Analysis of single-stranded RNA

11008605 · 2021-05-18

Assignee

Inventors

Cpc classification

International classification

Abstract

Provided is a method for modifying a ssRNA at the 3′ end, the method including contacting the strand with a ssRNA 2′-O-methyltransferase in the presence of a co-factor, under conditions which allow for the transfer by the ssRNA 2′-O-methyltransferase of a part of the co-factor onto the 3′ end of the ssRNA to form a modified ssRNA, wherein the ssRNA bears 2′-OH group at 3′ terminal nucleotide and wherein the part of the co-factor transferred includes a reporter group or a functional group.

Claims

1. A method for modifying a strand of single-stranded RNA (ssRNA strand) at the 3′ end, said method comprising contacting the ssRNA strand with a ssRNA 2′-O-methyltransferase in the presence of a co-factor, under conditions which allow for the transfer by the ssRNA 2′-O-methyltransferase of a part of the co-factor onto the 3′ end of the ssRNA strand to form a modified ssRNA strand, wherein the ssRNA strand bears unmethylated 2′-OH group at 3′ terminal nucleotide and wherein the part of the co-factor transferred comprises more than 4 atoms and contains a reporter group or a functional group capable of being used to attach a reporter group.

2. A method according to claim 1 wherein the ssRNA strand is 20 to 81000 nucleotides in length.

3. A method according to claim 1 wherein the ssRNA strand is eukaryotic long non-coding RNA and small non-coding RNA.

4. A method according to claim 1 wherein the ssRNA 2′-O-methyltransferase comprises an amino acid sequence having at least 70% sequence identity with SEQ ID No: 1 or SEQ ID No: 2.

5. A method according to claim 1 wherein the co-factor is an S-adenosyl-L-methionine analogue.

6. A method according to claim 1 wherein the co-factor comprises a functional group selected from the group consisting of an amino group, a thiol group, a hydrazine group, a hydroxylamine group, a 1,2-aminothiol group, an azide group, a diene group, an alkyne group, an arylhalide group, a terminal silylalkyne group, an N-hydroxysuccinimidyl ester group, a thioester group, an isothiocyanate group, an imidoester group, a maleimide group, a haloacetamide group, an aziridine group, an arylboronic acid group, an aldehyde group, a ketone group, a phosphane ester group, a dienophile group and a terminal haloalkyne group.

7. A method according to claim 1 wherein the co-factor comprises a functional group and the method further comprises a step of reacting the functional group with a compound comprising a reporter group under conditions which allow for the transfer of the reporter group to the ssRNA strand.

8. A method according to claim 1 wherein the reporter group is selected from the group consisting of a fluorophore, a quantum dot, an affinity tag, an oligonucleotide, a DNA aptamer, an RNA aptamer, a DNAzyme, an RNAzyme, an antibody, a peptide, a protein, a glycan, a nanoparticle, and a magnetic particle.

9. A method according to claim 8 wherein the affinity tag is biotin, c-myc-tag, HA-tag, digoxygenin, flag-tag, dinitrophenol, His-tag, strep-tag, glutathione, nickel-nitrilotriacetic acid (NTA), or maltose.

10. A method according to claim 1 wherein the part of the co-factor transferred comprises the functional group capable of being used to attach a reporter group and the method further comprises a step of reacting the functional group with a reactive group attached to an oligonucleotide under conditions that allow for the transfer of the oligonucleotide onto the 3′ end of the ssRNA strand.

11. A method according to claim 10 wherein said functional group is azide, and said reactive group is alkyne.

12. A method according to claim 10, wherein the method further comprises a step of sequencing the ssRNA strand through DNA oligonucleotide attachment and reverse transcription.

13. A method according to claim 1, wherein the contacting is in a reaction mixture to which divalent Co2+ or trivalent Co3+ ions are added.

14. A method according to claim 1 comprising an additional step of providing the ssRNA strand from a sample taken from a virus, microorganism, animal or plant.

15. A method for analysing ssRNA present in a biological sample, said method comprising: (a) attaching a reporter group to the 3′ end of an ssRNA strand in the biological sample using the method of claim 1; (b) analysing the reporter group attached to the ssRNA strand.

16. A method according to claim 15 wherein the reporter group is an affinity tag and step (b) comprises affinity binding and enrichment of the ssRNA strand attached to the affinity tag.

17. A method according to claim 16 further comprising the steps of cloning the enriched ssRNA strand and then sequencing said ssRNA strand.

18. A method according to claim 15 wherein step (b) comprises detecting and quantifying the reporter group attached to the ssRNA strand.

Description

DESCRIPTION OF FIGURES

(1) The invention will be described in more detail with reference to the Figures in which:

(2) FIG. 1 Schematic representation of Drosophila melanogaster and Homo sapiens ssRNA 2′-O-methyltransferases, Dm-piRMT and Hs-piRMT, respectively (A), together with the illustration of their natural role in piRNA modification (B). A. Dm-piRMT and Hs-piRMT are 391 and 393 aa. long proteins with methyltransferase (MTase) domain at N termini and about 100 aa long C-terminal domain (CTD) of unknown function. B. PIWI protein bound piRNAs are modified at their 3′ termini by ssRNA 2′-O-methyltransferase this being the last step of piRNA biogenesis.

(3) FIG. 2 shows strategies of Dm-piRMT and Hs-piRMT-directed labeling of ssRNAs in embodiments of the invention in comparison to the natural reaction. Pathway A (top) highlights the natural piRMT reaction—the methyl group transfer from S-adenosyl-L-methionine towards single-stranded RNA (R=methyl). Pathway B (center) describes a two step labeling strategy thereby a functional group (primay amine, thiol, alkine, azide, aziridine, carboxyl, aromatic hydrocarbon, etc.) embedded in the side chain R of a synthetic cofactor is transfered to the 3′ end of ssRNA and then the functional group is used to attach a desired reporter group in a second step. An alternative strategy C (bottum) illustrates one-step labeling of RNA molecules by direct piRMT-dependent transfer of a reporter group (e.g., biotin, fluorofores, etc.) embeded in the side chain R of a cofactor analog. The triangles represent functional groups, stars—reporter groups.

(4) FIG. 3 shows the metal ion requirements of Dm-piRMT and Hs-piRMT for efficient catalysis. A. From all analyzed potential metal ion cofactors, only the presence of Co.sup.2+ or Co.sup.3+ in the reaction mixture confers full methylation of ssRNA substrate. To test the requirement of different metal cofactors, 20 μl reaction volumes, containing reaction buffer [10 mM Tris-HCl (pH 7.4), 50 mM NaCl, 0.1 mg/ml BSA, 5% (v/v) glycerol and 0.05 u/μl RiboLock (Thermo Scientific)], 0.2 μM .sup.32P-labelled miR173.1 (5′-UUCGCUUGCAGAGAGAAAUCAC-3′, 22 nt) (SEQ ID NO: 3), 0.1 mM AdoMet, 10 mM metal ion and 1 μM of piRMT proteins' were mixed. After 30 min of incubation at 37° C., the degree of modification was determined by NaIO.sub.4/β-elimination reaction, during which RNA was treated with 0.2 mM NaIO.sub.4 in borax/boric acid buffer [0.06 M, pH 8.6] for 15 min followed by 75 min incubation in borax/boric acid buffer II [0.06 M pH 9.6] at 42° C. Reaction samples were analyzed in 13% denaturing polyacrylamide gel (PAG) and autoradiographed. Fractions of methylated RNA, represented by bands with lower electrophoretic mobility, were evaluated using Multi Gauge version 3.0 software (Fujifilm). The depletion of metal ions by EDTA in the reaction mixture, together with the sample without any metal cofactor added, further confirms that the effective piRMT methylation is due to Co.sup.2+ and Co.sup.3+ ions. B. Column-diagram of RNA methylation efficiency with different metal cofactors. Results are average of duplicate experiments±S.D.

(5) FIG. 4 shows improved uniformity of modification efficiency towards different terminal nucleotides in ssRNA substrates. The use of Co.sup.2+ as metal cofactor results in equally effective modification of RNA substrates with different 3′ terminal nucleotides by Dm-piRMT, while it is known, that other homologous piRNA methyltransferase, for example mouse piRMT, have a preference to A over C, U and G. A. RNA modification experiments were performed as described in FIG. 3, with the exception, that miR173.1 with different 3′ terminal nucleotides, namely U, C, A and G, was used as substrate and 2 μM of Dm-piRMT was added to the reaction mixtures. B. Column-diagram of modification efficiency of miR173.1 with different 3′ terminal nucleotides. Results are average of two experiments±S.D.

(6) FIG. 5 shows that Dm-piRMT and Hs-piRMT can be used to effectively transfer various functional groups from synthetic cofactor analogues to ssRNA. A. ssRNA 2′-O-methyltransferases covalently modify the miR173.1 strand. Reactions were performed using 2 μM of piRMT methyltransferases and AdoMet or synthetic cofactor analogues, Ado-6-amine or Ado-6-azide, with extended side chains for two step labeling. All the experimental details are given in FIGS. 3 and 4. B. Dm-piRMT modifies RNA substrates with different 3′ terminal nucleotides with synthetic cofactor analogues at the same or even higher reaction rates (k.sub.chem, min.sup.−1) as compared to AdoMet. To measure the rate of modification reactions, 0.2 μM .sup.32P-labelled miR173.1 with different 3′ terminal nucleotides, 0.1 mM AdoMet or its synthetic analogues, 10 mM Co.sup.2+ and 2 μM of Dm-piRMT were added to the reaction buffer [10 mM Tris-HCl (pH 7.4), 50 mM NaCl, 0.1 mg/ml BSA, 5% (v/v) glycerol and 0.05 u/μl RiboLock (Thermo Scientific)] and incubated at 37° C. At a certain time points reactions were stopped by the addition of Proteinase K in stop buffer [7 mM Tris-HCl (pH 7.4), 0.17 mM EDTA, 3 mM NaCl and 0.5% SDS] to a final concentration of 0.4 mg/ml and further incubation at 55° C. for 20 min. This was followed by NaIO.sub.4/β-elimination reaction and denaturating PAG electrophoresis described in FIG. 3. Results are mean of two experiments±S.D.

(7) FIG. 6 shows that in the presence synthetic cofactor analogues Dm-piRMT can alkylate RNA substrates of a wide length range. A. Principal scheme of 22-80 nt long RNA modification by Dm-piRMT with methyl group (CH.sub.3) or extended side chains (X) from AdoMet or synthetic cofactor analogues (AdoX), respectively. B. The proof of concept delineated in FIG. 6A. Experiments were prepared as described in FIG. 3, except that 2 μM of Dm-piRMT was used. The 23 nt long RNA substrate was siR173.1 (5′-UUAACGCUUGCAGAGAGAAUCAC-3) (SEQ ID NO: 4). The same siR173.1 sequence was at the 3′ ends of 60 and 80 nt long RNA molecules.

(8) FIG. 7 shows that piRMT modified RNA can be further used for its sequencing through DNA oligonucleotide attachment and subsequent reverse transcription. A. Scheme showing ligation independent strategy for RNA sequencing. At least 22-80 nt long RNAs (black lines) can be modified by Dm-piRMT with, for example 6-azide (X), as shown in FIG. 6, then through “click chemistry” attached to terminal alkyne (Y) modified double-stranded DNA oligonucleotides (gray and light gray lines) and reverse transcribed to complementary DNAs (dotted black line). B and C. The proof of concept laid down in FIG. 7A. B. DNA-alkyne can be successfully attached to Dm-piRMT generated RNA-6-azide. For click reaction 10 μM of alkylated DNA was mixed with 10 μM .sup.32P-labeled modified RNA, ˜60% DMSO and 3.3 mM CuBr-TBTA (3.3 mM CuBr, 3% DMSO, 7 mM TBTA). After 1 h of incubation at 45° C. samples were analyzed in 13% PAG. C. New DNA strand, complementary to RNA of interest, can be synthesized from RNA-DNA hybrid. After click reaction 0.08 μM of RNA-DNA conjugate were reverse transcribed by 10 u/μl of RevertAid RT (RT) (Thermo Scientific) in reaction mixture containing 0.4 mM dNTP, 1 u/μl RiboLock (Thermo Scientific) and 1× RevertAid RT reaction buffer at 30° C. for 2 h 10′.

(9) FIG. 8 shows the structure of example co-factor molecules applicable for two step labeling: X=Ado-6-amine and X=—N.sub.3-Ado-6-azide.

(10) FIG. 9 shows polyacrylamide gel analysis of Dm-piRMT-dependent labeling of ssRNA in a single step as depicted in FIG. 2C. The biotinylation of single-stranded miR173.1 was performed as described in FIG. 3 with the exception that 2 μM of Dm-piRMT was used in the modification reaction and no NaIO.sub.4/β-elimination was applied.

DETAILED DESCRIPTION OF THE INVENTION

(11) As indicated above the present invention provides, in a first aspect, a method for modifying a single-stranded RNA at the 3′ end, said method comprising contacting the strand with a ssRNA 2′-O-methyltransferase in the presence of a co-factor, under conditions which allow for the transfer by the ssRNA 2′-O-methyltransferase of a part of the co-factor onto the 3′ end of the single-stranded RNA to form a modified RNA, wherein the part of the co-factor transferred comprises a reporter group or a functional group.

(12) Enzyme

(13) The present inventors have surprisingly found that ssRNA 2′-O-methyltransferase enzymes are able to transfer a reporter group or a functional group from a co-factor onto ssRNA. In particular this ssRNA is not the enzymes' natural substrate, that it is not human's or D. melanogaster's piRNA, and is, preferably, up to 2.5 times longer than it. Using Co.sup.2+ as metal cofactor, high efficiency of modification reaction and uniformity towards different terminal nucleotides is achieved.

(14) The ssRNA 2′-O-methyltransferases modify exceptionally ssRNAs (Saito et al., (2007) Genes Dev. 21, 1603-1608). Mainly this is because their lack double-stranded RNA binding domain, contrary to their plant homologs (Huang, (2012) Biochemistry 51, 4087-4095) and, probably, differs in characteristics of methyltransferase domain (Vilkaitis et al., (2010) RNA 16, 1935-1942). It is proposed, that the length of ssRNA 2′-O-methyltransferase's substrate is determined during the interaction with enzyme's partners, PIWI proteins (Horwich et al., (2007) Curr Biol. 17, 1265-1272).

(15) As ssRNA 2′-O-methyltransferase homologs use both Mn.sup.2+ and Mg.sup.2+ ions as metal cofactors, it is shown that Hs-piRMT modifies RNA in a presence of Mn.sup.2+, although to seemingly low levels (Huang, (2012) Biochemistry 51, 4087-4095; Chan et al., (2009) Proc Natl Acad Sci USA. 106, 17699-17704).

(16) The ssRNA 2′-O-methyltransferase enzymes are the ones which normally use (or is capable of using) S-adenosyl-L-methionine (SAM or AdoMet) as a co-factor (Huang, (2012) Biochemistry 51, 4087-4095).

(17) The biogenesis of animal piRNAs as well as plant miRNAs and siRNAs involves their modification at the 3′-termini (Kim et al., (2010) Cell 143, 703-709). In animals this reaction is carried out by a family of single-stranded RNA 2′-O-methyltransferases which share a conservative catalytic domain with plant and bacteria RNA modifying enzymes. Human and D. melanogaster ssRNA 2′-O-methyltransferases, piRMTs, catalyzes methyl group transfer from S-adenosyl-L-methionine to piRNA (Saito et al., (2007) Genes Dev. 21, 1603-1608). Unlike plant methyltransferases which display a strong preference towards duplex RNAs and efficiently methylates both strands of it (Vilkaitis et al., (2010) RNA 16, 1935-1942), these animal homologues modify single-stranded RNA substrates of 21-38 nt in length (Saito et al., (2007) Genes Dev. 21, 1603-1608). This methylation is critical for piRNA stability and function (Horwich et al., (2007) Curr Biol. 17, 1265-1272).

(18) The RNA 2′-O-methyltransferase enzyme to be used in the method described herein may be obtained from animals and is preferably Hs-piRMT (acquired from human) or Dm-piRMT (obtainable from a fruit fly), a catalytic domain of piRMT or a piRMT homolog (or a catalytic domain thereof), such as mouse piRMT (Kirino and Mourelatos, (2007) RNA 13, 1397-1401). The sequences of the wild type Hs-piRMT and Dm-piRMT can be found in GenBank, Accession Nos NP_653185.2 and NP_610732.1, respectively. The protein sequences are as follows:

(19) TABLE-US-00001 SEQ ID No: 1 Hs-piRMT: MEENNLQCSSVVDGNFEEVPRETAIQFKPPLYRQRYQFVKNLVDQHEP KKVADLGCGDTSLLRLLKVNPCIELLVGVDINEDKLRWRGDSLAPFLG DFLKPRDLNLTITLYHGSVVERDSRLLGFDLITCIELIEHLDSGDLAR FPEVVFGYLSPSMIVISTPNSEFNPLFPSVTLRDSDHKFEWTRMEFQT WALYVANRYDYSVEFTGVGEPPAGAENVGYCTQIGIFRKNGGKATESC LSEQHDQHVYKAVFTTSYPSLQQERFFKLVLVNEVSQQVESLRVSHLP RRKEQAGERGDKPKDIGGSKAPVPCFGPVFTEVEKAKIENSPTPFCVG DKFFVPLQRLLAYPKLNRLCANEEMMRSVIADSIPLSSDGSAVVADLR NYFDEQFEF SEQ ID No: 2 Dm-piRMT: MFSHKFICGSLTKMTETGITFDPPVYEQRYCATIQILEDARWKDQIKK VVEFGCAEMRFFQLMRRIETIEHIGLVDIDKSLLMRNLTSVNPLVSDY IRSRASPLKVQILQGNVADSSEELRDTDAVIAIELIEHVYDDVLAKIP VNIFGFMQPKLVVFSTPNSDFNVIFTRFNPLLPNGFRHEDHKFEWSRD EFKNWCLGIVEKYPNYMFSLTGVGNPPKEYESVGPVSQIAIFVRKDML EMQLVNPLVSKPNIDKESIPYKLIHTVEYPFYVDTRTEKEKLWTEVQI ELQRFKRQFESSEIEEGTYQDTCNMPIAFLLDRLEHVGATKERIEELL LENNLTVENECVLIVSSDQESEWSDPYKFSDRSSQDDALVDQEQEEER WDQGPES

(20) Preferably the ssRNA 2′-O-methyltransferase enzyme has at least 70% sequence identity, more preferably at least 80% sequence identity, most preferably at least 90% sequence identity with SEQ ID No: 1 or SEQ ID No: 2.

(21) The RNA 2′-O-methyltransferase enzyme to be used in the method described herein may also be an engineered (modified, truncated or enlarged) version of the natural proteins which retains the majority of their catalytic domain. The catalytic domains of Hs-piRMT and Dm-piRMT comprise aa 22-280 of SEQ ID NO: 1 and 16-291 of SEQ ID NO: 2 respectively.

(22) The RNA 2′-O-methyltransferase enzyme to be used in the method described herein may also be obtained from bacteria, archaea and viruses, which could be identified by their AdoMet-dependent ssRNA 2′-O-methyltransferase activity and which belong to the superfamily of “S-adenosyl-L-methionine-dependent methyltransferases” (http://supfam.org/SUPERFAMILY/cgi-bin/scop.cgi?sunid=53335) as defined in the Superfamily database of the HMM library and genome assignment server (http://supfam.csbrisac.uk/SUPERFAMILY/).

(23) RNA

(24) In the method described herein the RNA which is modified is a single-stranded molecule. In particular, the RNA strand is not an animal piRNA 2′-O-methylated at 3′ terminal nucleotide.

(25) The RNA strand is preferably a strand of a virus, a microorganism, a plant or an animal (including human) as long as it has an unmethylated 3′ terminal 2′-OH group. Accordingly, the method of invention can comprise an additional step of obtaining or providing a strand of RNA from a biological sample taken from a virus, a microorganism, a plant or an animal (including human).

(26) The RNA strand may span the range of 20-81000 nucleotides in length, corresponding accordingly to the shortest ssRNA modified by piRMT and the longest coding sequence in human genome (the titin gene); it is preferably, 20-400 nt in length, which corresponds accordingly to the shortest ssRNA modified by Hs-piRMT and the size of largest bacterial ssRNAs; most preferably it is 22-80 nt in length as shown in Example 2 below.

(27) The single-stranded RNA that can be modified using the method of invention may be eukaryotic long non-coding RNA, small non-coding RNA, such as miRNA, siRNA, piRNA; bacterial small regulatory RNA; viral RNA; mRNA, or synthetic ssRNA.

(28) In one embodiment of the invention the strand of RNA is miRNA, siRNA or piRNA. Preferably the miRNA, siRNA or piRNA is from a biological sample taken from an animal (e.g. human) or plant. Preferably the strand of RNA is 21-36 nt in length. Preferably the strand of RNA has an unmodified 2′-OH group at 3′ terminal nucleotide.

(29) In another embodiment of the invention the strand of RNA is sRNA. Preferably the sRNA is from a biological sample taken from bacteria. Preferably the sRNA is 50-400 nt in length.

(30) In general, this method is suitable for ssRNAs from all organisms with the exception to the ones with 2′-O-modifications at their 3′ terminal nucleotides.

(31) Co-Factor

(32) The co-factor for use in the methods described herein is based on the molecule S-adenosyl-L-methionine (SAM or AdoMet) and is an S-adenosyl-L-methionine analog which comprises a functional group or a reporter group in an extended side-chain, which can be transferred onto the ssRNA by the enzyme described above.

(33) In particular, the AdoMet analog may have the following formula:

(34) ##STR00001##

(35) X1 and X2 represent —OH, —SH, —H or —F;

(36) X3 represents —O—, —NH—, —CH.sub.2—, —S—, or —Se—;

(37) X4, X5, X7, X8 represent —N—, or —CH—;

(38) X6 represents —NH.sub.2, —OH, —OCH.sub.3, —H, —F, —Cl, —SH or —NHCH.sub.3;

(39) X9 represents —CO.sub.2H, —PO.sub.3H, —H, —CHO, —CH.sub.3, or —CH.sub.2OH;

(40) X10 represents —NH.sub.2, —OH, —H, —CH.sub.3, or —NHCH.sub.3;

(41) X.sup.− is an organic or inorganic anion selected from trifluoroacetate, formate, halide and sulfonate;

(42) Z represents S or Se;

(43) C-bound H atoms in the adenosine moiety can be replaced by —F, —OH, —NH.sub.2, or —CH.sub.3;

(44) R is an extended side-chain comprising a functional group or a reporter group.

(45) Preferably R comprises a —CH═CH—, —C≡C— or —C(═O)— in a β-position to Z+ centre and is separated there from it by CR1R2-, where R1 and R2 are independently H or D.

(46) Suitable co-factors comprising functional groups and reporter groups are also described in WO 2006/108678.

(47) The use of a co-factor comprising a functional group or a reporter group allows for the labeling of ssRNA via two different strategies, Pathway B and Pathway C shown in FIG. 2. Pathway A (top) illustrates the natural RNA 2′-O-methyltransferase reaction—the methyl-group transfer from S-adenosyl-L-methionine towards single-stranded RNA (R=methyl). Pathway B (centre) describes a two-step RNA labeling strategy whereby a functional group (primary amine, thiol, alkine, azide, aziridine, carboxyl, aromatic hydrocarbon, etc.) embedded in the side chain of a synthetic AdoMet analog is transferred to the 3′-end of ssRNA and then the functional group is used to attach a desired reporter group in a second step. An alternative strategy C (bottom) depicts one-step labeling of RNA molecules by direct RNA 2′-O-methyltransferase-dependent transfer of a reporter group (e.g., biotin, fluorofores, etc.) embedded in the side chain R of a cofactor analog.

(48) Accordingly, where the co-factor comprises a functional group, this must be capable of being used to attach a desired reporter group in a second step. In this embodiment the method of the invention may comprise a further step of reacting the functional group attached to the ssRNA with a compound comprising a reactive group (or second functional group) attached to a reporter group under conditions which allow for the transfer of the reporter group onto the ssRNA.

(49) The functional group comprises a reactive group (group X) which may comprise an amino group, a thiol group, a hydrazine group, a hydroxylamine group, a 1,2-aminothiol group, an azide group, a diene group, an alkyne group, an arylhalide group, a terminal silylalkyne group, an N-hydroxysuccinimidyl ester group, a thioester group, an isothiocyanate group, an imidoester group, a maleimide group, a haloacetamide group, an aziridine group, an arylboronic acid group, an aldehyde group, a ketone group, a phosphane ester group, a dienophile group, or a terminal haloalkyne group.

(50) Group X can then be reacted with a compound comprising a second reactive group (group Y) which is attached to the reporter group. Suitable groups for X and Y, and the subsequent linkage which the reaction forms between the ssRNA and the reporter group are shown below in Table 1. Suitable reporter groups are a fluorophore, a quantum dot, an oligonucleotide, a DNA aptamer, a RNA aptamer, a ribozyme, DNA with specific protein targets or sequences for analysis (bar codes), an affinity tag, an antibody, a peptide, a protein, a glycan or a nanoparticle.

(51) TABLE-US-00002 TABLE 1 Mutually reactive functional groups X and Y suitable for conjugation Reactive group X or Y Reactive group Y or X Linkage formed Primary amine N-hydroxysuccinimidyl ester amide Primary amine thioester amide Primary amine isothiocyanate thioureas Primary amine imidoester imidate Primary amine aldehyde, ketone imine/secondary amine after reduction Thiol maleimide thioether Thiol haloacetamide thioether Thiol aziridine thioether Thiol thiol disulfide Hydrazine aldehyde, ketone hydrazone Hydroxylamine aldehyde, ketone oxime 1,2-Aminothiol aldehyde, ketone thiazolidine 1,2-Aminothiol thioester amide Azide alkyne 1,2,3-triazole Azide phosphane ester amide Diene dienophile cyclohexene Terminal alkyne arylhalide arylalkyne Arylhalide arylboronic acid biaryl Terminal silylalkyne terminal haloalkyne diyne

(52) The functional group of the co-factor may optionally be in protected form, such as a protected amino group, a protected thiol group, a protected hydrazine group, a protected hydroxyamino group, a protected aldehyde group, a protected ketone group and a protected 1,2-aminothiol group. As such, the reactive group X may be first transferred from the co-factor to the ssRNA in a protected form as a derivative that is converted to an active functional form in a separate step. For example, thiols may be transferred with acetyl protecting group (protected F1=—S—COCH.sub.3) which can be readily removed to yield thiol (F1=—SH) by treatment of modified DNA with 20% ammonia, or transferred 1,2-diol can be converted to aldehyde by oxidation with sodium periodate.

(53) Alternatively, in a one-step labeling procedure the extended side-chain R of the AdoMet analog comprises a reporter group. Suitable reporter groups include a fluorophore, a quantum dot, an affinity tag, an oligonucleotide primer, a DNA aptamer, an RNA aptamer, ribozymes, or DNA with specific protein targets or sequences for analysis (bar codes). The affinity tag may be biotin, maltose, c-myc-tag, HA-tag, digoxygenin, flag-tag, dinitrophenol, His tag, strep-tag, glutathione, or nickel-nitrilotriacetic acid (NTA).

(54) Analysis Methods

(55) As indicated above, methods of the present invention has particular utility in analysis of the small single-stranded RNAs in biological samples, including the determination of the types of small RNAs present in a particular sample, and the exploration and discovery of new species of small ssRNAs within the small RNAs transcriptome in biological samples. Accordingly, the method described above can further comprise steps of using the reporter groups or functional groups to enrich, to clone and/or to sequence the RNA strand, to detect or quantitate the small ssRNAs.

(56) In particular, the method of the present invention can be used in the analysis of single-stranded RNAs in a biological sample. Accordingly, all of the methods described herein may comprise a step of obtaining and/or preparing a biological sample. In particular, the biological sample can be individual cells, cultured cells, tissues (highly differentiated, fetal), biopsy, bodily fluids (e.g. blood, urine, tears, saliva), whole organisms (e.g. plants), bacterial strains or viruses. Methods of preparing such samples, so that they are suitable for analysis of the ssRNAs they contain, are known in the art.

(57) In a particular embodiment the method of the present invention is used to examine the small single-stranded RNA pool from a biological sample by the strategies shown in FIGS. 7 and 9: ssRNA 2′-O-methyltransferase-dependent alkylation to attach affinity reporter (e.g. biotin) for selective enrichment and cloning (FIG. 9, strategy A) or RNA 2′-O-methyltransferase-dependent alkylation to attach an oligonucleotide adapter for primed reverse transcription and sequencing (FIG. 7, strategy B).

(58) This method of strategy A can comprise the steps of: (a) labeling the 3′ end of ssRNA in the biological sample using the methods described above to attach an affinity group; (b) affinity binding and enrichment of the labeled ssRNA; and (c) cloning and sequencing of the enriched ssRNAs.

(59) The method of strategy B can comprise the steps of (a) attaching a functional group to the 3′ end of ssRNA in the biological sample using the methods described above; (b) reacting the functional group with a reactive group attached to an oligonucleotide under conditions that allow for the transfer of the oligonucleotide onto the 3′ end of the ssRNA; (c) sequencing the ssRNA using the oligonucleotide.

(60) To the extent that the ssRNA 2′-O-methyltransferase modifies only at 3′ terminal nucleotide 2′-OH group unmethylated ssRNAs, the results of (massive parallel) sequencing would be free of DNA contamination, enable the differentiation between modified and unmodified RNAs as well as among circular, single or double-stranded RNAs.

(61) The methods of the invention involve ssRNA 2′-O-methyltransferase dependent modification of RNA molecules, exceptionally, and their further use for enrichment, cloning and/or sequencing. As ssRNA specific modification can be fulfilled even in DNA containing samples, the amount of steps comprising ssRNA purification for analysis (e.g. DNA elimination) can be reduced. This leads to smaller losses of ssRNA sample as well as allows starting with smaller amounts of it. This approach can be particular beneficial for analysis of ssRNA in biological samples where its concentrations are exceptionally low, such as bodily fluids (Sterling et al., (2014) Nucleic Acids Res., epub July 23).

(62) The methods of the present invention encompasses analysis of the the modification status of the 3′ terminal nucleotide 2′-OH group in ssRNAs. As 2′-O-methylated RNA is a product of ssRNA 2′-O-methyltransferase modification reaction, it cannot be used as substrate. Such a method to specifically identify the 2′-O-unmethylated ssRNAs can be applied to pathology identification in animal (e.g. human) germline cells, where piRNAs are normally methylated, or plants, where all small ssRNAs appear to be modified under normal conditions (Lozsa eta la., (2008) Nucleic Acids Res. 36, 4099-4107). In these cases, the detection of unmethylated ssRNAs and their identification would serve both as an indicator of disease and a target for treatment.

(63) The methods of this invention can be applied for detection and analysis of a newly identified class of non-coding RNAs, circular RNAs (circRNAs) (Salzman et al., (2012) PLoS ONE 7, e30733). circRNAs are proposed to act as miRNA sponges in eukaryotes in this way controlling the amount of active miRNA molecules and, to higher extent, the physiology of whole organism (Kosik, (2013) Nature 495, 322-324). Up to date circRNAs are determined by comparing RNAse R and mock treated samples with the intent that in exonuclease treated samples only circRNAs should be left (Jeck et al., (2013) RNA 19, 141-157). The main drawbacks of this approach are the following: (1) considerable amount of material is needed for two different samples' preparation, (2) exonuclease in use is unable to eliminate lariat RNAs, which later hampers the analysis.

(64) Based on our invention the method for circRNA identification and analysis can be comprised of subsequent steps: a) removal and analysis of single-stranded RNAs: labeling of ssRNAs, including free 3′ ends containing lariat RNAs; affinity binding and enrichment of labeled RNAs; cloning and sequencing of enriched RNA strands; b) analysis of circRNAs left in the sample: linearization of circRNAs, their modification and sequencing.

(65) The method described, contrary to the currently applied ones, enables parallel analysis of single-stranded and circRNAs. In addition to this, it separates lariat RNAs and linear transcripts with scrambled exons from circRNAs facilitating true circular RNA identification.

(66) The present invention involving ssRNA 2′-O-methyltransferases' catalyzed modification of ssRNAs may be an adequate alternative to 3′ adapter ligation and to T4 RNA ligases, in particular. As sequencing methods are struggling with adapter ligation during RNA library preparation, this invention presents an alternative method for 3′ adapter attachment, in particular—2′-OH modification of a 3′ terminal nucleotide in RNA strand with a functional group followed by 3′ adapter addition using a click chemistry reaction (FIG. 7). This method circumvents inefficient, RNA sequence dependent and DNA as well as 2′-O-methylated RNA indiscriminatory 3′ adapter ligation step in RNA library preparation (Raabe et al., (2013) Nucleic Acids Res. 42, 1414-1426). Combined with techniques of CircLigase based approaches (Jackson et al., (2014) BMC Genomics 15) our method can fully liberate RNA library preparation from adapter ligation.

(67) As methods of the invention involve the modification of 3′ termini of ssRNAs they can be applied for precise determination of ssRNA sequence from 3′ end. 70% of human genes are characterized by alternative poliA sites which lead to different isoforms of transcripts with variable length and sequence of their 3′ untranslated regions (UTRs) (Xia et al., (2014) Nat Commun. 5, 5274). As 3′UTRs bear complementary sequence motifs for miRNAs, these sites are affected due to alternative polyadenilation (APA). As specific APA events are tumor specific, their identification holds potential for prognostic use. Using the methods of the invention miRNA detection and precise 3′ termini identification of mRNA can be combined to one powerful tool.

(68) Methods of the invention allow the detection of cellular small non-coding RNAs, whose expression level is affected in response to a treatment or environmental conditions.

(69) The detection of the attached reporter on the ssRNA can be achieved by the emission of fluorescence, or assays specific for the reporter group being used (e.g. avidin or streptavidin conjugated to peroxidase or alkaline phosphotase, antigens, aptamers, color-codes tiny beads—microsphere particles, beads etc).

(70) The present invention allows the development of tools for clinical diagnostics based on simultaneous quantitation of all types of ssRNAs.

(71) ssRNA 2′-O-methyltransferase-dependent RNA labeling allows developing a set of tools for research and clinical applications: analysis and detection in fluid systems, solid substrates, in situ, by confocal fluorescence microscopy, etc.

(72) Kit

(73) In a further aspect the present invention provides a kit for use in labeling a ssRNA comprising (a) a co-factor comprising a reporter group or a functional group; and (b) an ssRNA 2′-O-methyltransferase capable of transferring the reporter group or the functional group onto the ssRNA.

(74) Each element of the kit is in a separate container.

(75) The kit may optionally further comprise instructions for using the components of the kit in order to label a ssRNA. The instructions are provided on an appropriate medium, for example paper or an electronic data carrier.

(76) The description herein regarding the methods of the present invention also applies to the elements of the kit of the invention.

(77) The present invention will now be described in further detail, by way of example only, with reference to the following Examples and related Figures.

EXAMPLES

Example 1. Efficient Methylation of the 3′-Nucleotide of Short ssRNA

(78) The results of Example 1 are shown in FIGS. 3 and 4, which demonstrate metal ion dependency and reaction conditions permitting uniform modification of different 3′ terminal nucleotides of piRMT-dependent methylation of single-stranded RNA substrate (miR173.1 strand) resembling plant natural miRNA.

Example 2. piRMT-Dependent Alkylation and Labeling of ssRNA

(79) In FIGS. 5-7 it is demonstrated that piRMT-mediated coupling of side chains on single-stranded RNA is appropriate for two-step labeling through primary amine from Ado-6-amine. Experiments using 0.2 μM synthetic 22-80 nt long single-stranded RNA, radiolabeled with phosphorus-33 isotope, were performed for 30′ at 37° C. with 100 μM synthetic cofactor either in the presence of 2 μM piRMT or in the absence of protein (FIGS. 5 and 6). The samples were resolved on 13% denaturing polyacrylamide gel (with 7M urea).

(80) In FIG. 7 it was demonstrated, that piRMT generated RNA-6-azide can be attached to DNA-alkyne (B) and copy DNA can be transcribed from this RNA-DNA conjugate for RNA sequencing (C).

(81) In FIG. 9 the piRMT-dependent direct labeling of short RNA strands with Ado-biotin is highlighted