 h. Sixteen hours before harvesting, 0.5 μCi of 3H-thymidine was added to each well prior to measuring thymidine uptake using a 1450 LSC & luminescence counter (PerkinElmer, Waltham, Mass., USA). Cytokine and chemokine production levels were measured from culture supernatants collected 48 hours after stimulation using a Cytokine/Chemokine kit (Millipore, Billerica, Mass., USA) according to manufacturer's instructions. For studies examining the costimulatory effects of MyD88 when fused to a tumor-reactive T cell receptor (TCR), human T cells transduced with the 1×10.sup.5 effector T cells DMF5 or DMF5-MyD88 were co-cultured with 1×10.sup.5 human Malm-3M melanoma tumor cells in 96-well round-bottom plates in 200 μl of culture volume in 96-well round-bottom plates for 72 h. Sixteen hours before harvesting, 0.5 μCi of 3H-thymidine was added to each well prior to measuring thymidine uptake using a 1450 LSC & luminescence counter (PerkinElmer, Waltham, Mass., USA).
(128) Cytotoxicity Assay.
(129) Cytotoxic activity against tumor target cells was measured using a standard .sup.51Cr release assay. Target cells were labeled with 200 μCi of .sup.51Cr for 2 h at 37° C., washed 3 times, and pulsed with anti-human antibodies for 1 h at 37° C. 1×10.sup.4 labeled target cells were then co-cultured with decreasing numbers of effector T cells at the indicated effector to target (E:T) ratios in 200 μl of culture volume in 96-well round-bottom plates. Target cells incubated in media alone were used to determined spontaneous .sup.51Cr release, and maximal release was determined by incubating labeled target cells in 10% Triton X-100. After 5 hours at 37° C., 50 μl of supernatant was collected and .sup.51Cr radioactivity was measured in a 1450 LSC & luminescence counter. The mean percentage of specific lysis was calculated according to the following equation: % specific lysis=(test release−spontaneous release)/(maximal release−spontaneous release)×100. All tests were performed in triplicate wells and results are shown as mean±SD. In other experiments, a non-radioactive cytotoxicity kit was used (Promega, Madison, Wis.).
(130) MDSC Suppression Assays.
(131) Myeloid-derived suppressor cells (MDSC; as characterized be expression of CD11b+Gr1+) were collected from the blood of mice with established B16-GMCSF melanoma tumors. MDSCs were irradiated (10,000 rads; gamma-radiation source) and co-cultured with T cells engineered to express CD8α-MyD88 or a control vector (GFP) in 96-well round bottom plates. 1×10.sup.5 T cells were cultured with 1×10.sup.5 or 2.5×10.sup.5 MDSCs for 48 hours. Sixteen hours before harvesting, 0.5 μCi of 3H-thymidine was added to each well prior to measuring thymidine uptake using a 1450 LSC & luminescence counter (PerkinElmer, Waltham, Mass., USA).
(132) Results
(133) Experiment 2A.
(134) CD8α expression was confirmed in CD8α-transfected HEK cells (which do not express endogenous CD8α). As shown in
(135) Experiment 2B.
(136) The ability of MyD88 to induce signaling in HEK-Blue cells was determined. As can be seen from
(137) Experiment 2B.
(138) The ability of MyD88 to induce signaling in HEK-Blue cells was determined. As can be seen from
(139) Experiment 2C.
(140) The ability of each CD8α construct to alter TCR-mediated CD8.sup.+ T cell proliferation and cytokine production was examined. CD8.sup.+ T cells from TCR transgenic mice, specific for the gp100.sub.25-33 antigen, were engineered to express mCD8α-hMyD88, mCD8αΔIC, mCD8α-28-137-3, or GFP control (pMIG). Forty-eight hours after transduction, T cells were stimulated with splenocytes pulsed with the varying concentrations of the gp100.sub.25-33 peptide, representing a melanoma tumor antigen. T cells expressing mCD8α-hMyD88 exhibited greater proliferation (
(141) Experiment 2D.
(142) To determine how the different CD8α constructs altered the capacity of CD8.sup.+ T cells to proliferate in response to stimulation with tumor cells, pmel T cells were engineered to express mCD8α-hMyD88, mCD8αΔIC, mCD8α-28-137-3 (mCD8α-137-28-3), or GFP control (pMIG) and co-cultured with varying numbers of mouse B16 melanoma cells. As shown in
(143) Experiment 2E.
(144) Mouse T cells were transduced with mCD8α-hMyD88, mCD8αΔIC, mCD8α-137-28-3 (CD8-28-1BB-3ξ), or GFP control (pMIG) as indicated in
(145) Experiment 2F.
(146) CD8-MyD88 signaling. CD8.sup.+ pmel T cells were transduced with CD8α-MyD88, CD8αΔIC or pMIG control vector. T cells were stimulated in at a 1 to 1 ratio with B16 tumor cells for 10 and 30 minutes, then fixed in 4% PFA. The 0 time point indicates no B16 were added. Cells were permeabilized and stained for the indicated phosphorylated proteins, p-p38, p-JNK, p-ERK½ which are activated in response to TCR signaling. As shown in
(147) Experiment 2G.
(148) The ability of mCD8α-hMyD88 to augment T cell cytotoxicity was examined. mCD8α-hMyD88 expression significantly enhanced the killing of mouse melanoma cells as compared with T cells expressing mCD8αΔIC or mCD8α-28-137-3,
(149) Experiment 2H.
(150) It has been demonstrated that tumor reactive T cells engineered to secrete a ligand that activates toll-like receptor 5 (TLR5) enhanced the ability of T cells to destroy a melanoma tumor in mice (Geng et al., Can Res. 2015; 75:1959-1971). The increased antitumor activity was associated with a reduced number of myeloid derived suppressor cells (MDSC) in tumors and spleens. MDSCs derived from mice treated with TLR5 ligand-secreting T cells also demonstrated phenotypic changes including increased levels of major histocompatibility complex (MHC) I and MHC II as well as increased expression levels of the costimulatory molecule CD86 which could potentiate antitumor T cell activity. Furthermore, TLR engagement on T cells alters the cytokine and chemokine profile in vitro and in vivo and these changes were associated with reduced numbers of and phenotypic alterations in myeloid derived suppressor cells (MDSC). MDSCs are potent inhibitors of antitumor CD8 and CD4 T cell responses. TLR stimulation requires MyD88 signaling. Therefore, the ability of mCD8α-hMyD88 expression in CD8.sup.+ T cells to alter cellular responses to MDSC-mediated suppression was evaluated. As shown in
(151) Experiment 2I.
(152) The antitumor activity of pmel CD8.sup.+ T cells engineered to express GFP (which serves as a transduction control), CD28-CD137-CD3zeta, or MyD88 was tested in mice with established B16 melanoma tumors. When tumors reached a size of approximately 30 mm.sup.2, mice were intravenously injected with ˜2.5×10.sup.6 T cells and tumor growth was measured over the course of several weeks. Mice treated with mCD8α-hMyD88 T cells exhibited delayed tumor growth kinetics (
(153) Experiment 2J.
(154) A further in vivo experiment confirmed that mCD8α-hMyD88 expression in tumor reactive T cells enhances antitumor responses and prolongs mouse survival in the absence of any support therapy. C57BL6 mice were injected s.c. with B16 melanoma tumor cells in the rear flank. Eight days after tumor cell injection, mice received by tail i.v. injection ˜10.sup.6 pmel T cells engineered to express mCD8α-hMyD88 or control pMIG vector or mice remained untreated. No support therapy (i.e., IL-2, immune adjuvants or checkpoint blockade Ab) was provided. Mice treated with mCD8α-hMyD88 T cells exhibited significantly enhanced antitumor responses (
(155) Experiment 2K.
(156) The ability for MyD88 signaling to enhance TCR-induced proliferation when linked directly to the TCR was examined. DMF5, a TCR specific for the MART-1.sub.26-35 peptide from the MART-1 melanoma antigen presented by MHC I, was fused to MyD88 lacking the TIR domain. The DMF5 TCR was kindly provided by Dr. Laura Johnson at the National Cancer Institute and is the same sequence used in clinical trials registered at www.ClinicalTrials.gov as NCI-07-C-0174 and NCI-07-C-0175 (Johnson, L A et al. Blood 2009; 114:535-546; Johnson, L A et al. J. Immunol. 2006; 177:6548-6559). Transduction efficiencies were similar between DMF5 and DMF5-MyD88. As shown in
(157) While the invention has been described with reference to certain particular embodiments thereof, those skilled in the art will appreciate that various modifications may be made without departing from the spirit and scope of the invention. The scope of the appended claims is not to be limited to the specific embodiments described.
REFERENCES
(158) All patents and publications mentioned in this specification are indicative of the level of skill of those skilled in the art to which the invention pertains. Each cited patent and publication is incorporated herein by reference in its entirety.