Methods and materials for detection of mutations
10988810 · 2021-04-27
Assignee
Inventors
Cpc classification
C12Q2525/121
CHEMISTRY; METALLURGY
C12Q2525/101
CHEMISTRY; METALLURGY
C12Q2525/203
CHEMISTRY; METALLURGY
C12Q2525/203
CHEMISTRY; METALLURGY
C12Q2525/101
CHEMISTRY; METALLURGY
C12Q2600/106
CHEMISTRY; METALLURGY
C12Q2525/121
CHEMISTRY; METALLURGY
C12N15/00
CHEMISTRY; METALLURGY
International classification
C12N15/00
CHEMISTRY; METALLURGY
Abstract
Provided herein are specially modified blocking nucleotides allowing for the sensitive detection of low copies of variant sequences, while significantly reducing signals from non-variant sequences that are similar but not identical to the variant sequence. These nucleotides can be used to detect rare variants in a sample mixture, as described in the present methods.
Claims
1. A method for detecting the presence of a more than one of a number of variant sequences in a target nucleic acid sequence comprising nucleotide(s) of interest (NOI), wherein said NOI may consist of said variant sequences, of other variant sequences or of a reference NOI sequence, said method comprising the steps of a) providing a sample comprising nucleic acids b) providing one blocking oligonucleotide comprising a sequence of in the range of 10 to 50 nucleotides (referred to as “blocking sequence”) into which in the range of 2 to 10 hydrophobic nucleotides have been inserted wherein at least one hydrophobic nucleotide is positioned at the 5′ end of said sequence or within 4 nucleotides from the 5′ end; and at least one hydrophobic nucleotide is positioned at the 3′ end of said sequence or within 4 nucleotides from the 3′ end; and wherein the hydrophobic nucleotide has the structure
X—Y-Q wherein X is a nucleotide or nucleotide analogue or a backbone monomer unit, Q is a intercalator which is not taking part in Watson-Crick hydrogen bonding; and Y is a linker moiety linking said nucleotide or nucleotide analogue or backbone monomer unit and said intercalator; and wherein the blocking sequence is identical to a consecutive stretch of the target nucleic acid sequence comprising the reference NOI sequence, c) providing sets of primers comprising at least two different primers including a first primer 1 and a primer 2, wherein the first primer 1 together with the primer 2 is capable of amplification of the target nucleic acid sequence comprising a first variant sequence, and wherein first primer 1 comprises a sequence of at least 15 nucleotides positioned at the 3′ end of said primer, which is identical to a consecutive stretch of the target nucleic acid sequence comprising said first variant sequence except for up to one mismatch, and a second primer 1 together with the primer 2 is capable of amplification of a target nucleic acid sequence comprising a second variant sequence, wherein said second primer 1 comprises a sequence of at least 15 nucleotides positioned at the 3′ end of said primer, which is identical to a consecutive stretch of the target nucleic acid sequence comprising said second variant sequence except for up to one mismatch; and wherein the sets of primers optionally comprise one or more further primer 1, which together with the primer 2 are capable of amplification of a target nucleic acid sequence comprising one or more further variant sequence(s), wherein said further primer 1(s) comprise a sequence of at least 15 nucleotides positioned at the 3′ end of said primer, which is identical to a consecutive stretch of the target nucleic acid sequence comprising said further variant sequence(s) except for up to one mismatch; d) performing a polymerase chain reaction in the presence of said sample, said blocking oligonucleotide; and said set of primers; e) detecting a product of said polymerase chain reaction, wherein the presence of a product of said polymerase chain reaction indicates the presence of a target nucleic acid sequence comprising the variant sequence in said sample.
2. The method according to claim 1, wherein the step of detecting said product comprises use of a detection probe.
3. The method according to claim 1, wherein the method comprises a kit comprising a) one blocking oligonucleotide consisting of a sequence of in the range of 10 to 50 nucleotides (referred to as “blocking sequence”) into which in the range of 2 to 10 hydrophobic nucleotides have been inserted, wherein at least one hydrophobic nucleotide is positioned at the 5′ end of said sequence or within 4 nucleotides from the 5′ end; and at least one hydrophobic nucleotide is positioned at the 3′ end of said sequence or within 4 nucleotides from the 3′ end; and Z is a hydrophobic nucleotide of the structure
X—Y-Q wherein X is a backbone monomer unit, Q is an intercalator, which is not taking part in Watson-Crick hydrogen bonding; and Y is a linker moiety linking said nucleotide or nucleotide analogue or backbone monomer unit and said intercalator; and wherein the blocking sequence is identical to a consecutive stretch of a target nucleic acid sequence comprising a reference NOI sequence; and sets of primers comprising at least two different primer 1 together with a primer 2, wherein a first primer 1 together with the primer 2 is capable of amplification of a target nucleic acid sequence comprising a first variant sequence, wherein said first primer 1 comprises a sequence of at least 15 nucleotides positioned at the 3′ end of said primer, which is identical to a consecutive stretch of the target nucleic acid sequence comprising said first variant sequence except for up to one mismatch, and a second primer 1 together with the primer 2 is capable of amplification of a target nucleic acid sequence comprising a second variant sequence, wherein said second primer 1 comprises a sequence of at least 15 nucleotides positioned at the 3′ end of said primer, which is identical to a consecutive stretch of the target nucleic acid sequence comprising said second variant sequence except for up to one mismatch; and wherein the sets of primers optionally comprise one or more further primer 1, which together with the primer 2 are capable of amplification of a target nucleic acid sequence comprising one or more further variant sequence(s), wherein said further primer 1 comprise a sequence of at least 15 nucleotides positioned at the 3′ end of said primer, which is identical to a consecutive stretch of the target nucleic acid sequence comprising said further variant sequence(s) except for up to one mismatch.
4. The method according to claim 1, wherein the primer 1 comprises a sequence which is identical to a consecutive sequence of the blocking sequence of at least 3 nucleotides except for up to one mismatch.
5. The method according to claim 4, wherein the sequence of the primer 1, which is identical to a consecutive sequence of the blocking sequence, is positioned immediately 5′ to the sequence identical to the variant sequence.
6. The method of claim 4, wherein the consecutive sequence of the blocking sequence is of at least 6 nucleotides except for up to one mismatch.
7. The method according to claim 1, wherein the 3′ nucleotide of primer 1 is identical to the variant sequence.
8. The method according to claim 1, wherein the variant sequence is a single nucleotide variant.
9. The method according to claim 1, wherein said mismatch is positioned at position 2, 3 or 4 from the 3′ end of primer 1.
10. The method according to claim 1, wherein primer 2 comprises a sequence of at least 15 nucleotides, which is complementary to a consecutive sequence of the target nucleic acid sequence.
11. The method according to claim 1, wherein the blocking oligonucleotide has the following structure
5′-(N).sub.a—Z—(N).sub.i—Z—(N).sub.j—Z—(N).sub.k—Z—(N).sub.l—Z—(N).sub.b-3′ wherein N is any nucleotide or nucleotide analogue; and Z is a hydrophobic nucleotide having the structure X—Y-Q wherein X is a nucleotide or nucleotide analogue or a backbone monomer unit, Q is a intercalator which is not taking part in Watson-Crick hydrogen bonding, and Y is a linker moiety linking said nucleotide or nucleotide analogue or backbone monomer unit and said intercalator; and a and b individually are integers in the range from 0 to 4; and j, k and l individually are integers in the range from 1 to 17; and a+b+i+j+k+l is at least 10 and at the most 50; and (N).sub.a—(N).sub.i—(N).sub.j—(N).sub.k—(N).sub.l(N).sub.b is identical to a stretch of the target nucleic acid sequence comprising a reference NOI sequence; or having the following structure
5′-(N).sub.a—Z—(N).sub.m—Z—(N).sub.n—Z—(N).sub.o—Z—(N).sub.p—Z—(N).sub.q—Z—(N).sub.b-3′ wherein N is any nucleotide or nucleotide analogue; and Z is a hydrophobic nucleotide having the structure X—Y-Q wherein X is a nucleotide or nucleotide analogue or a backbone monomer unit, Q is a intercalator which is not taking part in Watson-Crick hydrogen bonding, and Y is a linker moiety linking said nucleotide or nucleotide analogue or backbone monomer unit and said intercalator; and a and b individually are integers in the range of 0 to 4; and m, n, o, p and q individually are integers in the range of 1 to 16; and a+b+m+n+o+p+q is at least 10 and at the most 50; and (N).sub.a—(N).sub.m—(N).sub.n—(N).sub.o—(N).sub.p—Z—(N).sub.q—(N).sub.b is identical to a stretch of the target nucleic acid sequence comprising a reference NOI sequence.
12. The method according to claim 1, wherein at least one hydrophobic nucleotide comprises an intercalator which is pyrene or pyrido[3′,2′:4,5]thieno[3,2-d]pyrimidin-4(1H)-one or 7,9-dimethyl-pyrido[3′,2′,4,5]thieno[3,2-d]pyrimidin-4(3H)-one.
13. The method according to claim 1, wherein at least one backbone monomer unit X is selected from the group consisting of phosphoramidites.
14. A method of predicting the presence of a clinical condition in an individual in need thereof, wherein said clinical condition is associated with a target nucleic acid sequence comprising a variant sequence, said method comprising the steps of c. providing a sample from said individual d. performing the method according to claim 1 to determine the presence of said variant sequence; wherein the presence of said variant sequence is indicative of said individual suffering from said clinical condition.
15. The method according to claim 14, wherein the clinical condition is cancer.
16. A kit-of-parts comprising a) one blocking oligonucleotide consisting of a sequence of in the range of 10 to 50 nucleotides (referred to as “blocking sequence”) into which in the range of 2 to 10 hydrophobic nucleotides have been inserted, wherein at least one hydrophobic nucleotide is positioned at the 5′ end of said sequence or within 4 nucleotides from the 5′ end; and at least one hydrophobic nucleotide is positioned at the 3′ end of said sequence or within 4 nucleotides from the 3′ end; and Z is a hydrophobic nucleotide of the structure
X—Y-Q wherein X is a backbone monomer unit, Q is an intercalator, which is not taking part in Watson-Crick hydrogen bonding; and Y is a linker moiety linking said nucleotide or nucleotide analogue or backbone monomer unit and said intercalator; and wherein the blocking sequence is identical to a consecutive stretch of a target nucleic acid sequence comprising a reference nucleotide(s) of interest (NOI) sequence; and b) sets of primers comprising at least two different primer 1 together with a primer 2, wherein a first primer 1 together with the primer 2 is capable of amplification of a target nucleic acid sequence comprising a first variant sequence, wherein said first primer 1 comprises a sequence of at least 15 nucleotides positioned at the 3′ end of said primer, which is identical to a consecutive stretch of the target nucleic acid sequence comprising said first variant sequence except for up to one mismatch, and a second primer 1 together with the primer 2 is capable of amplification of a target nucleic acid sequence comprising a second variant sequence, wherein said second primer 1 comprises a sequence of at least 15 nucleotides positioned at the 3′ end of said primer, which is identical to a consecutive stretch of the target nucleic acid sequence comprising said second variant sequence except for up to one mismatch; and wherein the sets of primers optionally comprise one or more further primer 1, which together with the primer 2 are capable of amplification of a target nucleic acid sequence comprising one or more further variant sequence(s), wherein said further primer 1 comprise a sequence of at least 15 nucleotides positioned at the 3′ end of said primer, which is identical to a consecutive stretch of the target nucleic acid sequence comprising said further variant sequence(s) except for up to one mismatch.
17. The kit according to claim 16, wherein the kit furthermore comprises a detection probe.
18. The kit according to claim 16, wherein the kit comprises at least two different blocking oligonucleotides wherein at least one blocking oligonucleotide contains a blocking sequence identical to a consecutive stretch of a target nucleic acid sequence comprising a reference NOI sequence, and one or more blocking oligonucleotide(s) contain blocking sequence(s) identical to a consecutive stretch of a target nucleic acid sequence comprising other variant sequence(s), wherein said other variant sequences are different from the variant sequence identical to a stretch of primer 1.
19. A blocking oligonucleotide having the following structure
5′-(N).sub.a—Z—(N).sub.i—Z—(N).sub.j—Z—(N).sub.l—Z—(N).sub.l—Z—(N).sub.b-3′ wherein N is any nucleotide or nucleotide analogue; and Z is a hydrophobic nucleotide having the structure X—Y-Q wherein X is a nucleotide or nucleotide analogue or a backbone monomer unit, Q is a intercalator which is not taking part in Watson-Crick hydrogen bonding, and Y is a linker moiety linking said nucleotide or nucleotide analogue or backbone monomer unit and said intercalator; and a and b individually are integers in the range from 0 to 4; and j, k and l individually are integers in the range from 1 to 17; and a+b+i+j+k+l is at least 10 and at the most 50; and (N).sub.a—(N).sub.i—(N).sub.j—(N).sub.k—(N).sub.l—(N).sub.b is identical to a stretch of the target nucleic acid sequence comprising a reference nucleotide(s) of interest NOI sequence; or having the following structure
5′-(N).sub.a—Z—(N).sub.m—Z—(N).sub.n—Z—(N).sub.o—Z—(N).sub.p—Z—(N).sub.q—Z—(N).sub.b-3′ wherein N is any nucleotide or nucleotide analogue; and Z is a hydrophobic nucleotide having the structure X—Y-Q wherein X is a nucleotide or nucleotide analogue or a backbone monomer unit, Q is a intercalator which is not taking part in Watson-Crick hydrogen bonding, and Y is a linker moiety linking said nucleotide or nucleotide analogue or backbone monomer unit and said intercalator; and a and b individually are integers in the range of 0 to 4; and m, n, o, p and q individually are integers in the range of 1 to 16; and a+b+m+n+o+p+q is at least 10 and at the most 50; and (N).sub.a—(N).sub.m—(N).sub.n—(N).sub.o—(N).sub.p—Z—(N).sub.q—(N).sub.b is identical to a stretch of the target nucleic acid sequence comprising a reference NOI sequence.
20. A method of predicting the efficacy of treatment of a clinical condition in an individual in need thereof with a predetermined drug, wherein the efficacy of treatment of said clinical condition with said drug is associated with the presence of a variant sequence, said method comprising the steps of a. providing a sample from said individual b. performing the method according to claim 1 to determine the presence of said variant sequence; wherein the presence of said variant sequence is indicative of whether said drug is efficient in treating said clinical condition in said individual.
Description
DESCRIPTION OF DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
DETAILED DESCRIPTION OF INVENTION
Definitions
(11) The term “nucleotide” as used herein refers to naturally occuring nucleotides, for example naturally occurring ribonucleotides or deoxyribonucleotides or naturally occurring derivatives of ribonucleotides or deoxyribonucleotides. Naturally occurring nucleotides include deoxyribonucleotides comprising one of the four nucleobases adenine (A), thymine (T), guanine (G) or cytosine (C), and ribonucleotides comprising one of the four nucleobases adenine (A), uracil (U), guanine (G) or cytosine (C).
(12) The term “nucleotide analogue” comprises all nucleotide analogues capable of being incorporated into a nucleic acid backbone and capable of specific base-pairing, essentially like naturally occurring nucleotides. Nucleotide analogues according to the present invention include, but are not limited to the nucleotide analogues selected from the group consisting of PNA, HNA, MNA, ANA, LNA, INA, CNA, CeNA, TNA, (2′-NH)-TNA, (3′-NH)-TNA, α-L-Ribo-LNA, α-L-Xylo-LNA, β-D-Xylo-LNA, α-D-Ribo-LNA, [3.2.1]-LNA, Bicyclo-DNA, 6-Amino-Bicyclo-DNA, 5-epi-Bicyclo-DNA, α-Bicyclo-DNA, Tricyclo-DNA, Bicyclo[4.3.0]-DNA, Bicyclo[3.2.1]-DNA, Bicyclo[4.3.0]amide-DNA, β-D-Ribopyranosyl-NA, α-L-Lyxopyranosyl-NA, 2′-R.sub.1-RNA, 2′-OR.sub.1-RNA (R.sub.1 being a substituent), α-L-RNA, α-D-RNA, and β-D-RNA.
(13) The term “hydrophobic nucleotide” as used herein refers to the hydrophobic nucleotides described in detail herein below in the section “hydrophobic nucleotide”. In particular, a hydrophobic nucleotide according to the invention contains an intercalator connected to a nucleotide/nucleotide analogue/backbone monomer unit via a linker.
(14) The term “melting temperature” as used herein denotes the temperature in degrees centigrade at which 50% helical (hybridised) versus coil (unhybridised) forms are present. Melting temperature may also be referred to as (T.sub.m). Melting of nucleic acids and nucleic acid analogues refers to thermal separation of the two strands of a double-stranded nucleic acid molecule.
(15) The term “oligonucleotide” as used herein refers to oligomers of nucleotides and/or nucleotide analogous and/or hydrophobic nucleotides. Preferably, and oligonucleotide is an oligomer of nucleotides optionally comprising one or more hydrophobic nucleotides.
(16) The term “target nucleic acid sequence” as used herein refers to a nucleic acid sequence comprising the nucleotide(s) of interest (NOI). The target nucleic acid sequence can be amplified using a set of primers.
(17) The term “nucleotide(s) of interest” as used herein refers to nucleotide(s) within a target nucleic acid sequence, which may be present in two different variants. “Nucleotide(s) of interest” may also be referred to as “NOI” herein. Thus, the NOI may consist of a variant sequence or it may consist of a reference NOI sequence, also referred to as the “reference NOI sequence” herein. In some embodiments, the reference NOI sequence may be a wild type sequence.
(18) The term “reference target sequence” refers to a stretch of the target nucleic acid sequence comprising the reference NOI sequence. In general, the reference target sequence is identical to the blocking sequence.
(19) The term “variant sequence” as used herein refers to nucleotide(s) within a target nucleic acid sequence, which are different to a reference NOI sequence. Thus, the target nucleic acid sequence may contain a NOI, which is the variant sequence or the target nucleic acid sequence may contain NOI, which is the reference NOI sequence or the NOI may even be yet another variant sequence. The variant sequence may for example be a mutation, such as a single nucleotide mutation or it may be an insertion or deletion.
(20) Methods for Detecting a Variant Sequence in a Target Nucleic Acid Sequence
(21) The invention relates to methods for detection of a variant sequence in a target nucleic acid sequence. Thus, the methods are in particular useful for detecting the presence of a particular sequence in a target nucleic acid sequence, which may occur with two or more different sequences. Thus, the methods can for example be used for distinguishing between a wild type and a mutant sequence. The methods may also be useful for distinguishing between different polymorphic sequences.
(22) Thus, when two or more different target nucleic acid sequences exist, the methods are useful for distinguishing between at least two different target nucleic acid sequences, i.e. the target nucleic acid sequence comprising the variant sequence, and the target nucleic acid sequence not comprising the variant sequence—the latter also being referred to as “reference NOI sequence” and optionally also between target nucleic acid sequences comprising other variant sequences.
(23) In embodiments of the invention where the methods are used for distinguishing between a wild type and a mutant sequence, the mutant sequence may be the reference NOI sequence. However, frequently, the wild type sequence will be the reference NOI sequence. The methods of the invention may also be used for distinguishing between a wild type and several different mutant sequences, in which case the wild type sequence typically will be the reference NOI sequence and the several different mutant sequences will be variant sequences.
(24) The variant sequence may in some embodiments be a mutation indicative of a disease state or it may be predictive for the efficacy of a given treatment.
(25) The methods of the invention may in particular comprise the steps of: a) Providing a sample comprising nucleic acids, which may be any of the samples described herein below in the section “Sample”; b) Providing a blocking oligonucleotide, which may be any of blocking oligonucleotides described herein below in the section “Blocking oligonucleotide” c) Providing a set of primers consisting of primer 1 and primer 2, wherein said primers may be any of the primers described herein below in the section “Set of primers”; d) performing a polymerase chain reaction in the presence of said sample, said blocking oligonucleotide; said set of primers and PCR reagents, which may be any of the reagents described herein below in the section “PCR reagents”; e) detecting a product of said polymerase chain reaction, wherein the presence of a product of said polymerase chain reaction indicates the presence of a target nucleic acid sequence comprising the variant sequence in said sample.
(26) The blocking oligonucleotide is identical to the reference target sequence except that it contains at least 2 hydrophobic nucleotides inserted as bulge insertions. Because the blocking oligonucleotide is identical to the reference target sequence and contains the hydrophobic nucleotides, the blocking oligonucleotide will have a very high affinity for the complementary reference target sequence. Because the blocking oligonucleotide is not completely identical to the target nucleic acid sequence comprising the variant sequence, the blocking oligonucleotide will not bind the complementary target nucleic acid sequence comprising the variant sequence with similar high affinity. However, primer 1, which contains a sequence almost completely identical to a stretch of the target nucleic acid sequence containing the variant, will bind the complementary sequence with high affinity.
(27) When performing a PCR with the set of primers, the blocking oligonucleotide will block or significantly impair amplification of the target nucleic acid sequence comprising the reference NOI sequence. However, the blocking oligonucleotide will not block or significantly impair amplification of the target nucleic acid sequence comprising the variant sequence. Thus, if a PCR product is generated by PCR with a predefined set of parameters, then the sample contained the variant sequence, whereas if no PCR product is generated by PCR with the predefined set of parameters, then the sample did not comprise the variant sequence. Similarly, if significantly less PCR product is generated compared to a control comprising the variant sequence, this may also be indicative of the sample not comprising the variant sequence. “Significantly less” may in this regard mean less than 50%, such as less less than 25%, for example less than 10%, such as less than 5%.
(28) It is also within the scope of the invention to determine whether a PCR product is generated by the following method: a) performing a PCR wherein generation of a PCR product may be followed in real time b) determining the number of PCR cycles performed before a predetermined signal is achieved, wherein said number of PCR cycles are referred to as C.sub.T c) wherein a C.sub.T below a predetermined number is indicative of generation of a PCR product.
(29) Thus, conversely, a C.sub.T above said number may be considered as no presence of a PCR product. The predetermined number could be the C.sub.T value of one PCR reaction relative to the C.sub.T value of another (called ΔC.sub.T), so that a ΔC.sub.T below a set threshold is indicative of the presence of a variant sequence, whereas a ΔC.sub.T above a set threshold is indicative of the absence of a variant sequence.
(30) In addition to providing the blocking oligonucleotide with a high affinity for the complementary reference target sequence, the presence of the hydrophobic nucleotides also confers resistance to exonucleases. Thus, if a nucleic acid polymerase having exonuclease activity is used for PCR amplification, this will not degrade the blocking oligonucleotide. Furthermore the presence of the hydrophobic nucleotides ensures that the blocking oligonucleotide does not function well as a primer.
(31) Whether or not a PCR product is generated may be determined in any conventional manner, for example as described herein below in the section “Detection”. For example, generation of a PCR product may be followed in real time with the aid of a detection probe.
(32) In one embodiment the methods of invention involves providing one blocking oligonucleotide and one set of primers. However, as described herein the methods may also comprise providing more than one different blocking oligonucleotides and/or more than one different set of primers and/or more than one different primer 1.
(33) Thus, in one embodiment the invention relates to methods for detecting the presence of one specific variant sequence in a target nucleic acid sequence comprising nucleotide(s) of interest (NOI), wherein said NOI may consist of said variant sequence, other variant sequences or of a reference NOI sequence, said method comprising the steps of a) Providing a sample comprising nucleic acids b) Providing at least two different blocking oligonucleotides as defined herein, wherein at least one blocking oligonucleotide contains a blocking sequence identical to a consecutive stretch of the target nucleic acid sequence comprising the reference NOI sequence, and one or more blocking oligonucleotide(s) contain blocking sequence(s) identical to a consecutive stretch of the target nucleic acid sequence comprising said other variant sequence(s), c) Providing a set of primers consisting of primer 1 and primer 2, wherein the set of primers together are capable of amplification of the target nucleic acid sequence comprising the variant sequence, and wherein primer 1 comprises a sequence of at least 15 nucleotides positioned at the 3′ end of said primer, which is identical to a consecutive stretch of the target nucleic acid sequence comprising the variant sequence expect for up to one mismatch; d) performing a polymerase chain reaction in the presence of said sample, said blocking oligonucleotides; said set of primers and PCR reagents; e) detecting a product of said polymerase chain reaction, wherein the presence of a product of said polymerase chain reaction indicates the presence of a target nucleic acid sequence comprising the variant sequence in said sample.
(34) Such a method may be useful for detection of the presence of one specific variant sequence in a sample, which potentially may comprise a reference NOI sequence as well as one or more “other variant sequences”. For example, if the NOI may be present as a plurality of different variant sequences, such a method may be useful for detecting the presence of one specific variant sequence.
(35) In another embodiment the invention relates to methods for detecting the presence of a plurality of variant sequence(s) in a target nucleic acid sequence comprising nucleotide(s) of interest (NOI), wherein said NOI may consist of said plurality of variant sequences or of a reference NOI sequence, said method comprising the steps of a) Providing a sample comprising nucleic acids b) Providing a blocking oligonucleotide as defined herein, wherein said blocking oligonucleotide contains a blocking sequence identical to a consecutive stretch of the target nucleic acid sequence comprising the reference NOI sequence, c) Providing sets of primers comprising at least two different primer 1s and a primer 2, wherein a first primer 1 together with a primer 2 is capable of amplification of the target nucleic acid sequence comprising a first variant sequence, wherein said first primer 1 comprises a sequence of at least 15 nucleotides positioned at the 3′ end of said primer, which is identical to a consecutive stretch of the target nucleic acid sequence comprising said first variant sequence expect for up to one mismatch, and a second primer 1 together with a primer 2 is capable of amplification of the target nucleic acid sequence comprising a second variant sequence, wherein said second primer 1 comprises a sequence of at least 15 nucleotides positioned at the 3′ end of said primer, which is identical to a consecutive stretch of the target nucleic acid sequence comprising said second variant sequence expect for up to one mismatch; and optionally one or more further primer 1 together with a primer 2 are capable of amplification of the target nucleic acid sequence comprising one or more further variant sequence(s), wherein said further primer 1(s) comprise a sequence of at least 15 nucleotides positioned at the 3′ end of said primer, which is identical to a consecutive stretch of the target nucleic acid sequence comprising said further variant sequence(s) expect for up to one mismatch; d) performing a polymerase chain reaction in the presence of said sample, said blocking oligonucleotide; said sets of primers and PCR reagents; e) detecting a product of said polymerase chain reaction, wherein the presence of a product of said polymerase chain reaction indicates the presence of a target nucleic acid sequence comprising the variant sequence in said sample.
(36) The sets of primers may comprise only one kind of primer 2, but may also comprise a plurality of different primer 2s, which together with the various primer 1s are capable of amplification of the target nucleic acid sequence.
(37) Such methods may in particular be useful for detecting the presence of at least one of a plurality of variant sequences. For example, if the NOI may be present as a plurality of different variant sequences, such a method may be useful for detecting the presence of at least one of these variant sequences. Frequently such methods do not allow to distinguish one variant sequence from another, but allows distinguishing between the reference NOI sequence and a plurality of variant sequences. This may for example be useful if the presence of any of a plurality of variant sequences may be indicative of a clinical condition or susceptibility to a given treatment regime.
(38) A Kit-of-Parts
(39) The invention also relates to a kit-of-parts a) a blocking oligonucleotide, which may be any of the blocking oligonucleotides described herein below in the section “Blocking oligonucleotide” b) a set of primers consisting of primer 1 and primer 2, which may be any of the sets of primers described herein below in the section “Set of primers”
(40) The kit-of-parts is in particular useful for performing the methods according to the invention.
(41) In addition to said blocking oligonucleotide and said set of primers, the kit-of-parts may also comprise additional components. For example, the kit-of-parts may further comprise PCR reagents, such as any of the PCR reagents described herein below in the section “PCR reagents”. The kit-of-parts may also comprise a detection probe, such as any of the detection probes described herein below in the section “Detection”. The detection probe may in particular be a probe allowing for real time detection of the generation of a PCR product.
(42) Blocking Oligonucleotide
(43) The methods of the invention comprise the use of a blocking oligonucleotide. The kit-of-parts of the invention comprise a blocking oligonucleotide and in some embodiments the invention relates to a blocking oligonucleotide. Useful blocking oligonucleotides are described in this section.
(44) In general, the blocking oligonucleotides useful for the present invention comprise a sequence of 10 to 50 nucleotides (referred to as “blocking sequence”) into which 2 to 10 hydrophobic nucleotides have been inserted, wherein at least one hydrophobic nucleotide is positioned at the 5′ end of said sequence or within 4 nucleotides from the 5′ end; and at least one hydrophobic nucleotide is positioned at the 3′ end of said sequence or within 4 nucleotides from the 3′ end; and wherein the hydrophobic nucleotide is any of the hydrophobic nucleotides described herein below in the section “Hydrophobic nucleotide”; and wherein the blocking sequence is identical to a stretch of the target nucleic acid sequence comprising the reference NOI sequence.
(45) Typically, the internal hydrophobic nucleotides are inserted into the blocking oligonucleotide as bulge insertions. This means that when the blocking oligonucleotide is hybridizing with the reference target sequence, then the two nucleotides positioned on either side of a hydrophobic nucleotide are hybridized to two neighboring nucleotides in the reference target sequence. Preferably, all internal hydrophobic nucleotides are positioned as bulk insertions. Accordingly, the blocking sequence is generally made up of all the nucleotides within the blocking oligonucleotide, which are not hydrophobic nucleotides. In addition, one or two hydrophobic nucleotides may be positioned at the end of the blocking oligonucleotide.
(46) The blocking sequence may for example consist of in the range of 10 to 30 nucleotides, such as in the range of 15 to 25 nucleotides, for example in the range of 10 to 20 nucleotides identical to the reference target sequence.
(47) Since the blocking oligonucleotide is identical to the reference target sequence, then the blocking oligonucleotide contains a sequence which is identical to the reference NOI sequence. This sequence is referred to as reference NOI sequence in the following regardless of whether it is contained in the blocking sequence or in the target nucleic acid sequence.
(48) In one embodiment, the reference NOI sequence is positioned roughly in the middle of the blocking oligonucleotide. Thus, it may be preferred that the blocking oligonucleotide comprise at least 6 nucleotides positioned 5′ of the reference NOI sequence. It may also be preferred that the blocking oligonucleotide comprise at least 6 nucleotides positioned 3′ of the reference NOI sequence.
(49) In one embodiment of the invention, the blocking oligonucleotide has the following general structure (I):
5′-(N).sub.a—Z-SEQ.sub.1-Z—(N).sub.b-3′ wherein N is any nucleotide or nucleotide analogue; and Z is any of the hydrophobic nucleotides described herein below in the section “hydrophobic nucleotide”; and SEQ.sub.1 is a sequence of 4 to 20 nucleotides or nucleotide analogues into which up to 4 hydrophobic nucleotides (Z) may be inserted; and a and b individually are an integer in the range of 0 to 4; and the total number of nucleotides is at least 10; and (N).sub.a-SEQ.sub.1-(N).sub.b is identical to the reference target sequence.
(50) In particular, SEQ.sub.1 may be a sequence identical to a stretch of the target nucleic acid sequence comprising the reference NOI sequence.
(51) In one embodiment, the blocking oligonucleotide has the following general structure (II)
5′-(N).sub.a—Z—(N).sub.c—Z—(N).sub.b-3′ wherein N is any nucleotide or nucleotide analogue; and Z is a hydrophobic nucleotide as defined in claim 1; and a and b individually are integers in the range of 0 to 4; and c is an integer in the range of 4 to 20; and a+b+c is at least 10; and (N).sub.a—(N).sub.c—(N).sub.b is identical to the reference target sequence.
(52) (N).sub.c may in one embodiment contain the sequence identical to the reference NOI sequence.
(53) In one embodiment, the blocking nucleotide may be a blocking nucleotide of structure (II), wherein a+b+c may be in the range of 10 to 50, preferably in the range of 10 to 20. For example a may be 0 or 1, b may be 0 or 1 and c may an integer in the range of 8 to 20. For example, a may be 0, b may be 1 and c may be an integer in the range of 9 to 19.
(54) In one embodiment of the invention, the blocking oligonucleotide may have the following general structure (III)
5′-(N).sub.a—Z—(N).sub.d—(N).sub.e—Z—(N).sub.b-3′ wherein N is any nucleotide or nucleotide analogue; and Z is a hydrophobic nucleotide as defined in claim 1; and the total number of nucleotides or nucleotide analogues is at least 10; and a and b individually are integers in the range of 0 to 4; and d and e individually are integers in the range of 1 to 19; and a+b+d+e at least 10; and (N).sub.a—(N).sub.d—(N).sub.e—(N).sub.b is identical to the reference target sequence.
(55) (N).sub.d may in one embodiment contain the sequence identical to the reference NOI sequence. In other embodiments, (N).sub.e may contain the sequence identical to the reference NOI sequence.
(56) In one embodiment, the blocking nucleotide may be a blocking nucleotide of structure (III), wherein a+b+d+e is in the range of 10 to 50, preferably in the range of 10 to 20. For example, a may be 0 or 1, b may be 0 or 1, d may be an integer in the range of 4 to 10 and e may be an integer in the range of 4 to 10. For example, a may be 0, b may be 1, d may be an integer in the range of 4 to 10, and e is an integer in the range of 4 to 10. In addition it may be preferred that d and e are roughly the same size, thus d may be the same integer as e+/−2, for example d may be the same integer as e+/−1, for example d may be the same integer as e.
(57) In one embodiment, the blocking oligonucleotide may have the following general structure (IV):
5′-(N).sub.a—Z—(N).sub.f—Z—(N).sub.g—Z—(N).sub.h—Z—(N).sub.b-3′ wherein N is any nucleotide or nucleotide analogue; and Z is a hydrophobic nucleotide as defined in claim 1; and a and b individually are integers in the range of 0 to 4; and f, g and h individually are integers in the range of 1 to 18; and a+b+f+g+h is at least 10 and at the most 50; and (N).sub.a—(N).sub.f—(N).sub.g—(N).sub.h—(N).sub.b is identical to a reference target sequence.
(58) (N).sub.f may in one embodiment contain the sequence identical to the reference NOI sequence. In other embodiments, (N).sub.h may contain the sequence identical to the reference NOI sequence. Preferably, however, (N).sub.g may contain the sequence identical to the reference NOI sequence.
(59) In one embodiment, the blocking nucleotide may be a blocking nucleotide of structure (IV), wherein a+b+f+g+h may be in the range of 10 to 50, preferably in the range of 10 to 20. For example, a may be 0 or 1, b may be 0 or 1, f may be an integer in the range of 3 to 7, g may be an integer in the range of 3 to 7 and h may be an integer in the range of 3 to 7. For example, a may be 0, b may be 1, f may be an integer in the range of 3 to 7, g may be an integer in the range of 3 to 7 and h may be an integer in the range of 3 to 7.
(60) In addition, it may be preferred that f, g and h are roughly the same size, thus f and g may be the same integer as h+/−2, for example f and g may be the same integer as h+/−1, for example f and g may be the same integer as h.
(61) A blocking oligonucleotide having the following general structure (V)
5′-(N).sub.a—Z—(N).sub.i—Z—(N).sub.j—Z—(N).sub.k—Z—(N).sub.l—Z—(N).sub.b-3′ wherein N is any nucleotide or nucleotide analogue; and Z is a hydrophobic nucleotide as defined in claim 1; and a and b individually are integers in the range from 0 to 4; and j, k and l individually are integers in the range from 1 to 17; and a+b+i+j+k+l is at least 10 and at the most 50; and (N).sub.a—(N).sub.i—(N).sub.j—(N).sub.k—(N).sub.l—(N).sub.b is identical to a reference target sequence.
(62) (N).sub.j oder (N).sub.l may in one embodiment contain the sequence identical to the reference NOI sequence. Preferably however (N).sub.j oder (N).sub.k may contain the sequence identical to the reference NOI sequence.
(63) In one embodiment, the blocking nucleotide may be a blocking nucleotide of structure (V), wherein a+b+i+j+k+l may be in the range of 10 to 50, preferably in the range of 10 to 20. For example, a may be 0 or 1, b may be 0 or 1, i may be an integer in the range of 2 to 5, j may be an integer in the range of 2 to 5, k may be an integer in the range of 2 to 5 and l may be an integer in the range of 2 to 5. For example, a may be 0, b may be 1, i may be an integer in the range of 2 to 5, j may be an integer in the range of 2 to 5, k may be an integer in the range of 2 to 5 and l may be an integer in the range of 2 to 5.
(64) In addition, it may be preferred that i, j, k and l are roughly the same size, thus i, j and k may be the same integer as l+/−2, for example i, j and k may be the same integer as l+/−1, for example i, j and k may be the same integer as l.
(65) In one embodiment, the blocking oligonucleotide may have the following general structure (VI)
5′-(N).sub.a—Z—(N).sub.m—Z—(N).sub.n—Z—(N).sub.o—Z—(N).sub.p—Z—(N).sub.q—Z—(N).sub.b-3′ wherein N is any nucleotide or nucleotide analogue; and Z is a hydrophobic nucleotide as defined in claim 1; and a and b individually are integers in the range of 0 to 4; and m, n, o, p and q individually are integers in the range of 1 to 16; and a+b+m+n+o+p+q is at least 10 and at the most 50; and (N).sub.a—(N).sub.m—(N).sub.n—(N).sub.o—(N).sub.p—Z—(N).sub.q—(N).sub.b is identical to a reference target sequence.
(66) (N).sub.m, (N).sub.n, (N).sub.p or (N).sub.q may in one embodiment contain the sequence identical to the reference NOI sequence. Preferably, however, (N).sub.o may contain the sequence identical to the reference NOI sequence.
(67) In one embodiment, the blocking nucleotide may be a blocking nucleotide of structure (VI), wherein a+b+m+n+o+p+q may be in the range of 10 to 50, preferably in the range of 10 to 20. For example, a may be 0 or 1, b may be 0 or 1, m may be an integer in the range of 2 to 4, n may be an integer in the range of 2 to 4, o may be an integer in the range of 2 to 4, p may be an integer in the range of 2 to 4 and q may be an integer in the range of 2 to 4. For example, a may be 0, b may be 1, m may be an integer in the range of 2 to 4, n may be an integer in the range of 2 to 4, o may be an integer in the range of 2 to 4, p may be an integer in the range of 2 to 4 and q may be an integer in the range of 2 to 4.
(68) In addition, it may be preferred that m, n, o, p and q are roughly the same size, thus m, n, o and p may be the same integer as q+/−1, for example m, n, o and p may be the same integer as q.
(69) In relation to blocking oligonucleotides of structures (I), (II), (III), (IV, (V) or (VI) a may be an integer in the range of 0 to 3, for example in the range of 0 to 2, preferably a is an integer in the range of 0 to 1. In particular a may be 0.
(70) In relation to blocking oligonucleotides of structures (I), (II), (III), (IV, (V) or (VI) b may be an integer in the range of 0 to 3, for example in the range of 0 to 2, preferably b may be 0 or b may be 1.
(71) Set of Primers
(72) The methods of the invention involve use of a set of primers and the kit-of-parts according to the invention comprise a set of primers.
(73) The set of primers consists of primer 1 and primer 2, wherein the set of primers together are capable of priming amplification of a target nucleic acid sequence comprising a variant sequence. A pair of primer 1 and primer 2 is capable of priming amplification of said target nucleic acid sequence if said primers are used in a PCR reaction in the presence of said target nucleic acid sequence and FOR reagents.
(74) One of the primers can be considered the forward primer, whereas the other primer can be considered the reverse primer when used in a PCR reaction.
(75) In order to render the set of primers specific for the target nucleic acid sequence comprising the variant sequence, then primer 1 comprises a sequence, which is identical to a stretch of the target nucleic acid sequence comprising the variant sequence.
(76) In order to provide distinction between the variant sequence and the reference NOI sequence, primer 1 in general comprise a sequence identical to the variant sequence. In particular the 3′ end of primer 1 may comprise a sequence of at least 15 nucleotides, which is identical to a stretch of the target nucleic acid sequence comprising the variant sequence except for up to one mismatch.
(77) The exact length of the sequence of primer 1 identical to a stretch of the target nucleic acid sequence may be adjusted in order to arrive at a primer having a melting temperature useful for PCR amplification. The melting temperature of a primer is dependent on several factors, but in particular on the GC content and the length. Because primer 1 should be identical to a stretch of the target nucleic acid sequence comprising the variant sequence (see more details below) there are restrictions to the specific sequence of the primer. Accordingly, the melting temperature may in particular be adjusted by adjusting the length of the primer. The skilled person is well capable of designing a primer with a suitable melting temperature and useful software to this end is publicly available.
(78) Thus, the 3′ end of primer 1 may comprise a sequence of at least 15 nucleotides, for example at least 20 nucleotides, such as at least 25 nucleotides, for example in the range of 15 to 50 nucleotides, such as in the range of 20 to 40 nucleotides, which is identical to the target nucleic acid sequence comprising the variant sequence except for up to one mismatch.
(79) In one embodiment of the invention, primer 1 consists of a sequence of at least 15 nucleotides, for example at least 20 nucleotides, such as at least 25 nucleotides, for example in the range of 15 to 50 nucleotides, such as in the range of 20 to 40 nucleotides, which is identical to the target nucleic acid sequence comprising the variant sequence except for up to one mismatch.
(80) As mentioned above the sequence of primer 1 comprises or consists of a sequence identical to the target nucleic acid sequence comprising the variant sequence except for up to one mismatch. In some embodiments, it is preferred that there is one mismatch, as this may even further improve the specificity of the assay. In particular said mismatch may be positioned at position 2, 3 or 4 from the 3′ end of primer 1.
(81) In order to provide the best distinction between the variant sequence and the reference target sequence, it is preferred that the most 3′ nucleotide(s) of primer 1 are identical to the variant sequence. Thus, in such an embodiment the most 3′ nucleotide(s) of primer 1 are different to the reference NOI sequence. In this way, even if the primer 1 should hybridise to the reference target sequence, then the very 3′ end of primer 1 will not hybridise and thus the primer 1 will not serve as a good primer to PCR amplification of a sequence comprising the reference NOI sequence.
(82) The sequence of primer 1 may be designed according to the nature of the variant sequence. In one preferred embodiment of the invention, the variant sequence is a single nucleotide variant. Thus, the difference between the target nucleic acid sequence comprising the variant sequence and the reference target sequence is only 1 nucleotide. For the sake of simplicity this nucleotide is referred to as single nucleotide variant in the following.
(83) It is preferred that the primer 1 comprises a sequence identical to said single nucleotide variant and to the sequences positioned immediately 5′ of said single nucleotide variant in the target nucleic acid sequence comprising the variant sequence except for up to one mismatch.
(84) It is preferred that the primer 1 comprises a sequence identical to said single nucleotide variant and to the sequences positioned immediately 5′ of said single nucleotide variant in the target nucleic acid sequence except for up to one mismatch. Thus, primer 1 may comprise or consist of a sequence of at least 15 nucleotides, for example at least 20 nucleotides, such as at least 25 nucleotides, for example in the range of 15 to 50 nucleotides, such as in the range of 20 to 40 nucleotides, which is identical to the single nucleotide variant and the target nucleic acid sequence positioned immediately 5′ of the single nucleotide variant in the target nucleic acid sequence, except for up to one mismatch.
(85) In one embodiment of the invention, the variant sequence consists of more than one consecutive variant nucleotides. Thus, the difference between the target nucleic acid sequence comprising the variant sequence and the reference target sequence is a stretch of more than one consecutive nucleotides.
(86) In such embodiments, the most 3′ nucleotides of primer 1 may be identical to the variant nucleotides.
(87) In one embodiment of the invention, the variant sequence consists of an insertion of one or more nucleotides. Thus, the difference between the target nucleic acid sequence comprising the variant sequence and the reference target sequence is the target nucleic acid sequence comprising the variant sequence comprises a stretch of one or more nucleotides not present in the reference target sequence.
(88) In such embodiments, the most 3′ nucleotides of primer 1 may be identical to at least the nucleotide(s) positioned at 5′ end of the insertion. If the insertion is only a few nucleotides, then the most 3′ nucleotides of primer 1 may be identical to all the inserted nucleotides. This may for example be the case when the insertion is insertion of 5 or fewer nucleotides.
(89) In one embodiment of the invention, the variant sequence consists of a deletion of one or more nucleotides. Thus, the difference between the target nucleic acid sequence comprising the variant sequence and the reference target sequence is that the reference target sequence comprises a stretch of one or more nucleotides not present in the target nucleic acid sequence comprising the variant sequence.
(90) In such embodiments, the most 3′ nucleotides of primer 1 may be identical to at least one nucleotide positioned immediately 3′ of the deletion in the target nucleic acid sequence.
(91) In addition, in order to provide good distinction between the target nucleic acid sequence comprising the reference NOI sequence or the variant sequence, then primer 1 may in preferred embodiments contain a consecutive sequence identical to a consecutive sequence of the blocking oligonucleotide. In that way primer 1 binding to the reference target sequence may be further inhibited, because the blocking oligonucleotide will occupy the part of the reference target sequence to which primer 1 potentially could bind. Thus, primer 1 may comprises a sequence which is identical to a consecutive sequence of the blocking sequence of at least 3 nucleotides, preferably of at least 6 nucleotides except for up to one mismatch.
(92) The sequence of primer 1, which is identical to a consecutive sequence of the blocking sequence except for the up to one mismatch may be positioned at any useful position within primer 1, but typically it is positioned immediately 5′ to the sequence identical to the variant sequence.
(93) Primer 2 may be any primer, which together with primer 1 is capable of priming amplification of the target nucleic acid sequence comprising the variant sequence. Thus, there is more freedom for the skilled person to design primer 2. The skilled person will be well able to design primers with an adequate melting temperature, normally a melting temperature similar to the melting temperature of primer 1. Furthermore, primer 2 must comprise or even consist of a sequence of at least 15 nucleotides, which is complementary to a consecutive sequence of the target nucleic acid sequence. Primer 2 may for example comprise or even consist of a sequence of at least 20 nucleotides, such as at least 25 nucleotides, for example in the range of 15 to 50 nucleotides, such as in the range of 20 to 40 nucleotides, which is complementary to a consecutive sequence of the target nucleic acid sequence.
(94) Specific examples of useful ways of designing the blocking oligonucleotide and primer 1 are described herein in Example 1 and illustrated in
(95) Variant Sequence
(96) The variant sequence may be any sequence, which differs between two sequences. Frequently, the variant sequence is a mutant sequence, e.g. a sequence which differs from the wild type sequence. The variant sequence can however also be a polymorphic sequence or any other sequence which differs from a reference NOI sequence.
(97) The variant sequence may consist of at least one, such as 1, for example 2, such as 3, for example 4, such as 5, for example 6, such as 7, for example 8, such as 9, for example 10, such as from 10 to 20, for example from 20 to 50, such as more than 50 nucleotides.
(98) In preferred embodiments of the invention, the variant sequence is a single nucleotide mutation or a single nucleotide polymorphism (SNP).
(99) The variant sequence may be change of one or more nucleotides for one or more other nucleotides compared to the reference target sequence. Furthermore, the term variant sequence may be a deletion or insertion of nucleotides within a nucleic acid, for example deletion or insertion of nucleotides compared to the reference target sequence.
(100) The target nucleic acid sequence may comprise a polymorphic site (see details herein below) and thus the reference target sequence may comprise one polymorphism, whereas the “variant sequence” may constitute another polymorphism.
(101) In one embodiment, the reference target sequence is a wild type sequence, i.e. the most frequently naturally occurring sequence, whereas the variant sequence comprises one or more mutations compared to said wild type sequence. Accordingly, a variant sequence according to the present invention may in one embodiment be a polymorphism, such as a single nucleotide polymorphism (SNP). For example, the polymorphism may be indicative of a specific DNA profile. Knowledge of a specific DNA profile may for example be employed to identify an individual. For example, a specific DNA profile may be employed to identify a criminal or a potentially criminal or to identify a dead body or part of a dead body. Furthermore, a specific DNA profile may be employed to determine relationship between individuals, for example parents-child relationship or more distant relationships. Relationship may also be relationship between different species or different population of a given species.
(102) In one embodiment, the mutation may be indicative of a clinical condition or the mutation may be indicative of increased risk of a clinical condition.
(103) Said clinical condition may for example be selected from the group consisting of neoplastic diseases, neurodegenerative diseases, cardiovascular diseases and metabolic disorders including diabetes.
(104) Furthermore, the mutation may be indicative of a specific response to a predetermined drug treatment. For example, the mutation may be indicative of whether an individual will respond positively to said drug treatment or whether an individual can not tolerate a specific drug treatment.
(105) The variant sequence may be positioned in a particular gene, a gene segment, a micro satellite or any other DNA sequence. Furthermore the variant sequence may be positioned in a mRNA, miRNA or any other RNA sequence. Of particular interest is the detection of particular DNAs, which may be of eukaryotic, prokaryotic, Archae or viral origin. Importantly, the invention may assist in the diagnosis and/or genotyping of various infectious diseases by assaying for particular sequences known to be associated with a particular microorganism.
(106) Detection
(107) The methods of the invention involve detecting a product of a polymerase chain reaction (PCR). Many methods are available to detect the presence of a PCR product, and any available method may be used. Thus, the invention is not restricted to a particular method for detecting whether a PCR product is generated.
(108) It may be preferred to use a method, which can detect generation of a PCR product in real time such as quantitative real-time PCR in which either non-specific fluorescent dyes that intercalate with double-stranded DNA or sequence-specific DNA detection probes are used to quantitate the amplified DNA.
(109) Frequently said detection probe is labelled with a detectable label, e.g. with a fluorescent label.
(110) In one embodiment, the detection probe is labelled with a signalling pair consisting of two members. Thus, the detection probe may be an oligonucleotide comprising a sequence which is identical to or complementary to a consecutive sequence of the target nucleic acid sequence, wherein said oligonucleotide comprises a signalling pair.
(111) The signalling pair may in particular consist of two members providing different signals depending on the distance between the members. For example, the signalling pair may consist of a fluorophore and a quencher, capable of quenching fluorescence of said fluorophore. The signalling pair may also consist of two fluorophores capable of fluorescence resonance energy transfer (FRET).
(112) Examples of useful detection probes include TaqMan probes and molecular beacons.
(113) In one embodiment, the detection probe may comprise one or more hydrophobic nucleotides, such as any of the hydrophobic nucleotides described herein below in the section “Hydrophobic nucleotides”. For example, the detection probe may be a double stranded oligonucleotide or an oligonucleotide comprising a double stranded part. Said double strand may comprise hydrophobic nucleotides, for example at least two hydrophobic nucleotides positioned essentially opposite of each other one on each strand of the double strand. In addition, said detection probe may comprise a signalling pair as described above. Thus, the detection probe may be a duplex of oligonucleotides capable of hybridising to each other, wherein one strand of said duplex is identical to a consecutive sequence of the target nucleic acid, and wherein each strand of said duplex contains a hydrophobic nucleotide and a member of a signalling pair, wherein said hydrophobic nucleotides are positioned opposite of each other, and said members of the signalling pair are positioned opposite of each other, when said oligonucleotides are hybridised to each other.
(114) Thus, the detection probe may be any of the oligonucleotides or oligonucleotide analogues containing a signalling pair, e.g. any of the stemless beacons described in international patent application WO2007/104318, which is incorporated by reference herein.
(115) Non-limiting examples of useful detection probes include HydrolEasy and EasyBeacons.
(116) Other methods may be used with the present invention for the detection and/or evaluation of either single or multiple PCR-products. Those include, but are not limited to: Gel documentation of electrophoresis-separated PCR products including Southern blotting for detection of the target nucleic acid sequence(s) using specific hybridization probes; mutant-enriched PCR using selective restriction enzyme digestion enabling specifically amplification of the variant sequence(s); Next-Generation Sequencing and DNA microarray profiling in order to obtain extended sequence information from the PCR products generated.
(117) Hydrophobic Nucleotide
(118) The blocking oligonucleotide according to the invention comprises at least one hydrophobic nucleotide. A hydrophobic nucleotide according to the present invention has the following structure:
X—Y-Q
(119) wherein
(120) X is a nucleotide or nucleotide analogue or a backbone monomer unit capable of being incorporated into the backbone of a nucleic acid,
(121) Q is an intercalator, which is not taking part in Watson-Crick hydrogen bonding; and
(122) Y is a linker moiety linking said nucleotide or nucleotide analogue or backbone monomer unit and said intercalator.
(123) The backbone monomer unit X may be any of the backbone monomer units described herein below in the section “Backbone monomer unit.
(124) The intercalator Q may be any of the intercalators described herein below in the section “Intercalator”.
(125) Intercalator
(126) The term intercalator according to the present invention covers any molecular moiety comprising at least one essentially flat conjugated system, which is capable of co-stacking with nucleobases of a nucleic acid. Preferably an intercalator according to the present invention essentially consists of at least one essentially flat conjugated system, which is capable of co-stacking with nucleobases of a nucleic acid.
(127) An intercalator comprises at least one 7 (phi) electron system, which according to the present invention can interact with other molecules comprising a π electron system. These interactions can contribute in a positive or negative manner to the hydrophobic interactions of said intercalators. Hunter and Sanders (1990) J. Am Chem. Soc. 112: 5525-5534, have proposed a range of different orientations and conditions where two π electron systems can interact positively with each other.
(128) Preferably, the intercalator comprises a chemical group selected from the group consisting of polyaromates and heteropolyaromates an even more preferably the intercalator essentially consists of a polyaromate or a heteropolyaromate. Most preferably the intercalator is selected from the group consisting of polyaromates and heteropolyaromates.
(129) Polyaromates or heteropolyaromates according to the present invention may consist of any suitable number of rings, such as 1, for example 2, such as 3, for example 4, such as 5, for example 6, such as 7, for example 8, such as more than 8. Furthermore polyaromates or heteropolyaromates may be substituted with one or more selected from the group consisting of hydroxyl, bromo, fluoro, chloro, iodo, mercapto, thio, cyano, alkylthio, heterocycle, aryl, heteroaryl, carboxyl, carboalkoyl, alkyl, alkenyl, alkynyl, nitro, amino, alkoxyl, carbonyl and amido.
(130) Accordingly, an intercalator Q according to the present invention may for example be an intercalator selected from the group consisting of phenanthroline, phenazine, phenanthridine, anthraquinone, pyrene, anthracene, napthene, phenanthrene, picene, chrysene, naphtacene, acridones, benzanthracenes, stilbenes, oxalo-pyridocarbazoles, azidobenzenes, porphyrins, psoralens and any of the aforementioned intercalators substituted with one or more selected from the group consisting of hydroxyl, bromo, fluoro, chloro, iodo, mercapto, thio, cyano, alkylthio, heterocycle, aryl, heteroaryl, carboxyl, carboalkoyl, alkyl, alkenyl, alkynyl, nitro, amino, alkoxyl and/or amido.
(131) Preferably, the intercalator is selected from the group consisting of phenanthroline, phenazine, phenanthridine, anthraquinone, pyrene, anthracene, napthene, phenanthrene, picene, chrysene, naphtacene, acridones, benzanthracenes, stilbenes, oxalo-pyridocarbazoles, azidobenzenes, porphyrins and psoralens.
(132) In a preferred embodiment, the intercalator is selected from the group consisting of phenanthroline, phenazine, phenanthridine, anthraquinone, pyrene, anthracene, phenanthrene, chrysene, naphtacene, benzanthracenes, stilbenes and porphyrins
(133) In another preferred embodiment the intercalator comprises pyrene or pyrido[3′,2′:4,5]thieno[3,2-d]pyrimidin-4(1H)-one or 7,9-dimethyl-pyrido[3′,2′,4,5]thieno[3,2-d]pyrimidin-4(3H)-one. The intercalator may also consist of pyrene or pyrido[3′,2′:4,5]thieno[3,2-d]pyrimidin-4(1H)-one, or 7,9-dimethyl-pyrido[3′,2′,4,5]thieno[3,2-d]pyrimidin-4(3H)-one.
(134) More preferably, the intercalator may be selected from the group of intercalators comprising one of the structures as indicated herein below:
(135) ##STR00001## ##STR00002## ##STR00003## ##STR00004## ##STR00005## ##STR00006## ##STR00007## ##STR00008##
(136) and optionally, but not so preferable derivatives thereof.
(137) Even more preferably the intercalator may be selected from the group of intercalators consisting of the intercalator structures above numbered V, XII, XIV, XV, XVII, XXIII, XXVI, XXVIII, XLVII, LI and LII as well as derivatives thereof, preferably from the group of intercalators consisting of the intercalator structures above numbered V, XII, XIV, XV, XVII, XXIII, XXVI, XXVIII, XLVII, LI and LII.
(138) Most preferably, the intercalator is selected from the group of intercalator structures above numbered XII, XIV, XVII, XXIII, LI as well as derivatives thereof, preferably from the group of intercalator structures above numbered XII, XIV, XVII, XXIII and LI.
(139) The above list of examples is not to be understood as limiting in any way, but only as to provide examples of possible structures of intercalators. In addition, the substitution of one or more chemical groups on each intercalator to obtain modified structures is also included in the present invention.
(140) In one embodiment of the invention, the intercalator may be any of the intercalators described in international patent application WO03/052132 in the section “intercalator” on p. 46, I. 10-p. 54, I. 13.
(141) In a preferred embodiment the intercalator is pyrene. In another preferred embodiment the intercalator is
(142) ##STR00009##
(143) Backbone Monomer Unit
(144) The backbone monomer unit of a nucleotide or a nucleotide analogue according to the present invention is the part of the nucleotide, which is involved in incorporation into the backbone of a nucleic acid or a nucleic acid analogue. The backbone monomer unit (X) is preferably covalently linked to a linker (Y), which is covalently linked to the intercalator. Any suitable backbone monomer unit may be employed for incorporating intercalator into the oligonucleotide analogues according to the present invention. Any sort of linker linking said backbone monomer unit and said intercalator could also be employed. In addition, the backbone monomer unit may comprise one or more leaving groups, protecting groups and/or reactive groups, which may be removed or changed in any way during synthesis or subsequent to synthesis of an oligonucleotide or oligonucleotide analogue comprising said backbone monomer unit.
(145) The backbone monomer unit may be any suitable backbone monomer unit. In one embodiment of the present invention, the backbone monomer unit may for example be selected from the group consisting of the backbone monomer units of DNA, RNA, PNA, HNA, MNA, ANA, LNA, CNA, CeNA, TNA, (2′-NH)-TNA, (3′-NH)-TNA, α-L-Ribo-LNA, α-L-Xylo-LNA, β-D-Xylo-LNA, α-D-Ribo-LNA, [3.2.1]-LNA, Bicyclo-DNA, 6-Amino-Bicyclo-DNA, 5-epi-Bicyclo-DNA, α-Bicyclo-DNA, Tricyclo-DNA, Bicyclo[4.3.0]-DNA, Bicyclo[3.2.1]-DNA, Bicyclo[4.3.0]amide-DNA, β-D-Ribopyranosyl-NA, α-L-Lyxopyranosyl-NA, 2′-R-RNA, α-L-RNA or α-D-RNA, β-D-RNA and mixtures thereof and hybrids thereof, as well as phosphorous atom modifications thereof, such as but not limited to phosphorothioates, methyl phospholates, phosphoramidiates, phosphorodithiates, phosphoroselenoates, phosphotriesters and phosphoboranoates. In addition non-phosphorous containing compounds may be used for linking to nucleotides such as but not limited to methyliminomethyl, formacetate, thioformacetate and linking groups comprising amides.
(146) Below is depicted a range of different backbone monomer units of nucleotides and nucleotide analogues useful with the present invention, and how they are connected to the nucleobases via linkers that are attached at one or two positions of the backbone monomer unit:
(147) ##STR00010##
(148) Examples of Oligomers of DNA, RNA & PNA:
(149) ##STR00011## ##STR00012##
(150) Examples of Oligomers of Some Analogues:
(151) ##STR00013## ##STR00014## ##STR00015## ##STR00016## ##STR00017##
(152) Section of a Nucleic Acid of the Respective Analogues
(153) ##STR00018## ##STR00019## ##STR00020## ##STR00021##
(154) General Structure of 2′-Modified Oligomers
(155) ##STR00022## ##STR00023##
(156) Examples of modifications that, to our knowledge, are not synthesised or published yet:
(157) ##STR00024##
(158) Some of the backbone monomer units shown above are already coupled to intercalators according to the present invention, while others can have intercalators linked to the nucleotides. The interacalators can be connected at any available atom, such as at an atom of the nucleobase, the backbone or the linker linking said nucleobase and backbone if present. The intercalators could also replace the nucleobases or be coupled to its own backbone monomer unit of any sort.
(159) In a preferred embodiment, the backbone monomer unit does not comprise a nucleobase, such as a naturally occurring nucleobase. It is also preferred that the linker does not comprise a nucleobase, such as a naturally occurring nucleobase.
(160) When the backbone monomer unit comprises a ribose group it is in one embodiment preferred that the intercalator is covalently linked to said ribose group via a linker. In this embodiment, the intercalators are thus preferably not covalently linked to a phosphate group of the backbone via a linker (Y).
(161) The backbone monomer unit of LNA (locked nucleic acid) is a sterically restricted DNA backbone monomer unit, which comprises an intramolecular bridge that restricts the usual conformational freedom of a DNA backbone monomer unit, LNA may be any LNA molecule as described in WO 99/14226 (Exiqon), preferably, LNA is selected from the molecules depicted in the abstract of WO 99/14226. Preferred LNA according to the present invention comprises a methyl linker connecting the 2′-O position to the 4′-C position, however other LNA's such as LNA's wherein the 2′ oxy atom is replaced by either nitrogen or sulphur are also comprised within the present invention.
(162) The preferred backbone monomer units of nucleotides comprising intercalators according to the present invention are backbone monomer units that allow said intercalator to interact with its target nucleic acid.
(163) In one preferred embodiment of the present invention, the backbone monomer unit is selected from the group consisting of acyclic backbone monomer units. Acyclic is meant to cover any backbone monomer unit, which does not comprise a ring structure, for example the backbone monomer unit preferably does not comprise a ribose or a deoxyribose group.
(164) It is thus preferred, that the backbone monomer unit of an hydrophobic nucleotide according to the present invention may be selected from the group consisting of backbone monomer units comprising at least one chemical group selected from the group consisting of trivalent and pentavalent phosphorous atom such as a pentavalent phosphorous atom. More preferably, the phosphate atom of the backbone monomer unit according to the present invention may be selected from the group consisting of backbone monomer units comprising at least one chemical group selected from the group consisting of, phosphoester, phosphodiester, phosphoramidate and phosphoramidit groups.
(165) In particular, it is preferred that the backbone monomer unit of a hydrophobic nucleotide according to the present invention is selected from the group consisting of acyclic backbone monomer units comprising at least one chemical group selected from the group consisting of phosphate, phosphoester, phosphodiester, phosphoramidate and phosphoramidit groups.
(166) Preferably, the backbone monomer unit is capable of being incorporated into a phosphate backbone of a nucleic acid or nucleic acid analogue in a manner so that at the most 5, for example at the most 4 atoms are separating the phosphor atom of the backbone monomer unit and the nearest neighbouring phosphor atom, more preferably 5, such as at the most 4 atoms are separating the phosphor atom of the backbone monomer unit and the nearest neighbouring phosphor atom, in both cases not including the phosphor atoms themselves.
(167) In a particularly preferred embodiment of the present invention, the hydrophobic nucleotide comprises a backbone monomer unit that comprises a phosphoramidit and more preferably the backbone monomer unit comprises a trivalent phosphoramidit or a pentavalent.
(168) Suitable trivalent phosphoramidits are trivalent or pentavalent phosphoramidits that may be incorporated into the backbone of a nucleic acid and/or a nucleic acid analogue. Usually, the amidit group per se may not be incorporated into the backbone of a nucleic acid, but rather the amidit group or part of the amidit group may serve as a leaving group and/or protecting group. However, it is preferred that the backbone monomer unit comprises a phosphoramidit group, because such a group may facilitate the incorporation of the backbone monomer unit into a nucleic acid backbone.
(169) In one embodiment of the present invention, the backbone monomer unit may be any of the backbone monomer units described in international patent application WO03/052132 in the section “Backbone monomer unit” on p. 24, I. 27-p. 43, I. 14.
(170) Linker
(171) The linker of an intercalator nucleotide according to the present invention is a moiety connecting the intercalator and the backbone monomer of said hydrophobic nucleotide, preferably covalently linking said intercalator and the backbone monomer unit. The linker may comprise one or more atom(s) or bond(s) between atoms.
(172) By the definitions of backbone and intercalator defined herein above, the linker is the shortest path linking the backbone and the intercalators. If the intercalator is linked directly to the backbone, the linker is a bond.
(173) The linker usually consists of a chain of atoms or a branched chain of atoms. Chains can be saturated as well as unsaturated. The linker may also be a ring structure with or without conjugated bonds.
(174) For example the linker may comprise a chain of m atoms selected from the group consisting of C, O, S, N. P, Se, Si, Ge, Sn and Pb, preferably from the group consisting of C, O, S, N and P, even more preferably they are C, wherein one end of the chain is connected to the intercalator and the other end of the chain is connected to the backbone monomer unit, wherein m is an integer.
(175) In some embodiments, the total length of the linker and the intercalators of the hydrophobic nucleotides according to the present invention preferably is between 8 and 13 Å (see herein below). Accordingly, m should be selected dependent on the size of the intercalators of the specific hydrophobic nucleotide.
(176) I.e. m should be relatively large, when the intercalator is small and m should be relatively small when the intercalator is large. For most purposes however m will be an integer from 1 to 7, such as from 1-6, such as from 1-5, such as from 1-4. As described above the linker may be an unsaturated chain or another system involving conjugated bonds. For example, the linker may comprise cyclic conjugated structures. Preferably, m is from 1 to 4 when the linker is a saturated chain.
(177) When the intercalator is pyrene, m is preferably an integer from 1 to 7, such as from 1-6, such as from 1-5, such as from 1-4, more preferably from 1 to 4, even more preferably from 1 to 3, most preferably m is 2 or 3.
(178) When the intercalator has the structure
(179) ##STR00025##
(180) m is preferably from 2 to 6, more preferably 2.
(181) In one embodiment, the linker is an azaalkyl, oxaalkyl, thiaalkyl or alkyl chain. For example the linker may be an alkyl chain substituted with one or more selected from the group consisting C, H, O, S, N, P, Se, Si, Ge, Sn and Pb, preferably selected from the group consisting of C, H, O, S, N and P. In a preferred embodiment the linker consists of an unbranched alkyl chain, wherein one end of the chain is connected to the intercalators and the other end of the chain is connected to the backbone monomer unit and wherein each C is substituted with 2H. More preferably, said unbranched alkyl chain is from 1 to 5 atoms long, such as from 1 to 4 atoms long, such as from 1 to 3 atoms long, such as from 2 to 3 atoms long.
(182) In another embodiment, the linker consists of from 1-6 C atoms, from 0-3 of each of the following atoms O, S, N. More preferably the linker consists of from 1-6 C atoms and from 0-1 of each of the atoms O, S, N.
(183) In a preferred embodiment, the linker consists of a chain of C, O, S and N atoms, optionally substituted. Preferably said chain should consist of at the most 3 atoms, thus comprising from 0 to 3 atoms selected individually from C, O, S, N, optionally substituted.
(184) In a preferred embodiment, the linker consists of a chain of C, N, S and O atoms, wherein one end of the chain is connected to the intercalator and the other end of the chain is connected to the backbone monomer unit.
(185) Preferably such a chain comprise one of the linkers shown below, most preferably the linker consist of one of the molecules shown below:
(186) ##STR00026## ##STR00027## ##STR00028##
(187) In a preferred embodiment, the chain comprises one of the linkers shown below, more preferably the linker consists of one of the molecules shown below:
(188) ##STR00029##
(189) In a more preferred embodiment, the chain comprises one of the linkers shown below, more preferably the linker consists of one of the molecules shown below:
(190) ##STR00030##
(191) The linker constitutes Y in the formula for the hydrophobic nucleotide X—Y-Q, as defined above, and hence X and Q are not part of the linker.
(192) In one embodiment of the invention the linker may be any of the linkers described in WO03/052132 in the section “Linker” on p. 54, I. 15 to p. 58, I. 7.
(193) Sample
(194) The present invention provides methods for detecting the presence of a variant sequence in a sample comprising nucleic acids.
(195) The sample may comprise cells comprising said nucleic acids. The cells may for example be prokaryotic cells or eukaryotic cells, such as plant cells or mammalian cells.
(196) The sample may for example be a synthetically prepared sample, which may or may not have been further processed in vitro, however most frequently, the sample is a sample obtained from an individual.
(197) Thus, frequently, it is desirable to test the DNA or RNA of an individual, such as a mammal, for example a human being. In that case the sample is a sample derived from said individual. Thus, the sample may for example comprise nucleic acids selected from the group consisting of DNA, mRNA, miRNA or any other RNA sequence. The sample may be derived from a body fluid sample for example a blood sample, a biopsy, a sample of hair, nails or the like or any other suitable sample. In embodiments of the invention, wherein the individual is suffering from cancer, the sample may be a sample of a cancer tumour removed from the individual by surgery, or a biopsy of said tumour. However, in embodiments of the invention wherein the individual is suffering from cancer, the sample may also be a blood sample, which typically may contain CTCs and cfDNA.
(198) The sample may be processed in vitro prior to detection of the presence of the variant sequence. For example the sample may be subjected to one or more purification steps that may purify nucleic acids from the sample completely or partially. Furthermore, the sample may have been subjected to reverse transcription.
(199) The sample may comprise a complex biological mixture of nucleic acid (RNA and DNA) and non-nucleic acids, for example an intact cell or a crude cell extract.
(200) If the target DNA is double stranded or otherwise have significant secondary and tertiary structure, it may need to be heated prior to performing the methods of the invention. It may also be desirable in some cases to extract the nucleic acids from the complex biological samples prior to performing the PCR by any methods known in the art.
(201) The sample may comprise a wide range of eukaryotic and prokaryotic cells, including protoplasts; or other biological materials that may harbour target deoxyribonucleic acids. The methods are thus applicable to tissue culture animal cells, animal cells (e.g., blood, serum, plasma, reticulocytes, lymphocytes, urine, bone marrow tissue, cerebrospinal fluid or any product prepared from blood or lymph) or any type of tissue biopsy (e.g. a muscle biopsy, a liver biopsy, a kidney biopsy, a bladder biopsy, a bone biopsy, a cartilage biopsy, a skin biopsy, a pancreas biopsy, a biopsy of the intestinal tract, a thymus biopsy, a mammal biopsy, an uterus biopsy, a testicular biopsy, an eye biopsy or a brain biopsy, homogenized in lysis buffer), plant cells or other cells sensitive to osmotic shock and cells of bacteria, yeasts, viruses, mycoplasmas, protozoa, rickettsia, fungi and other small microbial cells and the like. The assay and isolation procedures of the present invention are useful, for instance, for detecting non-pathogenic or pathogenic micro organisms of interest. By detecting the presence of a variant sequence in a biological sample, the presence of the micro organisms may be established.
(202) PCR Reagents
(203) The methods of the invention in general comprise use of “PCR reagents”. Also the kit-of-parts according to the invention may comprise PCR reagents.
(204) Said PCR reagents may be any reagents, which are required for or may be beneficial for performing a PCR. The skilled person is well aware of how to perform a PCR and which reagents may be useful for performing a PCR. Useful methods and materials for PCR are for example described in Sambrook J et al. 2000. Molecular Cloning: A Laboratory Manual (Third Edition), Cold Spring Habor Laboratory Press.
(205) In general the PCR reagents at least comprise a nucleic acid polymerase, and nucleotides.
(206) Thus, the PCR reagents may comprise deoxynucleoside triphosphates (dNTPs), in particular all of the four naturally-occurring deoxynucleoside triphosphates (dNTPs).
(207) The PCR reagents frequently comprise deoxyribonucleoside triphosphate molecules, including all of dATP, dCTP, dGTP, dTTP. In some cases dUTP is added.
(208) The nucleic acid polymerase may be any useful polymerase. Said nucleic acid polymerase may be any nucleic acid polymerase, such as a DNA polymerase. The nucleic acid polymerase is in general thermostable, so that it can retain activity after having been subjected to high denaturing temperatures. Also the nucleic acid polymerase should have activity at the elongation temperature, which is typically chosen to be higher than the annealing temperature.
(209) In some embodiments, the nucleic acid polymerase is a DNA polymerase with 5′ to 3′ exonuclease activity. This may in particular be the case in embodiments of the invention, wherein the detection probe is a hydrolysis probe (e.g. a Taqman probe). One advantage of the blocking oligonucleotides of the invention is that they are not broken down by 5′ to 3′ exonuclease activity to any significant extent, and thus can maintain blocking activity even if a DNA polymerase with 5′ to 3′ exonuclease activity is used.
(210) Any DNA polymerase, e.g., a DNA polymerase with 5′ to 3′ exonuclease activity that catalyzes primer extension can be used. For example, a thermostable DNA polymerase can be used.
(211) In one embodiment, the nucleic acid polymerase is a Taq polymerase.
(212) The PCR reagents may also comprise compounds useful in assisting the activity of the nucleic acid polymerase. Thus, the PCR reagent may comprise a divalent cation, e.g., magnesium ions. Said magnesium ions may be added on the form of e.g. magnesium chloride or magnesium acetate (MgCl.sub.2) or magnesium sulfate is used.
(213) The PCR reagents may also comprise one or more of the following: non-specific blocking agents such as BSA or gelatin from bovine skin, betalactoglobulin, casein, dry milk, or other common blocking agents, non-specific background/blocking nucleic acids (e.g., salmon sperm DNA), biopreservatives (e.g. sodium azide), PCR enhancers (e.g. Betaine, Trehalose, etc.), inhibitors (e.g. RNAse inhibitors).
(214) The PCR reagents may also contain other additives, e.g., dimethyl sulfoxide (DMSO), glycerol, betaine (mono)hydrate (N,N,N-trimethylglycine=[caroxy-methyl]trimethylammonium), trehalose, 7-Deaza-2′-deoxyguanosine triphosphate (dC7GTP or 7-deaza-2′-dGTP), formamide (methanamide), tettrmethylammonium chloride (TMAC), other tetraalkylammonium derivaties (e.g., tetraethyammonium chloride (TEA-Cl) and tetrapropylammonium chloride (TPrA-Cl), non-ionic detergent (e.g., Triton X-100, Tween 20, Nonidet P-40 (NP-40)), or PREXCEL-Q.
(215) The PCR reagents may comprise a buffering agent.
(216) In some cases, a non-ionic Ethylene Oxide/Propylene Oxide block copolymer is added to the aqueous phase in a concentration of about 0.1%, 0.2%, 0.3%, 0.4%, 0.5%, 0.6%, 0.7%, 0.8%, 0.9%, or 1.0%. Common biosurfactants include non-ionic surfactants such as Pluronic F-68, Tetronics, Zonyl FSN. Pluronic F-68 can be present at a concentration of about 0.5% w/v.
(217) In some cases, magnesium sulfate can be substituted for magnesium chloride, at similar concentrations. A wide range of common, commercial PCR buffers from varied vendors can be substituted for the buffered solution.
(218) PCR usually comprises incubating the blocking oligonucleotide, the set of primers and the PCR reagents in cycles comprising incubation at different temperatures. Typically, each cycle comprises incubation at a denaturing temperature, an annealing temperature and an elongation temperature. The PCR may also comprise additional steps, e.g. a first step of incubation at a denaturation temperature for a long period of time and/or a last step of incubation at an elongation temperature for a long period of time. The skilled person is well aware of how to choose suitable denaturation temperatures, elongation temperatures and annealing temperatures, times and number of cycles. Typically the denaturation temperature is in the range of 90 to 100° C., the elongation temperature is in the range of 55 to 80° C. and the annealing temperature is close to the melting temperatures of the primers, e.g. in the range of 40 to 70° C. The time for incubation at each temperature is typically relatively short, e.g. in the range of 30 to 120 seconds. The number of cycles may for example be in the range of 15 to 60, for example in the range of 30 to 40. A typical PCR reaction can also be comprised of just two steps with a denaturation temperature typically in the range of 90 to 100° C. followed by an annealing/elongation temperature typically in the range of 55 to 80° C. Information on how to select parameters for PCR are readily available for example in Sambrook J et al. 2000. Molecular Cloning: A Laboratory Manual (Third Edition), Cold Spring Habor Laboratory Press.
(219) Predicting Efficacy of Treatment of a Clinical Condition
(220) It is an aspect of the invention to provide methods of predicting the efficacy of treatment of a clinical condition in an individual in need thereof with a predetermined drug, wherein the efficacy of treatment of said clinical condition with said drug is associated with the presence of a variant sequence.
(221) Thus, some mutations may be indicative of whether or not a certain drug may be efficient for treatment of an individual. In particular, specific mutations may be indicative of a specific response to a predetermined drug treatment. For example, the mutation may be indicative of whether an individual will respond positively to said drug treatment, whether the disease of an individual is resistant toward the given drug or whether an individual cannot tolerate a specific drug treatment.
(222) Methods for predicting the efficacy of treatment of a clinical condition in an individual may comprise the steps of a. providing a sample from said individual b. performing the method for detecting the presence of a variant sequence according to the invention to determine whether the sample comprises the variant sequence wherein the presence of said variant sequence is indicative of whether said drug is efficient in treating said clinical condition in said individual.
(223) The clinical condition may for example be cancer. Many mutations have been identified, which are indicative of whether a given cancer drug or combination of drugs is effective in treating a particular cancer.
(224) In one embodiment of the invention, the variant sequence is an activating mutation in KRAS or NRAS. Several activating mutations in KRAS and NRAS have been identified. Typically, individual suffering from cancer characterized by an activating mutation in KRAS or NRAS will not benefit from treatment targeting EGFR. Thus, in one embodiment the invention relates to a method of predicting the efficacy of a treatment targeting EGFR in an individual suffering from cancer, the method comprising the steps of a) providing a sample of said cancer from said individual b) detecting the presence or absence of an activating mutation in KRAS and/or NRAS in said sample using the methods for detecting a variant sequence according to the invention, wherein the presence of an activating mutation is indicative of that the individual will not benefit from treatments targeting EGFR.
(225) The wild type amino acid sequences of human BRAF, EGFR, KRAS, NRAS and PIK3CA are provided herein as SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4 and SEQ ID NO:5, respectively. Said activating mutation may for example be selected from mutations in positions 12, 13, 59, 61, 117 and 146 of KRAS and mutations in positions 12, 13, 59, 61, 117, 148 of NRAS. For example the mutation may be selected from the group of mutations shown in Table 1. In particular, said mutation may be mutations in KRAS exon 2, codons 12 and/or 13.
(226) TABLE-US-00001 TABLE 1 Non-limiting examples of mutations indicative of efficacy of treatment investigated by methods of the present invention. Gene Mutations BRAF Val600Asp Val600Glu Val600Lys Val600Arg EGFR Glu709Ala Gly719Ala Exon19 Deletions Glu709Gly Gly719Cys Exon19 Insertions Glu709Lys Gly719Asp Ser768Ile Gly719Ser Thr790Met Leu858Arg Leu861Gln KRAS Gly12Ala Gln61His.sup.A>C Lys117Asn.sup.A>C Gly12Asp Gln61His.sup.A>T Lys117Asn.sup.A>T Gly12Arg Gln61Glu Ala146Pro Gly12Cys Gln61Lys Ala146Thr Gly12Ser Gln61Leu Ala146Val Gly12Val Gln61Arg Gly13Asp Ala61Gly Ala61Thr NRAS Gly12Ala Gly12Ala Gln61His.sup.A>T Lys117Asn.sup.G>C Gly12Cys Gly13Cys Gln61His.sup.A>C Lys117Asn.sup.G>T Gly12Asp Gly13Asp Gln61Lys Ala146Pro Gly12Arg Gly13Arg Gln61Leu Ala146Thr Gly12Ser Gly13Ser Gln61Arg Ala146Val Gly12Val Gly13Val PIK3CA His1047Leu His1047Arg His1047Tyr
(227) Said treatment targeting EGFR may be any treatment aimed at reducing or even abolishing the activity of EGFR. Several such treatments are known in the art including treatment with antibodies to EGFR. Examples of antibodies to EGFR useful for treatment of cancer patients include Cetuximab or Panitumumab. Treatments targeting EGFR may also be combination treatments, for example involving a combination of treatment with antibodies to EGFR and chemotherapy, e.g. FOLFOX4 or FOLFIRI schemes.
(228) Another example of a mutation indicative of efficacy of treatment is mutations in EGFR. Thus, specific mutations in EGFR are indicative of efficacy of treatment targeting EGFR and/or BRAF. Thus, in one embodiment the invention relates to a method of predicting the efficacy of a treatment targeting EGFR and/or BRAF in an individual suffering from cancer, the method comprising the steps of a) providing a sample of said cancer from said individual b) detecting the presence or absence of a mutation in EGFR in said sample using the methods for detecting a variant sequence according to the invention,
(229) wherein the presence of a mutation is indicative of that the individual will not benefit from treatment targeting EGFR or BRAF.
(230) Said EGFR mutation may for example be located in exon 20, and may in particular be the T790M mutation.
(231) Predicting the Presence of a Clinical Condition
(232) The methods of the invention are also useful for predicting or even diagnosing the presence of any clinical condition associated with a particular mutation in an individual.
(233) Such methods may comprise the steps of a) Providing a sample from said individual b) detecting the presence of a mutation associated with the clinical condition in the sample by performing the methods for detecting a variant sequence according to the invention; wherein the presence of said variant sequence is indicative of said individual suffering from said clinical condition.
(234) Numerous clinical conditions are known to be associated with particular mutations, and blocking oligonucleotides and sets of primers for detecting any such mutation may be designed.
(235) In one embodiment, the clinical condition is cancer.
(236) Multiplex
(237) It is often advantageous to investigate a sample for the presence of several different variant sequences. Accordingly, the methods of the invention may be adapted, so that several variant sequences are detected simultaneously. Often it is sufficient just to determine if at least one of many variant sequences is present. For example, when determining the presence of an activating mutation in KRAS or NRAS, it may be sufficient to detect whether at least one activating mutation is present, and of less relevance to determine exactly which one. In such cases the methods of the invention may be for detecting the presence of at least one of a number of variant sequences in the same method.
(238) It is also possible to include one or more controls in the PCR reactions of the invention. A control could for example be detection of the presence of one or more housekeeping genes. If the control is added to the same reaction container in the PCR it is ensured that (at least most of) the conditions of the control and the assay are the same, and therefore this is often advantageous over running parallel experiments.
(239) When more than one experiment is included in an assay, it is said to be a multiplexing assay or a multiplex assay. When only one experiment is included in an assay, this may also be referred to as a simplex assay.
(240) It is therefore an embodiment of the invention to provide one blocking oligonucleotide, one primer 2 and at least two different primer 1s, wherein each of the primer 1s comprise a sequence of at least 15 nucleotides, which is identical to the target nucleic acid sequence comprising the different variant sequences expect for up to one mismatch. When performing a PCR in the presence of the blocking oligonucleotide, primer 2 and the different primer 1s generation of a PCR product is indicative of the presence of at least one of the different variant sequences recognised by the different primer 1s. This kind of multiplexing is only useful if the different variant sequences are positioned sufficiently close to each other to allow design of the different primer 1s all having the required overlap with the blocking oligonucleotides. For example, such a multiplexing method may be useful for detecting different mutations at the same position in a gene, or for detecting different mutations in the same and/or neighbouring positions in a gene.
(241) It is also an embodiment of the invention to provide two different blocking oligonucleotides and two different sets of primers useful for detecting two different variant sequences. Such methods may include running one PCR reaction in the presence of both blocking oligonucleotides and both sets of primers. It may be preferable in such embodiments that the sets of primers are designed to have similar melting temperatures. If several different sequences are known to be occurring at a specific NOI, then even more than two different blocking oligonucleotides may be used each blocking different reference NOI sequences.
(242) Detection of a PCR product in a multiplex reaction may be performed by any useful method, e.g. by use of detection probe. It is possible to use only one detection probe capable of detecting the different PCR products. This may in particular be the case, when there is an overlap between the different target nucleic acid sequences. However, individual detection probes for the different target nucleic acid sequences may also be used. If different detection probes are used, they may be labelled in a similar manner, in which case the assay is useful for determined whether at least one of the variant sequences is present. The detection probes may also be differentially labelled, allowing for detection of different variant sequences in one reaction.
(243) TABLE-US-00002 Sequence listing SEQ ID NO: 1 Amino acid sequence of BRAF SEQ ID NO: 2 Amino acid sequence of EGFR SEQ ID NO: 3 Amino acid sequence of KRAS SEQ ID NO: 4 Amino acid sequence of NRAS SEQ ID NO: 5 Amino acid sequence of PIK3CA SEQ ID NO: 6 NRAS A59D primer 1 sequence (FIG. 4) SEQ ID NO: 7 NRAS 59 primer 2 sequence (FIG. 4) SEQ ID NO: 8 NRAS 59 probe sequence (FIG. 4) SEQ ID NO: 9 NRAS 59 blocking oligonucleotide sequence (FIG. 4) SEQ ID NO: 10 KRAS 59/61 primer 2 sequence (FIG. 7) SEQ ID NO: 11 KRAS Q61K primer 1 sequence (FIG. 7) SEQ ID NO: 12 KRAS Q61L primer 1 sequence (FIG. 7) SEQ ID NO: 13 KRAS A59G primer 1 sequence (FIG. 7) SEQ ID NO: 14 KRAS 61 probe sequence (FIG. 7) SEQ ID NO: 15 KRAS 59/61 blocking oligonucleotide sequence (FIG. 7) SEQ ID NO: 16 Primer 1 sequence, assay 1 (FIG. 3B) SEQ ID NO: 17 Blocking oligonucleotide sequence, assay 1 (FIG. 3B) SEQ ID NO: 18 Primer 1 sequence, assay 2 (FIG. 3B) SEQ ID NO: 19 Blocking oligonucleotide sequence, assay 2 (FIG. 3B) SEQ ID NO: 20 Primer 1 sequence, assay 3 (FIG. 3B) SEQ ID NO: 21 Blocking oligonucleotide sequence, assay 3 (FIG. 3B) SEQ ID NO: 22 Primer 1 sequence, assay 4 (FIG. 3B) SEQ ID NO: 23 Blocking oligonucleotide sequence, assay 4 (FIG. 3B) SEQ ID NO: 24 Primer 1 sequence, assay 5 (FIG. 3B) SEQ ID NO: 25 Blocking oligonucleotide sequence, assay 5 (FIG. 3B) SEQ ID NO: 26 Primer 1 sequence, assay 6 (FIG. 3B) SEQ ID NO: 27 Blocking oligonucleotide sequence, assay 6 (FIG. 38) SEQ ID NO: 28 Primer 2 sequence, assay 1(FIG. 3B) SEQ ID NO: 29 Primer 2 sequence, assay 2 (FIG. 3B) SEQ ID NO: 30 Primer 2 sequence, assays 3, 4, 5 (FIG. 3B) SEQ ID NO: 31 Primer 2 sequence, assay 6 (FIG. 3B) SEQ ID NO: 1 MAALSGGGGGGAEPGQALFNGDMEPEAGAGAGAAASSAADPAIPEEVWNIKQMIKL TQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSS ASMDTVTSSSSSSLSVLPSSLSVFQNPTDVARSNPKSPQKPIVRVFLPNKQRTVVPAR CGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENV PLTTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFFIQRCSTEVPLMCVNYDQLD LLFVSKFFEHHPIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRP ADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASL PGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRI GSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGY STKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSN NIFLHEDLTVKIGDFGLATVKSRWSGSFIQFEQLSGSILWMAPEVIRMQDKNPYSFQSD VYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAEC LKKKRDERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQ AGGYGAFPVH SEQ ID NO: 2 MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNN CEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSY ALAVLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSDFLSN MSMDFQNHLGSCQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSD CCHNQCAAGCTGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYS FGATCVKKCPRNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGI GEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITG FLLIQAWPENRTDLHAFENLEHRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIIS GNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPR DCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPD NCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGL EGCPTNGPKIPSIATGMVGALLLLLVVALGIGLFMRRRHIVRKRTLRRLLQERELVEPLT PSGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSP KANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQ YLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYH AEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTEGSKPYDGPASEISSILEK GERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMH LPSPTDSNFYRALMDEEDMDDVVDADEYLIPQQGFFSSPSTSRTPLLSSLSATSNNST VACIDRNGLQSCPIKEDSFLQRYSSDPTGALTEDSIDDTFLPVPEYINQSVPKRPAGSV QNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLNTVQPTCVNSTFDSPAHWAQK GSHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRVAPQSSEFIGA SEQ ID NO: 3 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTA GQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQ1KRVKDSDDVPMVLVGN KCDLPTRTVDTKQAHELAKSYGIPHETSAKTRQGVEDAFYTLVREIRQYRMKKLNSS DDGTQGCMGLPCVVM SEQ ID NO: 4 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTA GQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGN KCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEE KTPGCVKIKKCIIM SEQ ID NO: 5 MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPEL PKHIYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSE QLKLCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYS QLPMDCFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIY VRTGIYHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRK GAKEEHCPLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKET PCLELEFDWFSSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELREND KEQLKAISTRDPLSEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCL VKDWPPIKPEQAMELLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQ YLDNLLVRFLLKKALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKH LNRQVEAMEKLINLTDILKQEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPA HQLGNLRLEECRIMSSAKRPLWLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQII RIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSH TLHQWLKDKNKGEIYDAAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDF GHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGAQECTKTREFERFQEMCYKAYLAIR QHANLEINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHHG GWTTKMDWIFHTIKQHALN items
(244) The invention may further be defined by the following items: 1. A method for detecting the presence of a variant sequence in a target nucleic acid sequence comprising nucleotide(s) of interest (NOI), wherein said NOI may consist of said variant sequence, of other variant sequences or of a reference NOI sequence, said method comprising the steps of a) Providing a sample comprising nucleic acids b) Providing a blocking oligonucleotide comprising a sequence of in the range of 10 to 50 nucleotides (referred to as “blocking sequence”) into which in the range of 2 to 10 hydrophobic nucleotides have been inserted wherein at least one hydrophobic nucleotide is positioned at the 5′ end of said sequence or within 4 nucleotides from the 5′ end; and at least one hydrophobic nucleotide is positioned at the 3′ end of said sequence or within 4 nucleotides from the 3′ end; and wherein the hydrophobic nucleotide has the structure
X—Y-Q wherein X is a nucleotide or nucleotide analogue or a backbone monomer unit capable of being incorporated into the backbone of a nucleic acid or nucleic acid analogue, Q is a intercalator which is not taking part in Watson-Crick hydrogen bonding; and Y is a linker moiety linking said nucleotide or nucleotide analogue or backbone monomer unit and said intercalator; and wherein the blocking sequence is identical to a consecutive stretch of the target nucleic acid sequence comprising the reference NOI sequence, c) Providing a set of primers consisting of primer 1 and primer 2, wherein the set of primers together are capable of amplification of the target nucleic acid sequence comprising the variant sequence, and wherein primer 1 comprises a sequence of at least 15 nucleotides positioned at the 3′ end of said primer, which is identical to a consecutive stretch of the target nucleic acid sequence comprising the variant sequence expect for up to one mismatch; d) performing a polymerase chain reaction in the presence of said sample, said blocking oligonucleotide; said set of primers and PCR reagents; e) detecting a product of said polymerase chain reaction, wherein the presence of a product of said polymerase chain reaction indicates the presence of a target nucleic acid sequence comprising the variant sequence in said sample. 2. The method according to item 1, wherein the step of detecting said product involves use of a detection probe. 3. The method according to any one of the preceding items, wherein the sample is a blood sample. 4. A kit-of-parts comprising a) a blocking oligonucleotide consisting of a sequence of in the range of 10 to 50 nucleotides (referred to as “blocking sequence”) into which in the range of 2 to 10 hydrophobic nucleotides have been inserted, wherein at least one hydrophobic nucleotide is positioned at the 5′ end of said sequence or within 4 nucleotides from the 5′ end; and at least one hydrophobic nucleotide is positioned at the 3′ end of said sequence or within 4 nucleotides from the 3′ end; and Z is a hydrophobic nucleotide of the structure
X—Y-Q wherein X is a backbone monomer unit capable of being incorporated into the backbone of a nucleic acid or nucleic acid analogue, Q is an intercalator, which is not taking part in Watson-Crick hydrogen bonding; and Y is a linker moiety linking said nucleotide or nucleotide analogue or backbone monomer unit and said intercalator; and wherein the blocking sequence is identical to a consecutive stretch of a target nucleic acid sequence comprising a reference NOI sequence; and b) a set of primers consisting of primer 1 and primer 2, wherein the set of primers together are capable of amplification of the target nucleic acid sequence comprising a variant sequence, and wherein primer 1 contains a sequence of at least 15 nucleotides positioned at the 3′ end of said primer, which is identical to a consecutive stretch of the target nucleic acid sequence comprising the variant sequence expect for up to one mismatch. 5. The kit according to item 4, wherein the kit furthermore comprises a detection probe. 6. The kit according to any one of items 4 to 5, wherein the kit comprises at the most one kind of blocking oligonucleotide, one kind of primer 1 and one kind of primer 2. 7. The kit according to any one of items 4 to 5, wherein the kit comprises at least two different blocking oligonucleotides wherein at least one blocking oligonucleotide contains a blocking sequence identical to a consecutive stretch of a target nucleic acid sequence comprising a reference NOI sequence, and one or more blocking oligonucleotide(s) contain blocking sequence(s) identical to a consecutive stretch of a target nucleic acid sequence comprising other variant sequence(s), wherein said other variant sequences are different to the variant sequence identical to a stretch of primer 1. 8. The kit according to any one of items 4 to 5, wherein the kit comprises sets of primers comprising at least two different primer 1s and a primer 2, wherein a first primer 1 together with a primer 2 is capable of amplification of a target nucleic acid sequence comprising a first variant sequence, wherein said first primer 1 comprises a sequence of at least 15 nucleotides positioned at the 3′ end of said primer, which is identical to a consecutive stretch of the target nucleic acid sequence comprising said first variant sequence expect for up to one mismatch, and a second primer 1 together with a primer 2 is capable of amplification of a target nucleic acid sequence comprising a second variant sequence, wherein said second primer 1 comprises a sequence of at least 15 nucleotides positioned at the 3′ end of said primer, which is identical to a consecutive stretch of the target nucleic acid sequence comprising said second variant sequence expect for up to one mismatch; and wherein the sets of primers optionally comprise one or more further primer 1, which together with a primer 2 are capable of amplification of a target nucleic acid sequence comprising one or more further variant sequence(s), wherein said further primer 1(s) comprise a sequence of at least 15 nucleotides positioned at the 3′ end of said primer, which is identical to a consecutive stretch of the target nucleic acid sequence comprising said further variant sequence(s) expect for up to one mismatch. 9. The kit according to any one of items 4 to 8, wherein the kit comprises at the most one kind of primer 2. 10. The method according to any one of items 1 to 3, wherein the method comprises use of a kit according to item 7. 11. The method according to item 10, wherein the method comprises the steps of a) Providing a sample comprising nucleic acids b) Providing at least two different blocking oligonucleotides as defined in item 1, wherein at least one blocking oligonucleotide contains a blocking sequence identical to a consecutive stretch of the target nucleic acid sequence comprising the reference NOI sequence, and one or more blocking oligonucleotide(s) contain blocking sequence(s) identical to a consecutive stretch of the target nucleic acid sequence comprising said other variant sequence(s), c) Providing a set of primers consisting of primer 1 and primer 2, wherein the set of primers together are capable of amplification of the target nucleic acid sequence comprising the variant sequence, and wherein primer 1 comprises a sequence of at least 15 nucleotides positioned at the 3′ end of said primer, which is identical to a consecutive stretch of the target nucleic acid sequence comprising the variant sequence expect for up to one mismatch; d) performing a polymerase chain reaction in the presence of said sample, said blocking oligonucleotides; said set of primers and PCR reagents; e) detecting a product of said polymerase chain reaction, wherein the presence of a product of said polymerase chain reaction indicates the presence of a target nucleic acid sequence comprising the variant sequence in said sample. 12. The method according to any one of items 1 to 3, wherein the method comprises use of a kit according to any one of items 8 to 9. 13. The method according to item 12, wherein the method comprises the steps of a) Providing a sample comprising nucleic acids b) Providing a blocking oligonucleotide as defined herein, wherein said blocking oligonucleotide contains a blocking sequence identical to a consecutive stretch of the target nucleic acid sequence comprising the reference NOI sequence, c) Providing sets of primers comprising at least two different primer 1s and a primer 2, wherein a first primer 1 together with a primer 2 is capable of amplification of the target nucleic acid sequence comprising a first variant sequence, wherein said first primer 1 comprises a sequence of at least 15 nucleotides positioned at the 3′ end of said primer, which is identical to a consecutive stretch of the target nucleic acid sequence comprising said first variant sequence expect for up to one mismatch, and a second primer 1 together with a primer 2 is capable of amplification of the target nucleic acid sequence comprising a second variant sequence, wherein said second primer 1 comprises a sequence of at least 15 nucleotides positioned at the 3′ end of said primer, which is identical to a consecutive stretch of the target nucleic acid sequence comprising said second variant sequence expect for up to one mismatch; and optionally one or more further primer 1 together with a primer 2 are capable of amplification of the target nucleic acid sequence comprising one or more further variant sequence(s), wherein said further primer 1(s) comprise a sequence of at least 15 nucleotides positioned at the 3′ end of said primer, which is identical to a consecutive stretch of the target nucleic acid sequence comprising said further variant sequence(s) expect for up to one mismatch; d) performing a polymerase chain reaction in the presence of said sample, said blocking oligonucleotide; said sets of primers and PCR reagents; e) detecting a product of said polymerase chain reaction, wherein the presence of a product of said polymerase chain reaction indicates the presence of a target nucleic acid sequence comprising the variant sequence in said sample. 14. The method or the kit according to any one of the preceding items, wherein a primer 1 comprises a sequence which is identical to a consecutive sequence of the blocking sequence of at least 3, preferably of at least 6 nucleotides except for up to one mismatch. 15. The method according to item 14, wherein the sequence of primer 1, which is identical to a consecutive sequence of the blocking sequence is positioned immediately 5′ to the sequence identical to the variant sequence. 16. The method or the kit according to any one of the preceding items, wherein the most 3′ nucleotide(s) of a primer 1 are identical to the variant sequence. 17. The method or the kit according to any one of the preceding items, wherein the variant sequence is a single nucleotide variant. 18. The method or the kit according to item 17, wherein the most 3′ nucleotide of primer 1 is identical to the single nucleotide variant. 19. The method or the kit according to any one of items 1 to 16, wherein the variant sequence consists of more than one consecutive variant nucleotides. 20. The method or the kit according to item 11, wherein the most 3′ nucleotides of primer 1 are identical to the variant nucleotides. 21. The method or the kit according to any one of items 1 to 16, wherein the variant sequence consists of insertion of one or more nucleotides. 22. The method or the kit according to item 21, wherein the most 3′ nucleotide(s) of primer 1 are identical to at least the most 5′ nucleotide(s) of the insertion. 23. The method or the kit according to item 21, wherein the most 3′ nucleotides of primer 1 are identical to all of the inserted nucleotides. 24. The method or the kit according to any one of items 1 to 16, wherein the variant sequence consists of deletion of one or more nucleotides. 25. The method or the kit according to item 24, wherein the most 3′ nucleotides of primer 1 are identical to the nucleotides positioned immediately 3′ of the deletion. 26. The method or the kit according to any one of the preceding items, wherein primer 1 contains a sequence of in the range of 15 to 50 nucleotides, such as in the range of 15 to 20 nucleotides, which is identical to the target nucleic acid sequence comprising the variant sequence expect for up to one mismatch. 27. The method or the kit according to any one of the preceding items, wherein said sequence of at least 15 nucleotides, which is identical to the target nucleic acid sequence comprising the variant sequence expect for up to one mismatch is positioned at the 3′ end of primer 1. 28. The method or the kit according to item 27, wherein said mismatch is positioned at position 2, 3 or 4 from the 3′ end. 29. The method or the kit according to any one of the preceding items, wherein primer 2 comprises a sequence of at least 15 nucleotides, which is complementary to a consecutive sequence of the target nucleic acid sequence. 30. The methods or kit according to any one of the preceding items, wherein more than one blocking oligonucleotide is provided. 31. The methods or kit according to any one of the preceding items, wherein more than one primer 1 is provided, wherein each of said primer 1s contain a sequence identical to a consecutive stretch of the target nucleic acid sequence comprising a different variant sequence expect for up to one mismatch. 32. The method or the kit according to any one of the preceding items, wherein the blocking sequence is in the range of 10 to 30 nucleotides, such as in the range of 15 to 25 nucleotides. 33. The method or the kit according to any one of the preceding items, wherein the blocking oligonucleotide has the following general structure
5′-(N).sub.a—Z-SEQ.sub.1-Z—(N).sub.b-3′ wherein N is any nucleotide or nucleotide analogue; and Z is a hydrophobic nucleotide as defined in item 1; and SEQ.sub.1 is a sequence of 4 to 20 nucleotides or nucleotide analogues into which up to 4 hydrophobic nucleotides (Z) may be inserted; and a and b individually are an integer in the range of 0 to 4; and the total number of nucleotides is at least 10; and (N).sub.a-SEQ.sub.1-(N).sub.b is identical to a stretch of the target nucleic acid sequence comprising the reference NOI sequence. 34. The method or the kit according to item 33, wherein SEQ1 is a sequence identical to a stretch of the target nucleic acid sequence comprising the reference NOI sequence. 35. The method or the kit according to any one of the preceding items, wherein the blocking oligonucleotide has the following general structure
5′-(N.sub.a—Z—(N).sub.c—Z—(N).sub.b-3′ wherein N is any nucleotide or nucleotide analogue; and Z is a hydrophobic nucleotide as defined in item 1; and a and b individually are integers in the range of 0 to 4; and c is an integer in the range of 4 to 20; and a+b+c is at least 10; and (N).sub.a—(N).sub.c—(N).sub.b is identical to a stretch of the target nucleic acid sequence comprising the reference NOI sequence. 36. The method or the kit according to item 35, wherein N, is a sequence identical to a stretch of the target nucleic acid sequence comprising the reference NOI sequence. 37. The method or the kit according to any one of the preceding items, wherein the blocking oligonucleotide has the following general structure
5′-(N).sub.a—Z—(N).sub.d—Z—(N).sub.e—Z—(N).sub.b-3′ wherein N is any nucleotide or nucleotide analogue; and Z is a hydrophobic nucleotide as defined in item 1; and the total number of nucleotides or nucleotide analogues is at least 10; and a and b individually are integers in the range of 0 to 4; and d and e individually are integers in the range of 1 to 19; and a+b+d+e at least 10; and (N).sub.a—(N).sub.d—(N).sub.e—(N).sub.b is identical to the reference target sequence. 38. A blocking oligonucleotide having the following general structure
5′-(N).sub.a—Z—(N).sub.f—Z—(N).sub.g—Z—(N).sub.h—Z—(N).sub.b-3′ wherein N is any nucleotide or nucleotide analogue; and Z is a hydrophobic nucleotide as defined in item 1; and a and b individually are integers in the range of 0 to 4; and f, g and h individually are integers in the range of 1 to 18; and a+b+f+g+h is at least 10 and at the most 50; and (N).sub.a—(N).sub.f—(N).sub.g—(N).sub.h—(N).sub.b is identical to a stretch of the target nucleic acid sequence comprising the reference NOI sequence. 39. A blocking oligonucleotide having the following general structure
5′-(N).sub.a—Z—(N).sub.i—Z—(N).sub.j—Z—(N).sub.k—Z—(N).sub.l—Z—(N).sub.b-3′ wherein N is any nucleotide or nucleotide analogue; and Z is a hydrophobic nucleotide as defined in item 1; and a and b individually are integers in the range from 0 to 4; and j, k and l individually are integers in the range from 1 to 17; and a+b+i+j+k+l is at least 10 and at the most 50; and (N).sub.a—(N).sub.i—(N).sub.j—(N).sub.k—(N).sub.l—(N).sub.b is identical to a stretch of the target nucleic acid sequence comprising the reference NOI sequence. 40. A blocking oligonucleotide having the following general structure
5′-(N).sub.a—Z—(N).sub.m—Z—(N).sub.n—Z—(N).sub.o—Z—(N).sub.p—(N).sub.q—Z—(N).sub.b-3′ wherein N is any nucleotide or nucleotide analogue; and Z is a hydrophobic nucleotide as defined in item 1; and a and b individually are integers in the range of 0 to 4; and m, n, o, p and q individually are integers in the range of 1 to 16; and a+b+m+n+o+p+q is at least 10 and at the most 50; and (N).sub.a—(N).sub.m—(N).sub.n—(N).sub.o—(N).sub.p—Z—(N).sub.q—(N).sub.b is identical to a stretch of the target nucleic acid sequence comprising the reference NOI sequence. 41. The method or the kit according to any one of items 1 to 32, wherein the blocking oligonucleotide is the blocking oligonucleotide according to any one of items 37 to 39. 42. The method, the kit or the blocking oligonucleotide according to any one of the preceding items, wherein a is an integer in the range of 0 to 1, for example a is 0. 43. The method, the kit or the blocking oligonucleotide according to any one of the preceding items, wherein b is an integer in the range of 0 to 3, for example b may be 0 or b may be 1. 44. The method, the kit or the blocking oligonucleotide according to any one of the preceding items, wherein at least one intercalator is a flat conjugated system. 45. The method, the kit or the blocking oligonucleotide according to any one of the preceding items, wherein at least one intercalator, Q, is selected from the group consisting of polyaromates and heteropolyaromates optionally substituted with one or more selected from the group consisting of hydroxyl, bromo, fluoro, chloro, iodo, mercapto, thio, cyano, alkylthio, heterocycle, aryl, heteroaryl, carboxyl, carboalkoyl, alkyl, alkenyl, alkynyl, nitro, amino, alkoxyl and amido. 46. The method, the kit or the blocking oligonucleotide according to item 45, wherein the intercalator is selected from the group consisting of benzene, pentalene, indene, naphthalene, azulene, as-indacene, s-indacene, biphenylene, acenaphthylene, Phenalene, heptalene, phenanthrene, fluoranthene, phenanthroline, phenazine, phenanthridine, anthraquinone, pyrene, anthracene, napthene, phenanthrene, flurene, picene, chrysene, naphtacene, acridones, benzanthracenes, stilbenes, oxalo-pyridocarbazoles, azidobenzenes, porphyrins and psoralens and derivatives thereof thereof. 47. The method, the kit or the blocking oligonucleotide according to any one of the preceding items, wherein at least one intercalator, Q, is selected from the group consisting of:
(245) ##STR00031## ##STR00032## 48. The method, the kit or the blocking oligonucleotide according to any one of the preceding items, wherein at least one hydrophobic group is comprising pyrene or pyrido[3′,2′:4,5]thieno[3,2-d]pyrimidin-4(1H)-one or 7,9-dimethyl-pyrido[3′,2′,4,5]thieno[3,2-d]pyrimidin-4(3H)-one. 49. The method, the kit or the blocking oligonucleotide according to any one of the preceding items, wherein all intercalators, Q, are the same. 50. The method, the kit or the blocking oligonucleotide according to any one of the preceding items, wherein at least one backbone monomer unit X is selected from the group consisting of phosphoramidites. 51. The method, the kit or the blocking oligonucleotide according to any one of the preceding items, wherein at least one linker, Y, comprises a chain of x atoms selected from the group consisting of C, O, S, N and P. 52. The method, the kit or the blocking oligonucleotide according to item 51, wherein the chain is substituted with one or more selected from the group consisting of C, H, O, S, N and P. 53. A method of predicting the efficacy of treatment of a clinical condition in an individual in need thereof with a predetermined drug, wherein the efficacy of treatment of said clinical condition with said drug is associated with the presence of a variant sequence, said method comprising the steps of a. providing a sample from said individual b. performing the method according to any one of items 1, 2, 3, 10 to 37 and 41 to 52 to determine the presence of said variant sequence; wherein the presence of said variant sequence is indicative of whether said drug is efficient in treating said clinical condition in said individual. 54. The method according to item 53, wherein the clinical condition is cancer and the variant sequence is an activating mutation in KRAS or NRAS. 55. The method according to item 53, wherein the presence of an activating mutation in KRAS or NRAS is indicative of antibodies to EGFR not being effective for treatment of cancer in said individual. 56. A method of predicting the presence of a clinical condition in an individual in need thereof, wherein said clinical condition is associated with a target nucleic acid sequence comprising a variant sequence, said method comprising the steps of a. providing a sample from said individual b. performing the method according to any one of items 1, 2, 3, 10 to 37 and 41 to 52 to determine the presence of said variant sequence; wherein the presence of said variant sequence is indicative of said individual suffering from said clinical condition. 57. The method according to item 56, wherein the clinical condition is cancer. 58. The method according to any one of items 53 to 57, wherein the variant sequence is a single nucleotide variant. 59. The method according to item 58, wherein the single nucleotide variant is selected from mutations in positions 12, 13, 59, 61, 117 and 146 of KRAS and mutation in positions 12, 13, 61, 117, 148 of NRAS. 60. The method according to any one of items 52 to 58, wherein the mutation is selected from the group of mutations shown in Table 1.
EXAMPLES
(246) The invention is further illustrated by the following examples, which should however not be construed as being limiting for the invention.
(247) As described above, the methods of the invention comprise a step of performing a PCR. Said PCR may be performed in any useful manner e.g. by qPCR. In the following examples, qPCR was performed in 25 μl reactions in KAPA Probe Fast qPCR 2× Master Mix (KAPA Biosystems KM4711) on a Corbett Rotor-Gene 6000 real-time PCR system using 50 ng wild type DNA (Promega G304A) in the absence and presence of approximately 1000 copies of plasmid DNA containing the indicated mutations. The thermocycling conditions used were: 2 min of initial activation of the hotstart taq-polymerase at 95° C., followed by 45 cycles of a 2-step PCR with a 15 sec denaturation step at 94° C. and 60 sec extension step at 60° C.
Example 1
(248) The present invention is based on the use of a blocking oligonucleotide comprising at least two hydrophobic nucleotides as defined in claim 1 and where at least part of the sequence of said blocking oligonucleotide is fully identical to a target nucleic acid sequence comprising a reference NOI sequence. The blocking oligonucleotide may suppress the signal (here measured as the threshold cycle, C.sub.T), wherein suppressing by the blocking oligonucleotide is observed as C.sub.T being delayed/higher. In addition, in some embodiments it is preferred that the sequence of said blocking oligonucleotide analogue is partly but not fully identical to at least the last 3 nucleotides of the 3′ end of at least one of the primers used together with said blocking oligonucleotide (herein referred to as Primer 1). Three examples of useful design of the blocking oligonucleotide are described below. The first example illustrated in
(249)
(250) Said Blocking oligonucleotide can also be partly but not fully identical to a larger portion of said primer 1. Thus, in one embodiment of the invention the 5′ end of primer 1 is identical to a consecutive stretch of the target nucleic acid sequence of for example in the range of 10 to 25 nucleotides, typically 10 to 20 nucleotides and the middle part is in addition also identical to a consecutive stretch of the blocking sequence. This part may for example consist of in the range of 3 to 8 nucleotides. The 3′ end may consist of a mismatch followed by a few nucleotides (e.g. 1 to 3 nucleotides) identical to a stretch of the target nucleic acid sequence. The very 3′ nucleotide(s) of primer 1 may be identical to the variant sequence.
(251)
(252) However, the overlap between primer 1 and the blocking oligonucleotide can also be less. This is illustrated in
(253)
Example 2
Blocking Oligonucleotide Increases Specificity in Simplex Reactions
(254) In this example, we illustrate how the addition of a blocking oligonucleotide according to the present invention can increase the specificity, ΔC.sub.T, of a PCR (measured as the C.sub.T from a target nucleic acid sequence comprising the variant sequence minus the C.sub.T when there is only reference target sequence present, background signal).
(255) The present example is illustrating how addition of a blocking oligonucleotide according to the present application identical to the reference sequence comprising the wild type (WT) version of codon 59 of NRAS (Ala59) can remove the signal (C.sub.T, WT) from a WT template, while at the same time only have minimal effect on the signal (measured as C.sub.T, NRASA59D) from the variant sequence comprising a NRAS Ala59Asp (A59D) mutation (see
(256)
(257) In the sequence of the blocking oligonucleotide (NRAS 59 BaseBlocker), Z indicates a hydrophobic nucleotide. The hydrophobic nucleotide has a phosphoramidit backbone connected to pyrene via a linker.
(258) Similar experiments were made using a variety of different primers and blocking oligonucleotides for detecting the mutations indicated in
(259) In a similar example, we illustrate how addition of a blocking oligonucleotide according to the present invention identical to the WT sequence comprising codon 13 of NRAS (Gly13) can suppress amplification from a WT template as seen as delayed or absent signal at the threshold (C.sub.T, WT), with minimal effect on the amplification (C.sub.T, NRASG13D) from the template comprising a NRAS Gly13Asp (G13D) mutation (see
(260)
(261) It s not always possible to design a Blocking oligonucleotide that will totally remove the signal from one template while leaving a template with as little as one base pair change unaffected. However, a well designed Blocking oligonucleotide according to the present invention, should be able to significantly inhibit the amplification of the reference NOI sequence over the variant sequence under given conditions.
Example 3
Blocking Oligonucleotide Increases Specificity Towards a Certain Variant Sequence in a Simplex Reaction
(262) A Blocking oligonucleotide as described in the present invention may also be used to increase specificity of a PCR reaction towards a particular variant sequence. Thus, in the example illustrated in
(263)
Example 4
Blocking Oligonucleotide Increases Specificity of a Multiplex Reaction
(264) In this example, we illustrate how the addition of a Blocking oligonucleotide according to the present invention can increase the specificity, ΔC.sub.T, (measured as the C.sub.T from a target in question minus the C.sub.T when said target is absent, background signal) in multiplex reactions.
(265) The present example is illustrating how addition of a Blocking oligonucleotide identical to the WT sequence comprising codon 59 (Ala59) and codon 61 (Gln61) of KRAS can reduce the signal (C.sub.T, WT) from a WT template significantly while only having a minimal effect on the C.sub.T, KRAS A59G, C.sub.T, KRAS Q61K and C.sub.T, KRAS Q61L from target nucleic acid sequences comprising KRAS Ala59Gly (A59G), Gln61Lys (Q61K) and Gln61Leu (Q61L) mutations respectively (
(266)
(267) In a similar example, we illustrate how addition of a Blocking oligonucleotide identical to the WT sequence comprising codon 61 of NRAS (Gln61) can remove the signal (C.sub.T, WT) from a WT template with minimal effect on the C.sub.T, NRAS Q61H1, C.sub.T, NRAS Q61H2 and C.sub.T, NRAS Q61L from the template comprising a NRAS Gln61His.sup.A>C (Q61H1), Gln61His.sup.A>T (Q61H2) and Gln61Leu (Q61L) mutations in a multiplex reaction respectively (
(268)
Example 5
Assays Designed in Accordance to the Present Invention Show Extremely High Sensitivity
(269) Assays were designed in accordance to present invention and evaluated with respect to sensitivity towards the mutant template containing the variant sequence in a background of wild type template DNA. Each assay consists of an allele-specific primer set, a HydrolEasy™ hydrolysis probe and a blocking oligonucleotide according to the present invention. The primer set consists of a wild type primer (Primer 2) and an allele-specific primer comprising one mismatch (Primer 1). The Blocking oligonucleotide overlaps with the allele-specific primer and blocks amplification of wild type DNA.
(270)
(271) TABLE-US-00003 Well Fluorophore Target Content Sample Cq C01 FAM M2 Unkn 100 V 26, 37 C02 FAM M2 Unkn 10 V 29, 63 C03 FAM M2 Unkn 1 V 33, 27 C04 FAM M2 Unkn 0.5 V 33, 66 C05 FAM M2 Unkn 0.1 V 35, 58 C06 FAM M2 Unkn 0.05 V 36, 50 C07 FAM M2 Unkn 0.01 V 36, 89 C08 FAM M2 Unkn 0 38, 79
(272) Table 2. Quantification cycle (Cq) values for G12V detection in a multiplex qPCR reaction when setting the threshold to RFU=1,000. It can be seen that the more diluted the mutated sample is, the higher the Cq value gets. Furthermore, it is obvious from above results that it is possible to detect a very low amount (0.01%) of DNA comprising a single point mutation in 50 nG total DNA input, with a signal that is significantly different from when no mutation is present (100% wild type).
Example 6
Comparison with Other Tests
(273) Three different clinical studies were performed to compare the performance of the present method, termed SensiScreen®, to 4 common methods for detection of KRAS exon 2 mutation testing. Formalin-fixed paraffin-embedded DNA from three different patient populations with histologically confirmed colorectal cancer was analysed for the presence of 7 clinically relevant mutations in KRAS exon 2 codons 12 and 13.
(274) Cobas®
(275) The cobas® KRAS Mutation Test, (Roche Molecular Diagnostics), for use with the cobas® 4800 System, is a real-time PCR test intended for the identification of mutations in codons 12, 13 and 61 of the KRAS gene in DNA derived from formalin-fixed, paraffin-embedded human colorectal cancer (CRC) tissue. In formalin-fixed, paraffin-embedded tissue (FFPET), the cobas® KRAS Mutation Test can detect <5% mutant sequence copies in a background of wild-type DNA.
(276) Direct Sequencing
(277) Direct sequencing, also known as Sanger sequencing, is considered the gold-standard DNA sequencing method. Direct sequencing is based on the selective incorporation of chain-terminating dideoxynucleotides by DNA polymerase during in vitro DNA replication. In the dye-terminator method variant, each of the four chain terminating dideoxynucleotides is labelled with a specific fluorescent dye which emits light at distinct wavelengths. The mutational analyses of KRAS exon 2 by direct sequencing were performed using an ABI3130 Genetic Analyzer (Applied Biosystems) and evaluated with Sequencing Navigator Software (Applied Biosystems).
(278) Therascreen
(279) The therascreen KRAS test (Qiagen) is an FDA-approved test for KRAS mutation detection, therascreen is a real-time PCR test that performs allele-specific amplification using the amplification-refractory mutation system (ARMS) principle of allele-specific PCR scorpion primers that are covalently linked to a probe. The therascreen provides 8 separate PCR amplification reactions: 7 mutation-specific reactions in codons 12 and 13 of exon 2 of the KRAS oncogene, and a wild-type control in exon 4.
(280) Mutant-Enriched PCR
(281) Mutant-enriched PCR combines PCR amplification with restriction enzyme digestion to enrich for mutant alleles, while wt alleles are eliminated by digestion. Analyses of KRAS exon 2 mutations by mutant-enriched PCR were performed by introducing a restriction site, BstNI or BglI for codon 12 or 13, respectively, during the first PCR step, localized in the immediate vicinity of the K-ras codon to distinguish between wild-type and mutant sequences. Wild-type amplicons were then digested by BstNI or BglI restriction enzyme, whereas mutant products were enriched for a second round of amplifications. ME-PCR products were subsequently subjected to automated sequencing on an ABI PRISM 3130 Genetic Analyzer (Applied Biosystems).
(282) The results of the comparative studies can be seen in