IMMUNOMODULATING AND IMMUNOSTIMULATING POLYPEPTIDES FOR DRUG-DELIVERY

20210093716 · 2021-04-01

    Inventors

    Cpc classification

    International classification

    Abstract

    The present invention relates to modified bacterial polypeptides having immunomodulatory and immunostimulatory activity. Most specifically, the present invention relates to modified bacterial polypeptides having an amino acid sequence selected from SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 3, SEQ ID NO. 4 and SEQ ID NO. 5. The modified polypeptides are the adjuvant components of a pharmaceutical composition for eliciting an immune response against an specific antigen present in the pharmaceutical composition. In a preferred embodiment, the invention provides a pharmaceutical composition for a vaccine which comprises an adjuvant component which is any one of the modified polypeptides, one or more antigens, together with a pharmaceutically acceptable excipient.

    Claims

    1. An immunomodulating and immunostimulating polypeptide having an amino acid sequence selected from SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 3, SEQ ID NO. 4 and SEQ ID NO. 5.

    2-31. (canceled)

    32. A pharmaceutical composition comprising (i) a polypeptide according to claim 1, and optionally (ii) a pharmaceutically acceptable excipient.

    33. A pharmaceutical composition comprising (i) a polypeptide according to claim 1, (ii) one or more antigens and optionally (iii) a pharmaceutically acceptable excipient.

    34. The pharmaceutical composition according to claim 33, wherein the antigen is selected from viral, bacterial, fungal, parasitic tumor-derived antigens, self-antigens and allergens.

    35. The pharmaceutical composition according to claim 32, wherein the composition is in a form selected from oral composition and parenteral composition.

    36. A vaccine comprising (i) a polypeptide according to claim 1, (ii) an antigen selected from viral, bacterial, fungal, parasitic and tumor-derived antigens, and optionally (iii) a pharmaceutically acceptable vehicle, wherein the vaccine is the form of an oral composition.

    37. A nucleic acid sequence encoding a polypeptide according to claim 1, the nucleic sequence being selected from SEQ ID NO.6 to SEQ ID NO.10.

    38. A vector comprising the nucleic acid sequence according to claim 37.

    39. A host cell transformed or transfected with the nucleic acid sequence as defined in claim 37, wherein the host cell is a prokaryote or a eukaryotic host cell, such as yeast, fungi, insect or mammalian cell.

    40. The polypeptide as defined in claim 1, for use as an adjuvant for vaccine compositions against an antigen.

    41. The polypeptide as defined in claim 1, wherein the amino acid sequence is SEQ ID NO. 1, for use as an antigen in pharmaceutical compositions.

    42. The polypeptide as defined in claim 1, for use as immunomodulator in pharmaceutical compositions.

    43. The polypeptide as defined in claim 1, for use as a drug-delivery agent for antigens in pharmaceutical compositions or vaccine compositions, wherein said polypeptide is an immunomodulating and immunostimulating polypeptide that enhances a half-life of an antigen in said composition.

    44. A method for enhancing the immune response against an antigen in a subject, comprising administering to said subject an effective amount of the vaccine of claim 36.

    45. A method for modulating the immune response against an antigen in a subject, comprising administering to said subject an effective amount of the vaccine of claim 36.

    46. A method for inducing protective immunity to an antigen in a subject, comprising administering to said subject at least one dose of an effective amount of a polypeptide of claim 1.

    47. A method for inducing protective immunity to an antigen in a subject, comprising administering to said subject at least one dose of an effective amount of said antigen and an effective amount of a polypeptide of claim 1.

    48. A method for inducing protective immunity in a subject, comprising administering to said subject at least one dose of an effective amount of a polypeptide of claim 1.

    49. A method for stimulating or modulating the immune response in a subject, comprising administering to said subject an effective amount of the vaccine of claim 36.

    50. The pharmaceutical composition according to claim 33, wherein the composition is in a form selected from oral composition and parenteral composition.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0037] FIG. 1 depicts a circle map of a pET-22b(+) Vector (Novagen) used in Example 1 to obtain the final expression vectors. The pET-22b(+) vector carries an N-terminal pelB signal sequence for potential periplasmic localization, plus optional C-terminal His⋅Tag® sequence. Unique sites are shown on the circle map. The sequence is numbered by the pBR322 convention, so the T7 expression region is reversed on the circular map.

    [0038] FIGS. 2A-2B show a picture of a SDS-PAGE (2A) wherein purified polypeptides were stained with Coomassie Blue; and a Western Blot (2B) where a monoclonal antibody anti-His-Tag was used to determine the identity of the proteins. Lanes correspond to: M: molecular weight markers, 1: modified Ecotin, 2: modified Aprin, 3: modified Staphostatin A, 4: modified Staphostatin B and 5: modified Y Inhibitor.

    [0039] FIGS. 3A-3B show the production of pro-inflammatory cytokines in culture supernatants of dendritic cells (DCs). Bone marrow derived DCs from BALB/c mice were incubated with OVA alone or OVA plus different concentrations of each polypeptide of Table 1 (1, 10 or 50 μg/ml) and the production of pro-inflammatory cytokines in culture supernatants was evaluated by ELISA. Production of IL-6 (3A) and TNF-α (3B) is shown in pg/ml.

    [0040] FIG. 4 illustrates the production of pro-inflammatory cytokines in culture supernatants of BMDCs. BMDCs from C3H/HeJ mice were incubated with different concentrations of each polypeptide of Table 1 (25, 50 or 100 μg/ml) and the production of pro-inflammatory cytokines in culture supernatants was evaluated by ELISA. Production of IL-6 is shown in pg/ml.

    [0041] FIGS. 5A-5B show the production of pro-inflammatory cytokines in culture supernatants of dendritic cells (DCs). Bone marrow-derived DCs from C57BL/6 mice were incubated with different concentrations of each polypeptide of Table 1 (10, 50 o 100 μg/ml) and the production of pro-inflammatory cytokines in culture supernatants was evaluated by ELISA. Production of TNF-α (5A) and IL-6 (5B) is shown in pg/ml.

    [0042] FIG. 6 shows the production of IFN-γ by specific CD4.sup.+ T cells, measured by flow cytometry. BMDCs from BALB/c mice were incubated with medium (RPMI), OVA alone or OVA plus different concentrations of each polypeptide of Table 1, then washed and co-cultured with splenocytes from D011.10 transgenic mice. Cells were treated with brefeldin A. Afterward cells were harvested and stained with specific antibodies anti-CD4, fixed, permeabilized and stained intracellularly with anti-IFN-γ Ab. Results are expressed as percentage of CD4.sup.+ T cell producing IFN-γ.

    [0043] FIGS. 7A-7D show Ag-specific antibody responses induced after oral co-administration of modified Ecotin, Aprin, Staphostatin A or Staphostatin B polypeptides with CTB as Ag. BALB/c mice were immunized on days 0, 7 and 14. Specific antibody responses (anti-CT IgA and IgG) at feces and serum were evaluated by ELISA at 7 days after second immunization. Results are expressed as Vmax (mean±SD) (mili units/min).

    [0044] FIGS. 8A-8D show Ag-specific antibody responses induced after oral co-administration of modified Ecotin, Aprin, Staphostatin A or Staphostatin B polypeptides with CTB as Ag. BALB/c mice were immunized on days 0, 7 and 14. Specific antibody responses (anti-CT IgA and IgG) at feces and serum were evaluated by ELISA at 7 days after third immunization. Results are expressed as Vmax (mean±SD) (mili units/min).

    [0045] FIG. 9 shows Ag-specific antibody responses induced after oral co-administration with modified polypeptides of the invention. Specific antibody responses anti-Ecotin IgG, anti-Aprin IgG, anti-Staphostatin A IgG, anti-Staphostatin B IgG and anti-Y Inhibitor IgG were evaluated at different time points by ELISA. Results are expressed as Optical density at 450 nm.

    [0046] FIGS. 10A-10B show Delayed-type hypersensitivity (DTH) response to TT in mice immunized with TT plus each polypeptide of Table 1. TT was injected into one footpad, and saline was injected into the contralateral footpad, as a negative control. The thickness of both footpads was measured 48 (10A) and 72 h (10B) later and the increment between TT and saline injected was plotted.

    [0047] FIG. 11 shows in vivo proliferation of CD4.sup.+ T cells. CD4.sup.+ T cells from D011.10 were labeled with CFSE and transferred to WT BALB/c mice. Mice were orally administered with saline, OVA or OVA plus each polypeptide of Table 1. Three days later spleens were obtained and cell suspensions were analyzed by flow cytometry for CFSE dilution. Data are represented as percentage of CD4.sup.+ CFSE.sup.+ proliferative T cells (mean±SD).

    [0048] FIGS. 12A-12D illustrate in vivo proliferation of CD8.sup.+ T cells. Spleen cells from OT1 mice were labeled with CFSE and transferred to WT C57BL/6 mice. Mice were orally administered with saline, OVA or OVA plus each polypeptide of Table 1. Three days later spleens and MLNs were obtained and cell suspensions were analyzed by flow cytometry for CFSE dilution. Results are shown as dot plots and representative histograms (FIG. 12 A and FIG. 12 B) and bar graph (FIGS. 12C-12D). Data are represented as the percentage of CD8.sup.+ CFSE.sup.+ proliferative T cells.

    [0049] FIGS. 13A-13B illustrate reduction of Ag susceptibility to proteolysis within cells at Peyer's Patches (PPs) (13A) and Mesenteric Lymph Nodes (MLNs) (13B). Mice (n=3/group) were i.g. administered once with OVADQ plus i) buffer, ii) modified Ecotin, iii) modified Aprin, or iv) modified Y Inhibitor. Ag status was determined by detection of fluorescence in a fluorimeter. Fluorescence increase is proportional to Ag degradation. Results are expressed as mean fluorescence intensity (arbitrary units=a.u.)±SEM.

    [0050] FIG. 14 illustrates protection of Ag from intestine extracts digestion by the modified Ecotin, Aprin, Staphostatin A, Staphostatin B and Y inhibitor polypeptides. Inhibitor cocktail and BSA were positive and negative controls respectively. The substrate casein BODIPY FL was added and the fluorescence intensity measured in a fluorescence plate reader. Results are shown as mean % of proteolytic activity±SEM. ***P<0.001 vs BSA group.

    [0051] FIG. 15 illustrates protection of Ag from stomach extracts digestion by the modified Ecotin, Aprin, Staphostatin A, Staphostatin B and Y inhibitor polypeptides. Inhibitor cocktail and BSA were positive and negative controls respectively. The substrate casein BODIPY FL was added and the fluorescence intensity measured in a fluorescence plate reader. Results are shown as mean % of proteolytic activity±SEM. **P<0.01,***P<0.001 vs BSA group.

    [0052] FIG. 16 illustrates protection of Ag from pancreatin digestion by the modified Ecotin, Aprin, Staphostatin A, Staphostatin B and Y inhibitor polypeptides. Inhibitor cocktail and BSA were positive and negative controls respectively. The substrate casein BODIPY FL was added and the fluorescence intensity measured in a fluorescence plate reader. Results are shown as mean % of proteolytic activity±SEM. *P<0.05, **P<0.01, ***P<0.001 vs BSA group.

    [0053] FIGS. 17A-17B show protection induced by Ecotin polypeptide against Salmonella infection. The results are represented as amount of CFU per gram of tissue at spleen (17A) and liver (17B) of BALB/c mice immunized at days 0, 15 and 30, either intragastrically with physiologic solution (SF), Ecotin (100 μg), Ecotin (100 μg)+CT (10 μg), Ecotin (100 μg)+U-Omp19 (150 μg), or intraperitoneally with Ecotin (20 μg) plus Freund Incomplete adjuvant-FIA-(100 μL).

    DETAILED DESCRIPTION OF THE INVENTION

    [0054] The present application discloses modified polypeptides which show immunomodulating and immunostimulating properties. Said modified polypeptides are recombinant polypeptides of bacterial origin.

    [0055] As used herein, the terms “immunomodulating”, “immunomodulation” refer to agents that alter the immune response by suppression (immunosuppressive) or enhancement (immunostimulant). An immunomodulator may be defined as any biological or synthetic substance that can stimulate/suppress either innate or adaptive or both arms of the immune system.

    [0056] The present inventors have shown that the modified polypeptides of the invention can induce the activation of Dendritic Cells (DCs). Thus, according to a particular embodiment, the polypeptides of the invention are formulated in pharmaceutical compositions for modulating immune responses.

    [0057] According to another embodiment the modified polypeptides of the invention are the adjuvant components of a pharmaceutical composition for eliciting an immune response against the specific antigen present in the pharmaceutical composition.

    [0058] As used herein, the term “adjuvant” refers to substances that, incorporated to the antigen (Ag) or simultaneously administered with it, induce a more effective immune response against the antigen. They may be used to enhance the immune response against an Ag in several ways: they can enhance the magnitude of the immune response against a weak Ag; increase the rate and duration of the immune response, modulate antibody (Ab) avidity; isotypes or subclass distribution; stimulate and modulate the cellular immune response; promote the induction of local immune response (e.g., mucosa); decrease the amount of necessary Ag and reduce the vaccine cost; or they may help in avoiding Ag competence which exists in combined vaccines (21).

    [0059] Adjuvant-mediated enhancement of the immune response can be assessed by any method known in the art, including without limitation one or more of the following: (i) an increase in the number of antibodies produced in response to immunization with the adjuvant/antigen combination versus those produced in response to immunization with the antigen alone; (ii) an increase in the number or activation state of T cells recognizing the antigen or the adjuvant; (iii) an increase in the level of one or more cytokines; and (iv) in vivo protection after live challenge.

    [0060] An immune response is believed to be enhanced, if any measurable parameter of antigen-specific immunoreactivity (e.g., antibody titer or T cell production) is increased at least 10% when a subject is challenged with an antigen and adjuvant compared to a subject challenged with the antigen alone. In certain embodiments of the present invention, an immune response is enhanced if any measurable parameter of antigen-specific immunoreactivity is increased by at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 90%, at least 95%, at least 100%, at least 125%, at least 150%, at least 175%, at least 200%, at least 225%, at least 250%, at least 275%, at least 300%, at least 350%, at least 400%, at least 450%, at least 500%, or at least 1000%.

    [0061] A non-specifically immune response is believed to be enhanced, if any measurable parameter of immunoreactivity (e.g. cytokine production) is increased by at least 10% in a subject who is administered a polypeptide of the invention without administering an antigen. In certain embodiments of the present invention, an immune response is enhanced if any measurable parameter of immunoreactivity is increased by at least at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 90%, at least 95%, at least 100%, at least 125%, at least 150%, at least 175%, at least 200%, at least 225%, at least 250%, at least 275%, at least 300%, at least 350%, at least 400%, at least 450%, at least 500%, or at least 1000%, in a subject who is administered a polypeptide of the invention without administering an antigen.

    [0062] The term “antigen”, as used in the present invention, is a substance or molecule capable of eliciting an immune response and generating (specific) antibodies or cellular responses against it.

    [0063] As used herein, an “immunogen” is an antigen or any substance that may be specifically recognized by components of the immune system, such as antibodies or lymphocytes. Thus, an immunogen is capable of inducing an immune response, either antibodies or cellular.

    [0064] Therefore, for the purposes of present invention, the term “immunogen” and “antigen” have the same meaning and are defined as any substance against which, in an immunocompetent organism, antibodies or a cellular immune response may be induced. Accordingly, both terms may be used interchangeably herein, i.e., antigen is considered a synonym of immunogen in the present application.

    [0065] According to a preferred embodiment, the antigen is selected from the group of pathogen-derived antigens, tumor cell antigens, self-antigens and allergens. Pathogen-derived antigens may be from bacteria, virus, parasites or fungi.

    [0066] According to a preferred embodiment, the pathogen-derived antigen is selected from the group of viral antigens, bacterial antigens, parasitic antigens or fungal antigens.

    [0067] As used herein, a self-antigen is an endogenous antigen that is recognized as non-self, but to which the healthy immune system of the parent organism is tolerant.

    [0068] As used herein, an allergen is a type of antigen capable of inducing an allergy.

    [0069] In additional embodiments, the invention relates to a vaccine composition comprising a) one or more polypeptides described herein, b) an antigen, and c) a pharmaceutically acceptable carrier or diluent, wherein the amounts of a) and b) in combination are effective to elicit an immune response.

    [0070] A vaccine is any pharmaceutically acceptable preparation used as preventive or therapeutic administration to confer immunity against a specific disease.

    [0071] As used herein, a “vaccine composition” is a biological preparation that provides active acquired immunity to a particular disease. In other words, a vaccine can be used to elicit protective immunity in a recipient. Thus, after a subject has been vaccinated with an antigen, a vaccine prevents, delays, or lessens the severity of the development of a disease in the subject exposed to the same or a related antigen in relation to a non-vaccinated subject. Protective immunity provided by a vaccine can be humoral (antibody-mediated) immunity or cellular immunity, or both. Vaccination may, e.g., eliminate or reduce the load of a pathogen or infected cells, or produce any other measurable alleviation of an infection. Vaccination may also reduce a tumor burden in an immunized (vaccinated) subject.

    [0072] A vaccine typically contains an agent that resembles a disease-causing organism, and is often made from killed or weakened disease-causing organisms (or crucial fragments, products or derivatives). Typically, a vaccine is a suspension containing live, attenuated, modified, or killed organisms (or their toxins), or tumor antigens, which upon administration into the body stimulates the immune system to produce antigen-specific immune responses, antibodies and/or cellular immune mechanisms.

    [0073] In a further aspect, the present invention relates to a nucleic acid sequence encoding a polypeptide of the invention. The term “nucleic acid” is well known to the skilled person and encompasses DNA (such as cDNA) and RNA (such as mRNA). The nucleic acid can be either double stranded or single stranded, linear or circular. Said nucleic acid molecule is preferably comprised in a vector which is preferably comprised in a host cell. Said host cell is, e.g. after transformation or transfection with the nucleic acid sequence of the invention, capable of expressing the polypeptides. For that purpose, the nucleic acid molecule is operatively linked with control sequences.

    [0074] In a further aspect, the present invention relates to vectors. A vector is a nucleic acid molecule used as a vehicle to transfer (foreign) genetic material into a cell. The term “vector” encompasses—but is not restricted to—plasmids, viruses, cosmids and artificial chromosomes. In general, engineered vectors comprise an origin of replication, a multiple cloning site and a selectable marker. The vector itself is generally a nucleotide sequence, commonly a DNA sequence that comprises an insert (transgene) and a larger sequence that serves as the “backbone” of the vector.

    [0075] Modern vectors may encompass additional features besides the transgene insert and a backbone: promoter, genetic marker, antibiotic resistance, reporter gene, targeting sequence, protein purification tag. Vectors called expression vectors (expression constructs) specifically are for the expression of the transgene in the target cell, and generally have control sequences such as a promoter sequence that drives expression of the transgene. Insertion of a vector into the target cell is usually called “transformation” for bacterial cells, “transfection” for eukaryotic cells, although insertion of a viral vector is also called “transduction”.

    [0076] In the present invention, sequences were digested with NdeI and XhoI restriction enzymes and cloned into pET22b(+) vector (Novagen) to obtain the final expression vectors. Obtained vectors were used to transform E. coli BL21 (DE3) competent cells (Novagen; Genotype: F-ompT hsdSB (rB-mB-) gal dcm (DE3)).

    [0077] Other plasmids may also be used for introducing the nucleotide sequences of interest into the expression vectors, such as, for example: Pet-12a, pET-20b(+), etc. Also, other expression systems may be used for the expression of the polypeptides, such as, prokaryotic or eukaryotic protein expression systems (i.e. bacteria, yeast, plant-, insect- or mammalian-cells systems) even cell-free systems (i.e E. coli extracts, germ wheat extracts). Additionally, depending on the selected expression system and the final formulation sequences may be cloned in other vectors for each expression system.

    [0078] As used herein, the term “host cell” is intended to refer to a cell into which a nucleic acid encoding a polypeptide of the invention is introduced by transformation, transfection and the like. It should be understood that such terms refer not only to the particular subject cell but to the progeny or potential progeny of such cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term as used herein.

    [0079] The terms “host cell,” “target cell” or “recipient cell” are intended to include any individual cell or cell culture that can be or has/have been recipients for vectors or the incorporation of exogenous nucleic acid molecules, polynucleotides and/or proteins. It also is intended to include progeny of a single cell, and the progeny may not necessarily be completely identical (in morphology or in genomic or total DNA complement) to the original parent cell due to natural, accidental, or deliberate mutation. The cells may be prokaryotic or eukaryotic, and include but are not limited to bacterial cells, yeast cells, animal cells, and mammalian cells, e.g., murine, rat, macaque or human.

    [0080] Suitable host cells include prokaryotes and eukaryotic host cells including yeasts, fungi, insect cells and mammalian cells. Preferably, the host cell is the BL21 DE3 strain from E. coli. These cells are chemically competent E. coli cells suitable for transformation and protein expression obtained from Novagen.

    [0081] In an alternative embodiment, compositions are provided comprising a polypeptide of the invention, or produced according to the process of the invention.

    [0082] The particularly preferred pharmaceutical composition of this invention comprises one or more polypeptides of the invention. Preferably, the pharmaceutical composition comprises suitable excipients or vehicles. In a preferred embodiment, the pharmaceutical composition comprises a composition for oral administration.

    [0083] According to another embodiment a composition for inducing an immune response to any antigen is provided, the composition comprising one or more polypeptides of the invention or produced according to the process of the invention. Preferably, the composition is a pharmaceutical composition.

    [0084] As used herein, the term “pharmaceutical composition” relates to a composition for administration to a subject.

    [0085] Subject, as used herein, “a subject” means any animal subject, including mammalian subjects, such as humans and domestic mammals.

    [0086] As disclosed herein, the polypeptides of the invention may be administered in conjunction with any biologically relevant antigen, such that an increased immune response to said antigen is achieved. In a preferred embodiment, the modified polypeptides of the invention and the chosen antigen are administered simultaneously in a pharmaceutical composition comprising an effective amount of the polypeptide and an effective amount of the chosen antigen. The mode of administration is preferably oral. The respective amounts of polypeptide and antigen will vary depending upon the identity of the antigen employed and the species of animal to be immunized. Thus, the vaccine preparation compositions of the present invention may be prepared by mixing the above mentioned antigens with the claimed polypeptides at a desired ratio. The preparation should be conducted strictly aseptically, and each component should also be aseptic. Naturally, any pyrogens or allergens should be removed as completely as possible.

    [0087] In some embodiments, the compositions of the present invention comprise one or more pharmaceutically acceptable carriers or excipients. Excipients include any component that does not itself induce the production of antibodies and is not harmful to the subject receiving the composition. Suitable excipients are typically large, slowly metabolized macromolecules such as proteins, saccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, sucrose, trehalose, lactose and lipid aggregates (such as oil droplets or liposomes). Suitable pharmaceutical carriers are well known to those of ordinary skill in the art, including, but not limited to, diluents, such as water, saline, glycerol, and others. Suitably, sterile pyrogen-free, phosphate buffered physiologic saline is a pharmaceutical carrier. Additionally, additives, such as wetting or emulsifying agents, pH buffering substances, and the like, may be present. Vaccines of the present technology are formulated into suitable dosage for the subject to which it is to be administered. The dosage administered may vary with the condition, sex, weight and age of the individual; the route of administration; and the antigen used. The vaccine may be used in dosage forms such as suspensions or liquid solutions. The vaccine may be formulated with a pharmaceutically acceptable carrier as described above.

    [0088] Vaccines of the present invention may be in an aqueous form, for example, but not limited to, solutions, particles or suspensions. The vaccine can be an oil and water emulsion, such as an oil-in-water emulsion or a water-in-oil emulsion. Liquid formulations allow the compositions to be prepackaged and administered direct from their packaged form without the need for reconstitution. Compositions may be presented in vials.

    [0089] The compositions of the present invention can be combined with either a liquid or solid pharmaceutical carrier, and the compositions can be in the form of tablets, capsules, powders, granules, suspensions, syrups, solutions, particularly water solutions. The compositions can also contain suitable preservatives, coloring and flavoring agents, or agents that produce slow release. Potential carriers that can be used in the preparation of the pharmaceutical compositions of this invention include, but are not limited to, gelatin capsules, sugars, cellulose derivations such as sodium carboxymethyl cellulose, gelatin, talc, magnesium stearate, vegetable oil such as peanut oil, etc., glycerin, sorbitol, agar and water. Carriers may also serve as a binder to facilitate tableting of the compositions for convenient oral administration.

    [0090] The vaccine preparation composition of this invention may be maintained in a stable storage form for ready use by lyophilization or by other means well known to those skilled in the art. For oral administration, the vaccine preparation may be reconstituted as a suspension in buffered saline, milk, or any other physiologically compatible liquid medium. The medium may be made more palatable by the addition of suitable coloring and flavoring agents as desired.

    [0091] The term “and/or” wherever used herein includes the meaning of “and”, “or” and “all or any other combination of the elements connected by said term”.

    [0092] The term “about” or “approximately” as used herein means within ±20%, preferably within ±15%, more preferably within ±10%, and most preferably within ±5% of a given value or range.

    [0093] Unless otherwise indicated, the term “at least” preceding a series of elements is to be understood to refer to every element in the series. Those skilled in the art will recognize or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the present invention.

    [0094] Throughout this specification and the claims which follow, unless the context requires otherwise, the word “comprise”, and variations such as “comprises” and “comprising”, will be understood to imply the inclusion of any element, step, or ingredient not specified in the claim element. When used herein the term “comprising” can be substituted with the term “containing” or “including” or sometimes when used herein with the term “having”.

    [0095] When used herein “consisting of” excludes any element, step, or ingredient not specified in the claim element. When used herein, “consisting essentially of” does not exclude materials or steps that do not materially affect the basic and novel characteristics of the claim.

    [0096] In each instance herein, any of the terms “comprising”, “consisting essentially of” and “consisting of” may be replaced with either of the other two terms.

    [0097] The present application is better illustrated with the following examples, which should not be construed as limiting the scope of the invention. Rather, it should be understood that modifications and equivalents to such exemplary embodiments may be suggested by those skilled in the art, upon reading the present invention, without departing from the spirit and scope of the present application and the attached claims.

    [0098] Items

    [0099] The invention may further be described by the following items:

    [0100] 1. An immunomodulating and immunostimulating polypeptide having an amino acid sequence selected from SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 3, SEQ ID NO. 4 and SEQ ID NO. 5.

    [0101] 2. A polypeptide according to item 1, wherein the amino acid sequence is SEQ ID NO. 1.

    [0102] 3. A polypeptide according to item 1, wherein the amino acid sequence is SEQ ID NO. 2.

    [0103] 4. A polypeptide according to item 1, wherein the amino acid sequence is SEQ ID NO. 3.

    [0104] 5. A polypeptide according to item 1, wherein the amino acid sequence is SEQ ID NO. 4.

    [0105] 6. A polypeptide according to item 1, wherein the amino acid sequence is SEQ ID NO. 5.

    [0106] 7. A pharmaceutical composition comprising (i) a polypeptide according to any one of items 1-6, and optionally (ii) a pharmaceutically acceptable excipient.

    [0107] 8. A pharmaceutical composition comprising (i) a polypeptide according to any one of items 1-6, (ii) one or more antigens and optionally (iii) a pharmaceutically acceptable excipient.

    [0108] 9. The pharmaceutical composition according to item 8, wherein the antigen is selected from viral, bacterial, fungal, parasitic tumor-derived antigens, self-antigens and allergens.

    [0109] 10. The pharmaceutical composition according to any one of items 7 to 9, in the form of an oral composition.

    [0110] 11. The pharmaceutical composition according to any one of items 7 to 9, in the form of a parenteral composition.

    [0111] 12. A vaccine comprising (i) a polypeptide according to any one of items 1-6, (ii) an antigen, and optionally (iii) a pharmaceutically acceptable excipient.

    [0112] 13. The vaccine according to item 12, wherein the antigen is selected from viral, bacterial, fungal, parasitic and tumor-derived antigens.

    [0113] 14. The vaccine according to any of items 12 or 13, in the form of an oral composition.

    [0114] 15. A nucleic acid sequence encoding a polypeptide according to any one of items 1-6, the nucleic sequence being selected from SEQ ID NO. 6 to SEQ ID NO. 10.

    [0115] 16. A vector comprising a nucleic acid sequence according to item 15.

    [0116] 17. A host cell transformed or transfected with the nucleic acid sequence as defined in item 15 or with the vector as defined in item 16, wherein the host cell is a prokaryote or a eukaryotic host cell, such as yeast, fungi, insect or mammalian cell.

    [0117] 18. The polypeptide as defined in any one of items 1-6, for use as an adjuvant for vaccine compositions against an antigen.

    [0118] 19. A polypeptide of SEQ ID NO. 1, for use as an antigen in pharmaceutical compositions.

    [0119] 20. The polypeptide as defined in any one of items 1-6, for use as immunomodulator in pharmaceutical compositions.

    [0120] 21. The polypeptide as defined in any one of items 1-6, for use as a drug-delivery agent for antigens in vaccine compositions, wherein said polypeptide is an immunomodulating and immunostimulating polypeptide that enhances a half-life of an antigen in a vaccine composition.

    [0121] 22. The polypeptide as defined in any one of items 1-6, for use as a drug-delivery agent in pharmaceutical compositions.

    [0122] 23. A method for enhancing the immune response against an antigen in a subject, comprising administering to said subject an effective amount of the pharmaceutical composition of any of items 7 to 11 or of a vaccine of any items 12 to 14.

    [0123] 24. A method for modulating the immune response against an antigen in a subject, comprising administering to said subject an effective amount of the pharmaceutical composition of any of items 7 to 11 or of a vaccine of any items 12 to 14.

    [0124] 25. A method for inducing protective immunity to an antigen in a subject, comprising administering to said subject at least one dose of an effective amount of one or more of the polypeptides of any one of items 1 to 6.

    [0125] 26. A method for inducing protective immunity to an antigen in a subject, comprising administering to said subject at least one dose of an effective amount of an antigen and an effective amount of one or more of the polypeptides of any one of items 1 to 6.

    [0126] 27. A method for inducing protective immunity in a subject, comprising administering to said subject at least one dose of an effective amount of one or more of the polypeptides of any one of items 1 to 6.

    [0127] 28. A method for modulating the immune response in a subject, comprising administering to said subject an effective amount of the pharmaceutical composition of any of items 7 to 11 or of a vaccine of any items 12 to 14.

    [0128] 29. A method for non-specifically stimulating the subject immune system comprising administering to said subject an effective amount of at least one of the polypeptides of any one of items 1 to 6 or the pharmaceutical formulations of any of items 7-11 or the vaccine formulations of items 12-14.

    [0129] 30. The method of items 26, 27, 28 or 29 wherein the method is selected from oral or injectable administration to a subject of at least one of the polypeptides of any one of items 1 to 6 or the pharmaceutical formulations of any of items 7-11 or the vaccine formulations of items 12-14.

    [0130] 31. The method of item 30, wherein the pharmaceutical formulations are administered in the form of tablets, suspensions, solutions, emulsions, capsules, powders, syrups, drinking water compositions, and feed compositions.

    EXAMPLES

    Example 1—Expression and Purification of Polypeptides

    [0131] A nucleotide sequence selected from SEQ ID NO. 6 to SEQ ID NO. 10 was digested with NdeI and XhoI restriction enzymes and cloned into pET22b(+) vector (Novagen, Cat. No. 69744-3), (see FIG. 1), to obtain the final expression vectors. Obtained vectors were used to transform E. coli BL21 (DE3) competent cells (Novagen; Genotype: F-ompT hsdSB (rB-mB-) gal dcm (DE3)).

    [0132] The nucleotide sequences are:

    TABLE-US-00001 1-Modified Ecotin from Salmonella without signal peptide. SEQ ID NO. 6 CATATGGCTAACAATGGCGATACCGCCCAGCCGCTGGAAAAAATCGCCCC CTATCCGCAGGCGGAAAAAGGAATGAAGCGGCAAGTGATAACCCTTACCC CTCAGCAGGATGAATCTACCCTCAAAGTGGAACTGTTGATTGGCCAAACG CTGAATGTGGATTGTAACCAGCATCGCCTCGGCGGCACGCTGGAAACAAA AACGCTGGAAGGCTGGGGCTATGACTATTATGTCTTTGATAACGTCACCT CTCCGGTATCAACCATGATGGCCTGCCCTGAAGGTAAGAAAGAGCAAAAA TTCGTCACCGCCTGGCTGGGTGAAGACGGGATGCTGCGCTACAACAGCAA GCTGCCGATCGTGGTGTATACCCCGGCGAATGTGGACGTGAAATACCGCA TCTGGAAAGCGGACGCTAACGTACAGAACGCCGTCGCGCGACTCGAG 2-Modified aprin from Pseudomonas aeruginosa (without signal peptide) SEQ ID NO. 7 CATATGGCCAGCAGTCTGATTCTTCTCAGCGCTTCCGATCTCGCCGGGCA ATGGACCCTGCAGCAGGACGAGGCGCCCGCGATCTGCCACCTGGAGCTGC GCGACAGCGAAGTGGCGGAAGCCAGTGGCTACGACCTGGGCGGCGATACC GCCTGCCTCACGCGCTGGCTGCCCAGCGAGCCGCGCGCCTGGAGGCCTAC CCCGGCCGGGATCGCGCTGCTCGAACGCGGCGGCCTGACCCTGATGCTCC TCGGTCGCCAGGGCGAGGGCGACTACCGGGTGCAGAAGGGCGACGGCGGG CAGTTGGTGCTGCGCCGCGCGACGCCCCTCGAG 3-Modified staphostatin B from Staphylococcus aureus. SEQ ID NO. 8 CATATGCACCACCACCACCACCACTATCAACTACAATTTATAAATTTAGT TTACGACACAACCAAACTCACACATCTAGAACAAACCAATATCAATTTAT TCATTGGTAATTGGAGTAATCATCAATTACAAAAATCAATTTGTATACGT CATGGCGATGATACAAGTCACAATCAATATCATATTCTTTTTATAGATAC GGCACATCAACGCATTAAATTTTCATCTATTGATAATGAAGAAATCATTT ATATTCTTGATTATGATGATACACAGCATATCCTCATGCAAACGTCATCC AAACAAGGTATTGGCACTTCGCGCCCAATCGTTTATGAGCGCTTAGTATA ACTCGAG 4-Modified staphostatin A from Staphylococcus aureus. SEQ ID NO. 9 CATATGCACCACCACCACCACCACGAACAATTTGAATTATTTAGTATTGA TAAATTCAAATGTAATTCAGAGGCTAAGTATTATCTTAATATTATTGAGG GAGAATGGCATCCTCAAGATTTAAATGATAGCCCTTTAAAATTTATTCTC AGTACCTCAGACGATTCTGATTACATTTGCAAATATATAAATACAGAACA CAAACAACTCACATTATATAATAAAAATAATAGCTCAATTGTTATTGAAA TATTTATACCAAATGATAATAAAATACTACTAACAATTATGAACATAGAA GCTTTAGGAACTTCTCCTAGAATGACTTTCATTAAGCATAAAAGTTAACT CGAG 5-Modified serine carboxypeptidase Y inhibitor from Helicobacter pylori . . . SEQ ID NO. 10 CATATGAAAACTTTTGAAGTGATGATTCAAACCGATTCAGAAGGGTATTT GGACGCTAAATTTGGCGGTAACGCTCCTAGAGGGTTTCTCAATCCAAACG GCTTACCCACTTATTCGCCTAAAATCTCATGGCAAAAAGTAGAAGGTGCT CAAAGCTATGCGTTAGAACTTATTGATCATGACGCGCAAAAAGTGTGCGG CATGTCGTTTATCCATTGGGTCGTGGGCAATATCTCTCATAATGTTTTAG AAGAAAACGCCTCCATGATGGATAAAAGGATTACTCAAGGGGTCAATTCG CTTACTCAAGGCTTTATCCGTTCTCCTCTTAATGAAAGCGAAAAACAACG CTCCAATCTCAATAACAGCGTCTATATCGGCCCCATGCCTCCTAATGGCG ATCACCATTACTTGATTCAAGTGTATGCCCTAGACATTCCTAAACTCGCC TTAAAAGCCCCTTTTTTCTTAGGCGATTTGCATGACAAAATGCGCAACCA TATCATCGCCATAGGGAGAAAGGAATTTCTATACAAGCAGTTTATGAGGA AACTCGAG

    [0133] According to the supplier, the pET22b(+) vector contains the following sequence landmarks: [0134] T7 promoter 361-377 [0135] T7 transcription start 360 [0136] pelB coding sequence 224-289 [0137] Multiple cloning sites [0138] (Nco I-Xho I) 158-225 [0139] His⋅Tag coding sequence 140-157 [0140] T7 terminator 26-72 [0141] lacI coding sequence 764-1843 [0142] pBR322 origin 3277 [0143] b1a coding sequence 4038-4895 [0144] f1 origin 5027-5482

    [0145] The recombinant polypeptides containing a His-Tag at the N- or C-terminus were expressed in competent E. coli (BL21 DE3) cells. Transformed cells were plated on LB+ampicillin (100 μg/ml) agar plates and incubated ON at 37° C. Then, colonies were suspended in LB plus Ampicillin (100 μg/ml) at 37° C. and shacked at 200 rpm. Optical density (OD) at 600 nm was measured and at OD 0.6-0.8 the cell culture was induced with IPTG (1 mM) during 16 h at 18° C. (180 rpm). Bacterial cell cultures were centrifuged for 10 min at 6000×g at 4° C. Pellets were stored at −20° C. Cell culture pellets were suspended in buffer pH:8 (NaH.sub.2PO.sub.4 50 mM, NaCl 300 mM) sonicated on ice (3 pulses of 30 seconds) and centrifuged for 30 min at 14000×g. As the polypeptides contain a His-Tag, protein was purified by FPLC using Ni-NTA Agarose columns. Protein identity was confirmed by SDS-PAGE 15% (FIG. 2A) by Western Blot using monoclonal anti His-Tag antibody (FIG. 2B), and by mass spectrometry (not shown). LPS contamination from polypeptides was adsorbed with Sepharose-polymyxin B. Endotoxin determination was performed with Limulus amebocyte lysate (LAL) chromogenic assay. All the preparations of the polypeptides used contained <0.1 endotoxin units per mg of protein.

    [0146] The amino acid sequences of the polypeptides of the invention are shown in Table 1 below.

    TABLE-US-00002 TABLE 1 Polypeptide Amino acid Sequence Modified Ecotin from Salmonella enterica MANNGDTAQPLEKIAPYPQAEKGMKRQVITLT without signal peptide PQQDESTLKVELLIGQTLNVDCNQHRLGGTLE SEQ ID NO. 1 TKTLEGWGYDYYVFDNVTSPVSTMMACPEGKK EQKFVTAWLGEDGMLRYNSKLPIVVYTPANVD VKYRIWKADANVQNAVARLEHHHHHH Modified aprin from Psuedomonas MASSLILLSASDLAGQWTLQQDEAPAICHLEL aeruginosa without signal peptide RDSEVAEASGYDLGGDTACLTRWLPSEPRAWR SEQ ID NO. 2 PTPAGIALLERGGLTLMLLGRQGEGDYRVQKG DGGQLVLRRATPLEHHHHHH Modified Staphostatin B from MHHHHHHYQLQFINLVYDTTKLTHLEQTNINL Staphylococcus aureus FIGNWSNHQLQKSICIRHGDDTSHNQYHILFI SEQ ID NO. 3 DTAHQRIKFSSIDNEEIIYILDYDDTQHILMQ TSSKQGIGTSRPIVYERLV Modified Staphstatin A from MHHHHHHEQFELFSIDKFKCNSEAKYYLNIIE Staphylococcus aureus GEWHPQDLNDSPLKFILSTSDDSDYICKYINT SEQ ID NO. 4 EHKQLTLYNKNNSSIVIEIFIPNDNKILLTIM NIEALGTSPRMTFIKHKS Modified serine carboxypeptidase Y inh. MKTFEVMIQTDSEGYLDAKFGGNAPRGFLNPN from Helicobacter pylori. GLPTYSPKISWQKVEGAQSYALELIDHDAQKV SEQ ID NO. 5 CGMSFIHWVVGNISHNVLEENASMMDKRITQG VNSLTQGFIRSPLNESEKQRSNLNNSVYIGPM PPNGDHHYLIQVYALDIPKLALKAPFFLGDLH DKMRNHIIAIGRKEFLYKQFMRKLEHHHHHH

    Example 2—Polypeptides have Immunostimulating Properties

    [0147] Maturation of dendritic cells (DCs) is a key step in the induction of adaptive immune responses. Thus, the ability of polypeptides of SEQ ID NO. 1-5 to induce maturation of DCs in vitro in the presence of an antigen was evaluated. Bone marrow derived dendritic cells (BMDCs) (CD11c+ MHCIIlow) from wild type BALB/c (1×10.sup.6 cells/ml) were stimulated for 18 h with ovalbumin antigen (OVA, purified chicken egg OVA grade V, from Sigma) or OVA plus each polypeptide of Table 1 in different concentrations (1, 10 or 50 μg/ml) for 18 h. Then the production of pro-inflammatory cytokines in culture supernatants was determined by ELISA. DCs stimulation with OVA plus Ecotin of SEQ ID NO. 1, Staphostatin A (STA) of SEQ ID NO. 4, Staphostatin B (STB) of SEQ ID NO. 3 or Y Inhibitor (Y INH) of SEQ ID NO. 5, induced significant production of pro-inflammatory cytokines (IL-6 and TNF-α) in comparison with OVA stimulation alone (FIG. 3A and FIG. 3B). These results indicate that modified Ecotin, Staphostatin A (STA), Staphostatin B (STB) and Y Inhibitor (Y INH) polypeptides have immune-stimulatory activity on DCs.

    Example 3—Polypeptides Induce Dendritic Cell Activation in C3H/Hej Mice

    [0148] C3H/Hej mice are non-responsive to LPS (22, 23). BMDCs from C3H/HeJ mice were incubated with different concentrations of each polypeptide of SEQ ID NO. 1-5 alone in different concentrations (25, 50 or 100 μg/ml) for 18 h. Then, the production of pro-inflammatory cytokines in culture supernatants was evaluated by ELISA. Production of IL-6 is shown in pg/ml. Ecotin (SEQ ID NO. 1), Aprin (SEQ ID NO. 2) and STA (SEQ ID NO. 4) induced the production of significant levels of pro-inflammatory cytokines (IL-6) from C3H/Hej DCs (FIG. 4). These results indicate that modified Ecotin, Aprin and STA polypeptides activate DCs in a TLR4 independent manner.

    Example 4—Polypeptides Induce Dendritic Cell Activation

    [0149] The ability of polypeptides of the invention to induce activation/maduration of dendritic cells (DCs) in vitro was evaluated. Bone marrow-derived DCs (BMDCs) from C57BL/6 mice were incubated with different concentrations of each polypeptide of Table 1 (1, 10, or 50 μg/ml) for 18 h. Then the production of pro-inflammatory cytokines in culture supernatants was determined by ELISA. DCs stimulation with Ecotin of SEQ ID NO. 1, Aprin of SEQ ID NO. 2, Staphostatin A (STA) of SEQ ID NO. 4, Staphostatin B (STB) of SEQ ID NO. 3 or Y Inhibitor (Y INH) of SEQ ID NO. 5, induced production of pro-inflammatory cytokines TNF-α in comparison with medium alone (FIG. 5A). DCs stimulation with Ecotin of SEQ ID NO. 1 or Staphostatin A (STA) of SEQ ID NO. 4 induced production of IL-6 in comparison with medium alone (FIG. 5B). These results indicate that modified Ecotin, Aprin, Staphostatin A (STA), Staphostatin B (STB) and Y Inhibitor (Y INH) polypeptides have immunostimulatory activity on DCs

    Example 5—Polypeptides are Able to Induce Effector CD4.SUP.+ T Cells

    [0150] To study if polypeptides of SEQ ID NO. 1-5 have the capacity to promote effector specific CD4.sup.+ T cells responses, D011.10 mice were used as a source of OVA-specific CD4.sup.+ T cells. Bone marrow derived dendritic cells (BMDCs) (CD11c+ MHCII low) from BALB/c mice (1×10.sup.6) were pulsed with complete medium (RPMI), OVA alone, OVA plus each polypeptide or OVA plus LPS for 18 h, washed and then co-cultivated with CD4.sup.+ T cells from spleens (2×10.sup.6 cells) from D011.10 transgenic mice at 37° C. for 23 h. During last 5 h cells were treated with brefeldin A. Afterward cells were harvested and stained with specific antibodies anti-CD4, fixed, permeabilized with saponin and stained intracellularly with anti-IFN-γ Ab. Production of IFN-γ by specific CD4.sup.+ T cell was measured by flow cytometry. In FIG. 6, the results are expressed as percentage of CD4.sup.+ T cell producing IFN-γ. DCs incubated with all polypeptides in two different concentrations (1 and 25 μg/ml) induced higher levels of IFN-γ production in D011.10 CD4.sup.+ T cells (ranging from 10%43% of T cell proliferation) than T cells co-cultivated with OVA alone pulsed DCs (6.35%). LPS treated BMDCs also induced a strong IFN-γ production by D011.10 cells (48.6%). These results show that Ecotin (SEQ ID NO. 1), Aprin (SEQ ID NO. 2), Staphostatin A (STA, SEQ ID NO. 4), Staphostatin B (STB, SEQ ID NO. 3) or Y Inhibitor (Y INH, SEQ ID NO. 5) promote the activation of CD4.sup.+ T cells by DCs.

    Example 6—Polypeptides Induce Mucosal Immune Responses after Oral Co-Administration with an Antigen

    [0151] Antigen specific antibody (Ab) mucosal responses are important to achieve a protective response against many infectious diseases. To test polypeptides of SEQ ID NO. 1-5 capacity to elicit Ab responses the present inventors used, Cholera toxin subunit B (CTB) from Vibrio cholera and the tetanus toxoid (TT) as exemplary vaccine Ags. Presently, CTB is used in formulations of oral cholera vaccine Dukoral®, used in humanitarian's emergencies and TT in anti-tetanus vaccine.

    [0152] Female BALB/c mice, 2 months old (n=5/group), were i.g immunized on days 0, 7 and 14 with CTB (5 μg) alone or CTB plus each polypeptide (100 μg), according to the following scheme: i) CTB, ii) CTB+Ecotin of SEQ ID NO. 1, iii) CTB+Aprin of SEQ ID NO. 2, iv) CTB+Staphostatin A of SEQ ID NO 4, v) CTB+Staphostatin B of SEQ ID NO. 3 or vi) CTB+Y Inhibitor of SEQ ID NO. 5. Other groups of BALB/c (n=5/group) mice were i.g. immunized on days 0, 7 and 14 with TT (100 μg) alone or TT plus each polypeptide (150 μg).

    [0153] Feces and serum were collected 1 week after each immunization to evaluate the specific systemic and mucosal antibody responses induced. Specific antibody responses (anti-CT or anti-TT IgG and IgA) at feces and serum were evaluated at different time points by indirect ELISA.

    [0154] Antibody responses were evaluated one week after the second oral dose of the Ag plus the polypeptides. At this time point, oral co-delivery of modified Ecotin, Aprin, Staphostatin A or Staphostatin B polypeptides with CTB increased anti-CT IgA in feces and serum compared with those from CTB alone immunized mice (FIGS. 7 A, 7 C). Besides, there was an increase in anti-CT IgG in feces from animals that were co-administrated with CTB plus STA or STB (FIG. 7 B), while CT-specific IgG at serum was increased in Ecotin, STA, STB or Y Inh plus CTB co-delivered mice (FIG. 7 D). One week after third immunization there was an increase in CT-specific IgA in feces from mice that were co-administered orally with CTB plus Ecotin, Aprin, STA or STB in comparison with CTB alone (FIG. 8 A). CT-specific IgG in feces increased in mice that were orally co-delivered with CTB plus Ecotin or STB (FIG. 8 B). There was an increase in CT-specific IgG in serum in those mice that were co-administered with CTB plus all the polypeptides (FIG. 8 D). Altogether, these results indicate that the addition of polypeptides of the present invention to an oral vaccine formulation increase mucosal and systemic antibody responses against co-delivered antigen.

    [0155] Specific antibody responses anti-each polypeptide IgG at serum were evaluated at different time points by ELISA. In FIG. 9, anti-Ecotin IgG, anti-Aprin IgG, anti-Staphostatin A IgG, anti-Staphostatin B IgG and anti-Y Inhibitor IgG OD results are shown. Of note, Ab responses against the polypeptides were not induced. This is of importance because it was described for other adjuvants and delivery systems that antibody responses against themselves may inhibit subsequent utility. Thus, these results would support repeated use of polypeptides of the present invention contained in different vaccine formulations avoiding this problem.

    [0156] Together these results indicate that co-delivery of the polypeptides of SEQ ID NO. 1-5 of the present invention with antigens increase Ag-specific mucosal as well as systemic Ab responses against co-delivered Ags.

    Example 7—Polypeptides Induce In Vivo Antigen Specific Cellular Immune Responses after Oral Co-Administration with the Ag

    [0157] Delayed-type Hypersensitivity response (DTH) was evaluated in mice immunized with TT plus each polypeptide of SEQ ID NO. 1-5. Briefly, three weeks after the last immunization, mice were intradermally injected in one footpad with 20 μg of Ag (TT) and in the contra lateral footpad with an equal volume of saline, as a negative control. Footpad swelling was measured 48 and 72 h later using a digital caliper with a precision of 0.01 mm, and the mean increase in footpad thickness (mm) was calculated as: (footpad thickness) Ag—(footpad thickness) saline.

    [0158] At 48 h there was an increase in TT-specific DTH in mice co-administered with modified Ecotin, Aprin, STA and Y Inhibitor polypeptides compared with mice immunized with TT alone (FIG. 10A), while at 72 hs all polypeptides increased TT-specific DTH (FIG. 10B). These results indicate that these polypeptides when co-delivered with an Ag, are able to induce antigen specific cellular immune responses in vivo.

    Example 8—Polypeptides Induce Proliferation of Ag Specific T Cells In Vivo

    [0159] Adoptive transfer assays using TCR transgenic DO11.10 or OTI mice were also performed to determine in vivo the primary antigen-specific clonal expansion of transgenic CFSE.sup.+ labeled T cells following oral immunization with OVA plus the polypeptides of SEQ ID NO. 1-5.

    [0160] Single-cell suspensions of spleen and lymph nodes cells from DO11.10 or OT-I mice were labeled with 5 μM CFSE. Labeled cells (10×10.sup.6) were injected i.v into wild type BALB/c sex-matched recipients. One day later, transferred mice received a single oral dose of saline, OVA (500 μg) or OVA plus each polypeptide (250 μg, by gavage). Three days after immunization, mice were sacrificed and spleen cells were obtained and labeled with anti-CD4 antibodies to study by flow cytometry the dilution of CFSE on transgenic CD4.sup.+ T cells. Co-administration of OVA with Ecotin and Aprin showed a greater specific CD4.sup.+ T cell proliferation at spleens than mice immunized with OVA alone (FIG. 11).

    [0161] Other group of WT C57BL/6 mice were transferred with spleen cells from OTI mice labeled with CFSE. One day later mice were orally administered with saline, OVA (1 mg) or OVA plus each polypeptide (250 μg). Three days later spleens and MLNs were obtained and cell suspensions were analyzed by flow cytometry for CFSE dilution. Results are shown as dot plots, representative histograms (FIG. 12A and FIG. 12B) and bar graph (FIGS. 12C-12D). Data are represented as the percentage of CD8.sup.+ CFSE.sup.+ proliferative T cells. Co-administration of OVA plus Ecotin, Aprin, STA, STB or Y INH increased CD8.sup.+ T cell proliferation at spleens (12C) and MLNs (12D) in comparison with OVA delivered alone. These results show that these polypeptides co-administered orally with the Ag enhances Ag-specific CD8.sup.+ T cell responses in vivo at systemic (spleen) and mucosal sites as MLNs.

    [0162] Altogether these results indicate that polypeptides increase CD4.sup.+ and CD8.sup.+ T cell immune responses against the co-administered Ag.

    Example 9—Oral Delivery of Polypeptides Limits Proteolysis of the Co-Administered Ag within Cells from Peyer's Patches (PPs) and Mesenteric Lymph Nodes (MLNs)

    [0163] To induce an adaptive immune response Ags must reach inductive sites (PPs and MLNs) of the gastrointestinal immune system. Then, it is important that the Ag could resist the harsh environment of the gut (high degradation).

    [0164] OVADQ was used as an Ag, OVADQ is quenched and its hydrolysis relieves the quenching, yielding bright green fluorescent peptides. The increase in fluorescence is proportional to protein digestion. OVADQ alone, OVADQ plus each polypeptide of SEQ ID NO. 1-5 or PBS were administered i.g. to BALB/c mice (n=3/group). At 6 h post administration mice were sacrificed and PPs and MLNs were removed. Single cell suspensions were prepared, filtered through a stainless-steel sieve and washed twice in PBS solution to eliminate any extracellular Ag, thus the fluorescence determination was proportional to Ag-digestion. Total viable cells were counted using Trypan Blue. Fluorescence intensity (FI) in arbitrary units was determined in 1×10.sup.6 cells.

    [0165] Oral delivery of modified Ecotin reduced the amount of degraded Ag (OVA-DQ) that reached the Peyer patches 6 h after its co-administration (FIG. 13A). In the same way, modified Aprin and modified Y Inhibitor decreased the amount of digested OVA at the MLNs after 6 h of oral co-delivery (FIG. 13B). A reduction in the degradative status of the Ag can increase the amount of Ag that reaches these inductive sites. This would help reduce the amount of Ag needed in the formulation, thus reducing costs.

    Example 10—the Polypeptides Protect Co-Administered Ag from Gut Harsh Environment

    [0166] The ability of polypeptides of SEQ ID NO. 1-5 to protect Ag from stomach or intestine extracts digestion was studied. Digestion of CASEIN BODIPY in presence of polypeptides was assessed using murine stomach and intestine extracts or pig pancreatic extract. Different amounts of extracts were incubated with different amounts of polypeptides for 1 h at room temperature in the appropriate buffers and then the substrate was added (CASEIN BODIPY, 1 μg/ml). Fluorescence was measured in a fluorescence plate reader and the percentage of proteolytic activity was calculated.

    [0167] Intestine extracts were pre-incubated for 1 h with buffer, each polypeptide (1.25, 6.25 or 12.5 μg/ml), Inhibitor cocktail (from Sigma Aldrich, containing AEBSF 104 mM, Aprotinin 80 μM, Bestatin 4 mM, E-64 1.4 mM, Leupeptin 2 mM and Pepstatin A 1.5 mM in a ready-to-use solution in DMSO) or BSA (12.5 μg) as positive and negative controls, respectively. Then, the substrate casein BODIPY FL (1 μg/ml) was added and the fluorescence intensity measured in a fluorescence plate reader. Results are shown in FIG. 14 as mean % of proteolytic activity±SEM. ***P<0.001 vs BSA group.

    [0168] Stomach extracts were pre-incubated for 1 h with buffer, each polypeptide (3, 31.2 or 62.5 μg), Inhibitor cocktail or BSA (62.5 μg) as positive and negative controls respectively. Then, the substrate casein BODIPY FL (1 μg/ml) was added and the fluorescence intensity measured in a fluorescence plate reader. Results are shown in FIG. 15 as mean % of proteolytic activity±SEM. **P<0.01, ***P<0.001 vs BSA group.

    [0169] Ecotin, Aprin and Y Inhibitor were able to reduce the Ag digestion by intestine extracts while only Y Inhibitor has the capacity to protect the Ag from degradation by stomach extracts. BSA control did not inhibit the proteolytic activity of stomach or intestine extracts in vitro whereas a protease inhibitor cocktail did it.

    [0170] Commercial pancreatin—a broad-spectrum mixture of proteases produced by the exocrine cells of the porcine pancreas that is usually used for in vitro digestibility analysis—was used to evaluate the susceptibility of the Ag to this content. Pancreatin was pre-incubated for 1 h with buffer, each polypeptide (5, 10, 20 or 40 μg/ml), Inhibitor cocktail or BSA (40 μg) as positive or negative controls respectively. Then, the substrate casein BODIPY FL (1 μg/ml) was added and the fluorescence intensity measured in a fluorescence plate reader. Results are shown as mean % of proteolytic activity±SEM. *P<0.05, **P<0.01, ***P<0.001 vs BSA group.

    [0171] The results indicate that all the polypeptides of the invention, in different amounts, can protect the Ag (casein) from digestion by porcine pancreatic extract (FIG. 16).

    [0172] Altogether, these results indicate that co-administration of the polypeptides of the invention with an Ag by the oral route can protect the Ag passage to the gastrointestinal tract, increasing the half-life of the Ag within cells of the inductive sites: PPs and MLNs.

    Example 11—Ecotin Polypeptide in Oral Vaccine Formulation Protects Against Salmonella Infection in Mice

    [0173] BALB/c mice were immunized at days 0, 15 and 30, i.g with physiologic solution (SF), Ecotin (100 μg), Ecotin (100 μg)+CT (10 μg), Ecotin (100 μg)+U-Omp19 (150 μg), or intraperitoneally with Ecotin (20 μg) plus Freund Incomplete adjuvant-FIA-(100 μL). Thirty days after last immunization, animals were challenged with virulent Salmonellla 4208 via ip injection. Four days later animals were killed, spleens and livers were homogenized and plated in agar plus streptomycin to evaluate the amount of CFU per gram of tissue.

    [0174] Results indicate that Ecotin delivered alone, plus CT or FIA cannot induce protection against Salmonella infection. However, when co-formulated with the adjuvant U-Omp19 (an unlipidated outer membrane protein from Brucella abortus) and administered orally it induces significant reduction in the amount of CFU at spleen (FIG. 17A) and liver (FIG. 17B) in comparison with SF or Ecotin delivery alone. As it was reported previously that Omp19 alone cannot induce protection against Salmonella (24) the present results indicate that Ecotin when co-formulated with Omp19 is a good Ag for a vaccine formulation against Salmonella.

    REFERENCES

    [0175] 1. Takahashi, I., T. Nochi, Y. Yuki, and H. Kiyono. 2009. New horizon of mucosal immunity and vaccines. Curr Opin Immunol 21:352-358. [0176] 2. Gallichan, W. S., and K. L. Rosenthal. 1996. Long-lived cytotoxic T lymphocyte memory in mucosal tissues after mucosal but not systemic immunization. J Exp Med 184:1879-1890. [0177] 3. He, X. W., F. Wang, L. Jiang, J. Li, S. K. Liu, Z. Y. Xiao, X. Q. Jin, Y. N. Zhang, Y. He, K. Li, Y. J. Guo, and S. H. Sun. 2005. Induction of mucosal and systemic immune response by single-dose oral immunization with biodegradable microparticles containing DNA encoding HBsAg. J Gen Virol 86:601-610. [0178] 4. Kim, S. Y., H. J. Doh, J. S. Ahn, Y. J. Ha, M. H. Jang, S. I. Chung, and H. J. Park. 1999. Induction of mucosal and systemic immune response by oral immunization with H. pylori lysates encapsulated in poly(D,L-lactide-co-glycolide) microparticles. Vaccine 17:607-616. [0179] 5. Pavot, V., N. Rochereau, C. Genin, B. Verrier, and S. Paul. 2012. New insights in mucosal vaccine development. Vaccine 30:142-154. [0180] 6. Mestecky, J., M. W. Russell, and C. O. Elson. 2007. Perspectives on mucosal vaccines: is mucosal tolerance a barrier? J Immunol 179:5633-5638. [0181] 7. Holmgren, J., and C. Czerkinsky. 2005. Mucosal immunity and vaccines. Nat Med 11:S45-53. [0182] 8. Mowat, A. M. 2003. Anatomical basis of tolerance and immunity to intestinal antigens. Nat Rev Immunol 3:331-341. [0183] 9. Diamanti, E., B. Ibrahimi, F. Tafaj, E. Mezini, A. Dodbiba, V. Dobi, S. Catone, D. Genovese, P. Simeoni, and L. Fiore. 1998. Surveillance of suspected poliomyelitis in Albania, 1980-1995: suggestion of increased risk of vaccine associated poliomyelitis. Vaccine 16:940-948. [0184] 10. Reed, S. G., S. Bertholet, R. N. Coler, and M. Friede. 2009. New horizons in adjuvants for vaccine development. Trends Immunol 30:23-32. [0185] 11. Coffman, R. L., A. Sher, and R. A. Seder. 2010. Vaccine adjuvants: putting innate immunity to work. Immunity 33:492-503. [0186] 12. Freytag, L. C., and J. D. Clements. 2005. Mucosal adjuvants. Vaccine 23:1804-1813. [0187] 13. Hill, D. R., L. Ford, and D. G. Lalloo. 2006. Oral cholera vaccines: use in clinical practice. Lancet Infect Dis 6:361-373. [0188] 14. El-Kamary, S. S., M. B. Cohen, A. L. Bourgeois, L. Van De Verg, N. Bauers, M. Reymann, M. F. Pasetti, and W. H. Chen. 2014. Safety and immunogenicity of a single oral dose of recombinant double mutant heat-labile toxin derived from enterotoxigenic Escherichia coli. Clin Vaccine Immunol 20:1764-1770. [0189] 15. Zhu, Q., J. Talton, G. Zhang, T. Cunningham, Z. Wang, R. C. Waters, J. Kirk, B. Eppler, D. M. Klinman, Y. Sui, S. Gagnon, I. M. Belyakov, R. J. Mumper, and J. A. Berzofsky. 2012. Large intestine-targeted, nanoparticle-releasing oral vaccine to control genitorectal viral infection. Nat Med 18:1291-1296. [0190] 16. De Smet, R., T. Demoor, S. Verschuere, M. Dullaers, G. R. Ostroff, G. Leclercq, L. Allais, C. Pilette, M. Dierendonck, B. G. De Geest, and C. A. Cuvelier. 2013. Beta-Glucan microparticles are good candidates for mucosal antigen delivery in oral vaccination. J Control Release 172:671-678. [0191] 17. Kasturi, S. P., I. Skountzou, R. A. Albrecht, D. Koutsonanos, T. Hua, H. I. Nakaya, R. Ravindran, S. Stewart, M. Alam, M. Kwissa, F. Villinger, N. Murthy, J. Steel, J. Jacob, R. J. Hogan, A. Garcia-Sastre, R. Compans, and B. Pulendran. 2011. Programming the magnitude and persistence of antibody responses with innate immunity. Nature 470:543-547. [0192] 18. Islam, M. A., J. Firdous, Y. J. Choi, C. H. Yun, and C. S. Cho. 2012. Design and application of chitosan microspheres as oral and nasal vaccine carriers: an updated review. Int J Nanomedicine 7:6077-6093. [0193] 19. Shima, H., T. Watanabe, S. Fukuda, S. Fukuoka, O. Ohara, and H. Ohno. 2014. A novel mucosal vaccine targeting Peyer's patch M cells induces protective antigen-specific IgA responses. Int Immunol 26:619-625. [0194] 20. Ibanez, A. E., L. M. Coria, M. V. Carabajal, M. V. Delpino, G. S. Risso, P. G. Cobiello, J. Rinaldi, P. Barrionuevo, L. Bruno, F. Frank, S. Klinke, F. A. Goldbaum, G. Briones, G. H. Giambartolomei, K. A. Pasquevich, and J. Cassataro. 2015. A bacterial protease inhibitor protects antigens delivered in oral vaccines from digestion while triggering specific mucosal immune responses. J Control Release 220:18-28. [0195] 21. Singh, M., and D. O'Hagan. 1999. Advances in vaccine adjuvants. Nat Biotechnol 17:1075-1081. [0196] 22. Sultzer, B. M. 1972. Genetic control of host responses to endotoxin. Infection and immunity 5:107-113. [0197] 23. Sultzer, B. M. 1968. Genetic control of leucocyte responses to endotoxin. Nature 219:1253-1254. [0198] 24. Risso, G. S. et al. 2017. U-Omp19 from Brucella abortus is a Useful adjuvant for Vaccine Formulations against Salmonella infection in Mice. Frontiers Immunology. Volume 8. Article 171.