Human alpha-galactosidase variants

10973888 · 2021-04-13

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention provides engineered human alpha-galactosidase polypeptides and compositions thereof. The engineered human alpha-galactosidase polypeptides have been optimized to provide improved stability under both acidic (pH<4.5) and basic (pH>7) conditions. The invention also relates to the use of the compositions comprising the engineered human alpha-galactosidase polypeptides for therapeutic purposes.

Claims

1. A recombinant alpha galactosidase A comprising an amino acid sequence comprising at least 95%, sequence identity to SEQ ID NO: 5, wherein said amino acid sequence comprises a mutation at positions 44 and 206, wherein said positions are numbered with reference to SEQ ID NO: 5.

2. The recombinant alpha galactosidase A of claim 1, wherein said recombinant alpha galactosidase A is a recombinant human alpha galactosidase A.

3. The recombinant alpha galactosidase A of claim 1, wherein said recombinant alpha galactosidase A exhibits at least one improved property selected from: i) increased thermostability; ii) enhanced catalytic activity; iii) increased tolerance to pH 7.4; iv) increased tolerance to pH 4.3; v) increased tolerance to serum; or vi) reduced immunogenicity; or a combination of any of i), ii), iii), iv), v), or vi), as compared to a reference alpha galactosidase A.

4. The recombinant alpha galactosidase A of claim 3, wherein said recombinant alpha galactosidase A is more thermostable than the alpha galactosidase A of SEQ ID NO:5.

5. The recombinant alpha galactosidase A of claim 3, wherein said recombinant alpha galactosidase A is more stable at pH 7.4 than the alpha galactosidase A of SEQ ID NO:5.

6. The recombinant alpha galactosidase A of claim 3, wherein said recombinant alpha galactosidase A is more stable at pH 4.3 than the alpha galactosidase A of SEQ ID NO:5.

7. The recombinant alpha galactosidase A of claim 3, wherein said recombinant alpha galactosidase A is more stable to exposure to serum than the alpha galactosidase A of SEQ ID NO:5.

8. The recombinant alpha galactosidase A of claim 3, wherein said recombinant alpha galactosidase A is less immunogenic than wild-type alpha galactosidase A.

9. The recombinant alpha galactosidase A of claim 1, wherein the amino acid sequence of said recombinant alpha galactosidase further comprises at least one mutation at a position selected from position 2, 7, 8, 10, 14, 15, 17, 20, 21, 23, 24, 30, 31, 34, 36, 37, 39, 40, 41, 43, 47, 48, 52, 53, 56, 59, 64, 65, 66, 67, 74, 76, 77, 80, 84, 87, 88, 91, 92, 93, 94, 95, 96, 100, 102, 105, 113, 120, 123, 124, 125, 130, 133, 136, 143, 144, 147, 155, 156, 158, 159, 160, 161, 162, 163, 165, 166, 167, 168, 169, 170, 174, 177, 178, 179, 180, 181, 182, 186, 187, 189, 190, 195, 198, 199, 208, 210, 217, 219, 221, 228, 230, 234, 237, 238, 246, 247, 249, 252, 253, 254, 255, 256, 257, 258, 259, 261, 262, 263, 266, 269, 270, 271, 273, 274, 276, 277, 281, 283, 284, 287, 290, 293, 295, 299, 301, 302, 303, 305, 308, 314, 316, 317, 319, 322, 325, 326, 337, 339, 343, 344, 345, 346, 348, 349, 350, 352, 353, 354, 359, 362, 365, 367, 368, 369, 371, 373, 374, 375, 376, 377, 384, 385, 386, 387, 388, 389, 390, 391, 392, 393, 394, 395, 396, 397, and 398, wherein the positions are numbered relative to the amino acid sequence set forth in SEQ ID NO: 5.

10. The recombinant alpha galactosidase A of claim 1, wherein said recombinant alpha galactosidase A is purified.

11. A composition comprising said recombinant alpha galactosidase A of claim 1.

12. A pharmaceutical composition for the treatment of Fabry disease, comprising the enzyme composition of claim 11, further comprising a pharmaceutically acceptable carrier and/or excipient.

13. The pharmaceutical composition of claim 12, wherein said composition is suitable for parenteral injection or infusion to a human.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1 provides a graph showing the relative activity of different GLA constructs in S. cerevisiae after 2-5 days of culturing.

(2) FIG. 2 provides graphs showing the Absolute (Panel A) and relative (Panel B) activity of GLA variants after incubation at various pHs.

(3) FIG. 3 provides graphs showing the absolute (Panel A) and relative (Panel B) activity of GLA variants after incubation at various temperatures.

(4) FIG. 4 provides graphs showing the absolute (Panel A&B) and relative (Panel C&D) activity of GLA variants after challenge with buffers that contain increasing amounts of serum.

(5) FIG. 5 provides a graph showing the relative activity of GLA variants expressed in HEK293T cells.

(6) FIG. 6 provides graphs showing the absolute (Panel A) and relative (Panel B) activity of GLA variants expressed in HEK293T cells, normalized for activity, and incubated at various pHs.

(7) FIG. 7 provides graphs showing the absolute (Panel A) and relative (Panel B) activity of GLA variants expressed in HEK293T cells, normalized for activity, and incubated at various temperatures.

(8) FIG. 8 provides graphs showing GLA variant activity remaining after incubation in acidic (Panel A) or basic (Panel B) solutions.

(9) FIG. 9 provides a graph showing the GLA activity recovered in rat serum following administration of GLA variants.

DESCRIPTION OF THE INVENTION

(10) The present invention provides engineered human alpha-galactosidase polypeptides and compositions thereof. The engineered human alpha-galactosidase polypeptides have been optimized to provide improved stability under both acidic (pH<4.5) and basic (pH>7) conditions. The invention also relates to the use of the compositions comprising the engineered human alpha-galactosidase polypeptides for therapeutic purposes.

(11) In some embodiments, the engineered human alpha-galactosidase polypeptides have been optimized to provide improved stability at various levels. The invention also relates to the use of the compositions comprising the engineered human alpha-galactosidase polypeptides for therapeutic purposes.

(12) Enzyme replacement therapy for treatment of Fabry disease (e.g., Fabrazyme® agalsidase beta; Genzyme) is available and is considered for eligible individuals. Currently used enzyme replacements therapies are recombinantly expressed forms of the wild-type human GLA. It is known that intravenously administered GLA circulates, becomes endocytosed, and travels to the endosomes/lysosomes of target organs, where it reduces the accumulation of Gb3. These drugs do not completely relieve patient symptoms, as neuropathic pain and transient ischemic attacks continue to occur at reduced rates. In addition, the uptake of GLA by most target organs is poor in comparison to the liver, and the enzyme is unstable at the pH of blood and lysosomes. Thus, issues remain with available treatments. In addition, patients may develop an immune response (IgG and IgE antibodies targeting the administered drug), and suffer severe allergic (anaphylactic) reactions, severe infusion reactions, and even death. The present invention is intended to provide more stable enzymes suitable for treatment of Fabry disease, yet with reduced side effects and improved outcomes, as compared to currently available treatments. Indeed, the present invention is intended to provide recombinant GLA enzymes that have increased stability in blood (pH 7.4), which the enzyme encounters upon injection into the bloodstream. In addition, the enzyme has increased stability at the pH of the lysosome (pH 4.3), the location where the enzyme is active during therapy. Thus, directed evolution of recombinantly expressed human GLA in Saccharomyces cerevisiae, employing high throughput screening of diverse enzyme variant libraries, was used to provide novel GLA variants with desired stability properties. In addition, variant enzymes were screened and their amino acid sequence determined in order to identify novel GLA variants with a predicted reduced immunogenicity. By providing GLA variants with increased pH stability and reduced immunogenicity, the present invention provides compositions and methods suitable for use in patients by increasing patient tolerance of treatment and providing flexibility in dosing and formulation for improved patient outcomes.

Abbreviations and Definitions

(13) Unless defined otherwise, all technical and scientific terms used herein generally have the same meaning as commonly understood by one of ordinary skill in the art to which this invention pertains. Generally, the nomenclature used herein and the laboratory procedures of cell culture, molecular genetics, microbiology, biochemistry, organic chemistry, analytical chemistry and nucleic acid chemistry described below are those well-known and commonly employed in the art. Such techniques are well-known and described in numerous texts and reference works well known to those of skill in the art. Standard techniques, or modifications thereof, are used for chemical syntheses and chemical analyses. All patents, patent applications, articles and publications mentioned herein, both supra and infra, are hereby expressly incorporated herein by reference.

(14) Although any suitable methods and materials similar or equivalent to those described herein find use in the practice of the present invention, some methods and materials are described herein. It is to be understood that this invention is not limited to the particular methodology, protocols, and reagents described, as these may vary, depending upon the context they are used by those of skill in the art. Accordingly, the terms defined immediately below are more fully described by reference to the application as a whole. All patents, patent applications, articles and publications mentioned herein, both supra and infra, are hereby expressly incorporated herein by reference.

(15) Also, as used herein, the singular “a”, “an,” and “the” include the plural references, unless the context clearly indicates otherwise.

(16) Numeric ranges are inclusive of the numbers defining the range. Thus, every numerical range disclosed herein is intended to encompass every narrower numerical range that falls within such broader numerical range, as if such narrower numerical ranges were all expressly written herein. It is also intended that every maximum (or minimum) numerical limitation disclosed herein includes every lower (or higher) numerical limitation, as if such lower (or higher) numerical limitations were expressly written herein.

(17) The term “about” means an acceptable error for a particular value. In some instances “about” means within 0.05%, 0.5%, 1.0%, or 2.0%, of a given value range. In some instances, “about” means within 1, 2, 3, or 4 standard deviations of a given value.

(18) Furthermore, the headings provided herein are not limitations of the various aspects or embodiments of the invention which can be had by reference to the application as a whole. Accordingly, the terms defined immediately below are more fully defined by reference to the application as a whole. Nonetheless, in order to facilitate understanding of the invention, a number of terms are defined below.

(19) Unless otherwise indicated, nucleic acids are written left to right in 5′ to 3′ orientation; amino acid sequences are written left to right in amino to carboxy orientation, respectively.

(20) As used herein, the term “comprising” and its cognates are used in their inclusive sense (i.e., equivalent to the term “including” and its corresponding cognates).

(21) “EC” number refers to the Enzyme Nomenclature of the Nomenclature Committee of the International Union of Biochemistry and Molecular Biology (NC-IUBMB). The IUBMB biochemical classification is a numerical classification system for enzymes based on the chemical reactions they catalyze.

(22) “ATCC” refers to the American Type Culture Collection whose biorepository collection includes genes and strains.

(23) “NCBI” refers to National Center for Biological Information and the sequence databases provided therein.

(24) “Protein,” “polypeptide,” and “peptide” are used interchangeably herein to denote a polymer of at least two amino acids covalently linked by an amide bond, regardless of length or post-translational modification (e.g., glycosylation or phosphorylation).

(25) “Amino acids” are referred to herein by either their commonly known three-letter symbols or by the one-letter symbols recommended by IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single letter codes.

(26) The term “engineered,” “recombinant,” “non-naturally occurring,” and “variant,” when used with reference to a cell, a polynucleotide or a polypeptide refers to a material or a material corresponding to the natural or native form of the material that has been modified in a manner that would not otherwise exist in nature or is identical thereto but produced or derived from synthetic materials and/or by manipulation using recombinant techniques.

(27) As used herein, “wild-type” and “naturally-occurring” refer to the form found in nature. For example a wild-type polypeptide or polynucleotide sequence is a sequence present in an organism that can be isolated from a source in nature and which has not been intentionally modified by human manipulation.

(28) “Deimmunized” as used herein, refers to the manipulation of a protein sequence to create a variant that is predicted to be not as immunogenic as the wild-type or reference protein. In some embodiments, the predicted deimmunization is complete, in that the variant protein is predicted to not stimulate an immune response in patients to whom the variant protein is administered. This response can be measured by various methods including but not limited to, the presence or abundance of anti-drug antibodies, the presence or abundance of neutralizing antibodies, the presence of an anaphylactic response, peptide presentation on major histocompatibility complex-II (MHC-II) proteins, or the prevalence or intensity of cytokine release upon administration of the protein. In some embodiments, the variant protein is less immunogenic than the wild-type or reference protein. In some embodiments, deimmunization involves modifications to subsequences of proteins (e.g., epitopes) that are recognized by human leukocyte antigen (HLA) receptors. In some embodiments, these epitopes are removed by changing their amino acid sequences to produce a deimmunized variant protein in which such subsequences are no longer recognized by the HLA receptors. In some other embodiments, these epitopes retain binding affinity to HLA receptors, but are not presented. In some embodiments, the deimmunized protein shows lower levels of response in biochemical and cell-biological predictors of human immunological responses including dendritic-cell T-cell activation assays, or (HLA) peptide binding assays. In some embodiments, these epitopes are removed by changing their amino acid sequence to produce a deimmunized variant protein in which the epitopes are no longer recognized by T-cell receptors. In still other embodiments the deimmunized protein induces anergy in its corresponding T-cells, activates T regulatory cells, or results in clonal deletion of recognizing B-cells.

(29) “Coding sequence” refers to that part of a nucleic acid (e.g., a gene) that encodes an amino acid sequence of a protein.

(30) The term “percent (%) sequence identity” is used herein to refer to comparisons among polynucleotides and polypeptides, and are determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the polynucleotide or polypeptide sequence in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence for optimal alignment of the two sequences. The percentage may be calculated by determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity. Alternatively, the percentage may be calculated by determining the number of positions at which either the identical nucleic acid base or amino acid residue occurs in both sequences or a nucleic acid base or amino acid residue is aligned with a gap to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity. Those of skill in the art appreciate that there are many established algorithms available to align two sequences. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith and Waterman (Smith and Waterman, Adv. Appl. Math., 2:482 [1981]), by the homology alignment algorithm of Needleman and Wunsch (Needleman and Wunsch, J. Mol. Biol., 48:443 [1970]), by the search for similarity method of Pearson and Lipman (Pearson and Lipman, Proc. Natl. Acad. Sci. USA 85:2444 [1988]), by computerized implementations of these algorithms (e.g., GAP, BESTFIT, FASTA, and TFASTA in the GCG Wisconsin Software Package), or by visual inspection, as known in the art. Examples of algorithms that are suitable for determining percent sequence identity and sequence similarity include, but are not limited to the BLAST and BLAST 2.0 algorithms, which are described by Altschul et al. (See, Altschul et al., J. Mol. Biol., 215: 403-410 [1990]; and Altschul et al., 1977, Nucleic Acids Res., 3389-3402 [1977], respectively). Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information website. This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as, the neighborhood word score threshold (See, Altschul et al, supra). These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are then extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always >0) and N (penalty score for mismatching residues; always <0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a wordlength (W) of 11, an expectation (E) of 10, M=5, N=−4, and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a wordlength (W) of 3, an expectation (E) of 10, and the BLOSUM62 scoring matrix (See, Henikoff and Henikoff, Proc. Natl. Acad. Sci. USA 89:10915 [1989]). Exemplary determination of sequence alignment and % sequence identity can employ the BESTFIT or GAP programs in the GCG Wisconsin Software package (Accelrys, Madison Wis.), using default parameters provided.

(31) “Reference sequence” refers to a defined sequence used as a basis for a sequence comparison. A reference sequence may be a subset of a larger sequence, for example, a segment of a full-length gene or polypeptide sequence. Generally, a reference sequence is at least 20 nucleotide or amino acid residues in length, at least 25 residues in length, at least 50 residues in length, at least 100 residues in length or the full length of the nucleic acid or polypeptide. Since two polynucleotides or polypeptides may each (1) comprise a sequence (i.e., a portion of the complete sequence) that is similar between the two sequences, and (2) may further comprise a sequence that is divergent between the two sequences, sequence comparisons between two (or more) polynucleotides or polypeptide are typically performed by comparing sequences of the two polynucleotides or polypeptides over a “comparison window” to identify and compare local regions of sequence similarity. In some embodiments, a “reference sequence” can be based on a primary amino acid sequence, where the reference sequence is a sequence that can have one or more changes in the primary sequence. “Comparison window” refers to a conceptual segment of at least about 20 contiguous nucleotide positions or amino acids residues wherein a sequence may be compared to a reference sequence of at least 20 contiguous nucleotides or amino acids and wherein the portion of the sequence in the comparison window may comprise additions or deletions (i.e., gaps) of 20 percent or less as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The comparison window can be longer than 20 contiguous residues, and includes, optionally 30, 40, 50, 100, or longer windows.

(32) “Corresponding to”, “reference to” or “relative to” when used in the context of the numbering of a given amino acid or polynucleotide sequence refers to the numbering of the residues of a specified reference sequence when the given amino acid or polynucleotide sequence is compared to the reference sequence. In other words, the residue number or residue position of a given polymer is designated with respect to the reference sequence rather than by the actual numerical position of the residue within the given amino acid or polynucleotide sequence. For example, a given amino acid sequence, such as that of an engineered GLA, can be aligned to a reference sequence by introducing gaps to optimize residue matches between the two sequences. In these cases, although the gaps are present, the numbering of the residue in the given amino acid or polynucleotide sequence is made with respect to the reference sequence to which it has been aligned.

(33) “Amino acid difference” or “residue difference” refers to a difference in the amino acid residue at a position of a polypeptide sequence relative to the amino acid residue at a corresponding position in a reference sequence. The positions of amino acid differences generally are referred to herein as “Xn,” where n refers to the corresponding position in the reference sequence upon which the residue difference is based. For example, a “residue difference at position X93 as compared to SEQ ID NO:2” refers to a difference of the amino acid residue at the polypeptide position corresponding to position 93 of SEQ ID NO:2. Thus, if the reference polypeptide of SEQ ID NO:2 has a serine at position 93, then a “residue difference at position X93 as compared to SEQ ID NO:2” an amino acid substitution of any residue other than serine at the position of the polypeptide corresponding to position 93 of SEQ ID NO:2. In most instances herein, the specific amino acid residue difference at a position is indicated as “XnY” where “Xn” specified the corresponding position as described above, and “Y” is the single letter identifier of the amino acid found in the engineered polypeptide (i.e., the different residue than in the reference polypeptide). In some instances (e.g., in Tables 2.1, 2.2, 2.3, 2.4, 2.5, and 6.1), the present disclosure also provides specific amino acid differences denoted by the conventional notation “AnB”, where A is the single letter identifier of the residue in the reference sequence, “n” is the number of the residue position in the reference sequence, and B is the single letter identifier of the residue substitution in the sequence of the engineered polypeptide. In some instances, a polypeptide of the present disclosure can include one or more amino acid residue differences relative to a reference sequence, which is indicated by a list of the specified positions where residue differences are present relative to the reference sequence. In some embodiments, where more than one amino acid can be used in a specific residue position of a polypeptide, the various amino acid residues that can be used are separated by a “/” (e.g., X307H/X307P or X307H/P). In some embodiments, the enzyme variants comprise more than one substitution. These substitutions are separated by a slash for ease in reading (e.g., C143A/K206A). The present application includes engineered polypeptide sequences comprising one or more amino acid differences that include either/or both conservative and non-conservative amino acid substitutions.

(34) “Conservative amino acid substitution” refers to a substitution of a residue with a different residue having a similar side chain, and thus typically involves substitution of the amino acid in the polypeptide with amino acids within the same or similar defined class of amino acids. By way of example and not limitation, an amino acid with an aliphatic side chain may be substituted with another aliphatic amino acid (e.g., alanine, valine, leucine, and isoleucine); an amino acid with hydroxyl side chain is substituted with another amino acid with a hydroxyl side chain (e.g., serine and threonine); an amino acids having aromatic side chains is substituted with another amino acid having an aromatic side chain (e.g., phenylalanine, tyrosine, tryptophan, and histidine); an amino acid with a basic side chain is substituted with another amino acid with a basis side chain (e.g., lysine and arginine); an amino acid with an acidic side chain is substituted with another amino acid with an acidic side chain (e.g., aspartic acid or glutamic acid); and/or a hydrophobic or hydrophilic amino acid is replaced with another hydrophobic or hydrophilic amino acid, respectively.

(35) “Non-conservative substitution” refers to substitution of an amino acid in the polypeptide with an amino acid with significantly differing side chain properties. Non-conservative substitutions may use amino acids between, rather than within, the defined groups and affects (a) the structure of the peptide backbone in the area of the substitution (e.g., proline for glycine) (b) the charge or hydrophobicity, or (c) the bulk of the side chain. By way of example and not limitation, an exemplary non-conservative substitution can be an acidic amino acid substituted with a basic or aliphatic amino acid; an aromatic amino acid substituted with a small amino acid; and a hydrophilic amino acid substituted with a hydrophobic amino acid.

(36) “Deletion” refers to modification to the polypeptide by removal of one or more amino acids from the reference polypeptide. Deletions can comprise removal of 1 or more amino acids, 2 or more amino acids, 5 or more amino acids, 10 or more amino acids, 15 or more amino acids, or 20 or more amino acids, up to 10% of the total number of amino acids, or up to 20% of the total number of amino acids making up the reference enzyme while retaining enzymatic activity and/or retaining the improved properties of an engineered enzyme. Deletions can be directed to the internal portions and/or terminal portions of the polypeptide. In various embodiments, the deletion can comprise a continuous segment or can be discontinuous.

(37) “Insertion” refers to modification to the polypeptide by addition of one or more amino acids from the reference polypeptide. Insertions can be in the internal portions of the polypeptide, or to the carboxy or amino terminus. Insertions as used herein include fusion proteins as is known in the art. The insertion can be a contiguous segment of amino acids or separated by one or more of the amino acids in the naturally occurring polypeptide.

(38) A “functional fragment” or a “biologically active fragment” used interchangeably herein refers to a polypeptide that has an amino-terminal and/or carboxy-terminal deletion(s) and/or internal deletions, but where the remaining amino acid sequence is identical to the corresponding positions in the sequence to which it is being compared (e.g., a full-length engineered GLA of the present invention) and that retains substantially all of the activity of the full-length polypeptide.

(39) “Isolated polypeptide” refers to a polypeptide which is substantially separated from other contaminants that naturally accompany it, e.g., protein, lipids, and polynucleotides. The term embraces polypeptides which have been removed or purified from their naturally-occurring environment or expression system (e.g., host cell or in vitro synthesis). The recombinant GLA polypeptides may be present within a cell, present in the cellular medium, or prepared in various forms, such as lysates or isolated preparations. As such, in some embodiments, the recombinant GLA polypeptides can be an isolated polypeptide.

(40) “Substantially pure polypeptide” refers to a composition in which the polypeptide species is the predominant species present (i.e., on a molar or weight basis it is more abundant than any other individual macromolecular species in the composition), and is generally a substantially purified composition when the object species comprises at least about 50 percent of the macromolecular species present by mole or % weight. Generally, a substantially pure GLA composition comprises about 60% or more, about 70% or more, about 80% or more, about 90% or more, about 95% or more, and about 98% or more of all macromolecular species by mole or % weight present in the composition. In some embodiments, the object species is purified to essential homogeneity (i.e., contaminant species cannot be detected in the composition by conventional detection methods) wherein the composition consists essentially of a single macromolecular species. Solvent species, small molecules (<500 Daltons), and elemental ion species are not considered macromolecular species. In some embodiments, the isolated recombinant GLA polypeptides are substantially pure polypeptide compositions.

(41) “Improved enzyme property” refers to an engineered GLA polypeptide that exhibits an improvement in any enzyme property as compared to a reference GLA polypeptide and/or as a wild-type GLA polypeptide or another engineered GLA polypeptide. Improved properties include but are not limited to such properties as increased protein expression, increased thermoactivity, increased thermostability, increased pH activity, increased stability, increased enzymatic activity, increased substrate specificity or affinity, increased specific activity, increased resistance to substrate or end-product inhibition, increased chemical stability, improved chemoselectivity, improved solvent stability, increased tolerance to acidic or basic pH, increased tolerance to proteolytic activity (i.e., reduced sensitivity to proteolysis), reduced aggregation, increased solubility, reduced immunogenicity, improved post-translational modification (e.g., glycosylation), and altered temperature profile.

(42) “Increased enzymatic activity” or “enhanced catalytic activity” refers to an improved property of the engineered GLA polypeptides, which can be represented by an increase in specific activity (e.g., product produced/time/weight protein) or an increase in percent conversion of the substrate to the product (e.g., percent conversion of starting amount of substrate to product in a specified time period using a specified amount of GLA) as compared to the reference GLA enzyme. Exemplary methods to determine enzyme activity are provided in the Examples. Any property relating to enzyme activity may be affected, including the classical enzyme properties of K.sub.m, V.sub.max, or k.sub.cat, changes of which can lead to increased enzymatic activity. Improvements in enzyme activity can be from about 1.1 fold the enzymatic activity of the corresponding wild-type enzyme, to as much as 2-fold, 5-fold, 10-fold, 20-fold, 25-fold, 50-fold, 75-fold, 100-fold, 150-fold, 200-fold or more enzymatic activity than the naturally occurring GLA or another engineered GLA from which the GLA polypeptides were derived.

(43) In some embodiments, the engineered GLA polypeptides have a k.sub.cat of at least 0.1/sec, at least 0.5/sec, at least 1.0/sec, at least 5.0/sec, at least 10.0/sec and in some preferred embodiments greater than 10.0/sec. In some embodiments, the K.sub.m is in the range of about 1 μM to about 5 mM; in the range of about 5 μM to about 2 mM; in the range of about 10 μM to about 2 mM; or in the range of about 10 μM to about 1 mM. In some specific embodiments, the engineered GLA enzyme exhibits improved enzymatic activity after exposure to certain conditions in the range of 1.5 to 10 fold, 1.5 to 25 fold, 1.5 to 50 fold, 1.5 to 100 fold or greater than that of a reference GLA enzyme (e.g., a wild-type GLA or any other reference GLA). GLA activity can be measured by any suitable method known in the art (e.g., standard assays, such as monitoring changes in spectrophotometric properties of reactants or products). In some embodiments, the amount of products produced can be measured by High-Performance Liquid Chromatography (HPLC) separation combined with UV absorbance or fluorescent detection directly or following o-phthaldialdehyde (OPA) derivatization. Comparisons of enzyme activities are made using a defined preparation of enzyme, a defined assay under a set condition, and one or more defined substrates, as further described in detail herein. Generally, when lysates are compared, the numbers of cells and the amount of protein assayed are determined as well as use of identical expression systems and identical host cells to minimize variations in amount of enzyme produced by the host cells and present in the lysates.

(44) The term “improved tolerance to acidic pH” means that a recombinant GLA according to the invention will have increased stability (higher retained activity at about pH 4.8 after exposure to acidic pH for a specified period of time (1 hour, up to 24 hours)) as compared to a reference GLA or another enzyme.

(45) “Physiological pH” as used herein means the pH range generally found in a subject's (e.g., human) blood.

(46) The term “basic pH” (e.g., used with reference to improved stability to basic pH conditions or increased tolerance to basic pH) means a pH range of about 7 to 11.

(47) The term “acidic pH” (e.g., used with reference to improved stability to acidic pH conditions or increased tolerance to acidic pH) means a pH range of about 1.5 to 4.5.

(48) “Conversion” refers to the enzymatic conversion (or biotransformation) of a substrate(s) to the corresponding product(s). “Percent conversion” refers to the percent of the substrate that is converted to the product within a period of time under specified conditions. Thus, the “enzymatic activity” or “activity” of a GLA polypeptide can be expressed as “percent conversion” of the substrate to the product in a specific period of time.

(49) “Hybridization stringency” relates to hybridization conditions, such as washing conditions, in the hybridization of nucleic acids. Generally, hybridization reactions are performed under conditions of lower stringency, followed by washes of varying but higher stringency. The term “moderately stringent hybridization” refers to conditions that permit target-DNA to bind a complementary nucleic acid that has about 60% identity, preferably about 75% identity, about 85% identity to the target DNA, with greater than about 90% identity to target-polynucleotide. Exemplary moderately stringent conditions are conditions equivalent to hybridization in 50% formamide, 5× Denhart's solution, 5×SSPE, 0.2% SDS at 42° C., followed by washing in 0.2×SSPE, 0.2% SDS, at 42° C. “High stringency hybridization” refers generally to conditions that are about 10° C. or less from the thermal melting temperature T.sub.m as determined under the solution condition for a defined polynucleotide sequence. In some embodiments, a high stringency condition refers to conditions that permit hybridization of only those nucleic acid sequences that form stable hybrids in 0.018 M NaCl at 65° C. (i.e., if a hybrid is not stable in 0.018M NaCl at 65° C., it will not be stable under high stringency conditions, as contemplated herein). High stringency conditions can be provided, for example, by hybridization in conditions equivalent to 50% formamide, 5× Denhart's solution, 5×SSPE, 0.2% SDS at 42° C., followed by washing in 0.1×SSPE, and 0.1% SDS at 65° C. Another high stringency condition is hybridizing in conditions equivalent to hybridizing in 5×SSC containing 0.1% (w:v) SDS at 65° C. and washing in 0.1×SSC containing 0.1% SDS at 65° C. Other high stringency hybridization conditions, as well as moderately stringent conditions, are described in the references cited above.

(50) “Codon optimized” refers to changes in the codons of the polynucleotide encoding a protein to those preferentially used in a particular organism such that the encoded protein is more efficiently expressed in the organism of interest. Although the genetic code is degenerate in that most amino acids are represented by several codons, called “synonyms” or “synonymous” codons, it is well known that codon usage by particular organisms is nonrandom and biased towards particular codon triplets. This codon usage bias may be higher in reference to a given gene, genes of common function or ancestral origin, highly expressed proteins versus low copy number proteins, and the aggregate protein coding regions of an organism's genome. In some embodiments, the polynucleotides encoding the GLA enzymes may be codon optimized for optimal production from the host organism selected for expression.

(51) “Control sequence” refers herein to include all components, which are necessary or advantageous for the expression of a polynucleotide and/or polypeptide of the present application. Each control sequence may be native or foreign to the nucleic acid sequence encoding the polypeptide. Such control sequences include, but are not limited to, a leader, polyadenylation sequence, propeptide sequence, promoter sequence, signal peptide sequence, initiation sequence and transcription terminator. At a minimum, the control sequences include a promoter, and transcriptional and translational stop signals. The control sequences may be provided with linkers for the purpose of introducing specific restriction sites facilitating ligation of the control sequences with the coding region of the nucleic acid sequence encoding a polypeptide.

(52) “Operably linked” is defined herein as a configuration in which a control sequence is appropriately placed (i.e., in a functional relationship) at a position relative to a polynucleotide of interest such that the control sequence directs or regulates the expression of the polynucleotide and/or polypeptide of interest.

(53) “Promoter sequence” refers to a nucleic acid sequence that is recognized by a host cell for expression of a polynucleotide of interest, such as a coding sequence. The promoter sequence contains transcriptional control sequences, which mediate the expression of a polynucleotide of interest. The promoter may be any nucleic acid sequence which shows transcriptional activity in the host cell of choice including mutant, truncated, and hybrid promoters, and may be obtained from genes encoding extracellular or intracellular polypeptides either homologous or heterologous to the host cell.

(54) “Suitable reaction conditions” refers to those conditions in the enzymatic conversion reaction solution (e.g., ranges of enzyme loading, substrate loading, temperature, pH, buffers, co-solvents, etc.) under which a GLA polypeptide of the present application is capable of converting a substrate to the desired product compound, Exemplary “suitable reaction conditions” are provided in the present application and illustrated by the Examples. “Loading”, such as in “compound loading” or “enzyme loading” refers to the concentration or amount of a component in a reaction mixture at the start of the reaction. “Substrate” in the context of an enzymatic conversion reaction process refers to the compound or molecule acted on by the GLA polypeptide. “Product” in the context of an enzymatic conversion process refers to the compound or molecule resulting from the action of the GLA polypeptide on a substrate.

(55) As used herein the term “culturing” refers to the growing of a population of microbial cells under any suitable conditions (e.g., using a liquid, gel or solid medium).

(56) Recombinant polypeptides can be produced using any suitable methods known the art. Genes encoding the wild-type polypeptide of interest can be cloned in vectors, such as plasmids, and expressed in desired hosts, such as E. coli, S. cerevisiae, etc. Variants of recombinant polypeptides can be generated by various methods known in the art. Indeed, there is a wide variety of different mutagenesis techniques well known to those skilled in the art. In addition, mutagenesis kits are also available from many commercial molecular biology suppliers. Methods are available to make specific substitutions at defined amino acids (site-directed), specific or random mutations in a localized region of the gene (regio-specific), or random mutagenesis over the entire gene (e.g., saturation mutagenesis). Numerous suitable methods are known to those in the art to generate enzyme variants, including but not limited to site-directed mutagenesis of single-stranded DNA or double-stranded DNA using PCR, cassette mutagenesis, gene synthesis, error-prone PCR, shuffling, and chemical saturation mutagenesis, or any other suitable method known in the art. Non-limiting examples of methods used for DNA and protein engineering are provided in the following patents: U.S. Pat. Nos. 6,117,679; 6,420,175; 6,376,246; 6,586,182; 7,747,391; 7,747,393; 7,783,428; and 8,383,346. After the variants are produced, they can be screened for any desired property (e.g., high or increased activity, or low or reduced activity, increased thermal activity, increased thermal stability, and/or acidic pH stability, etc.). In some embodiments, “recombinant GLA polypeptides” (also referred to herein as “engineered GLA polypeptides,” “variant GLA enzymes,” and “GLA variants”) find use.

(57) As used herein, a “vector” is a DNA construct for introducing a DNA sequence into a cell. In some embodiments, the vector is an expression vector that is operably linked to a suitable control sequence capable of effecting the expression in a suitable host of the polypeptide encoded in the DNA sequence. In some embodiments, an “expression vector” has a promoter sequence operably linked to the DNA sequence (e.g., transgene) to drive expression in a host cell, and in some embodiments, also comprises a transcription terminator sequence.

(58) As used herein, the term “expression” includes any step involved in the production of the polypeptide including, but not limited to, transcription, post-transcriptional modification, translation, and post-translational modification. In some embodiments, the term also encompasses secretion of the polypeptide from a cell.

(59) As used herein, the term “produces” refers to the production of proteins and/or other compounds by cells. It is intended that the term encompass any step involved in the production of polypeptides including, but not limited to, transcription, post-transcriptional modification, translation, and post-translational modification. In some embodiments, the term also encompasses secretion of the polypeptide from a cell.

(60) As used herein, an amino acid or nucleotide sequence (e.g., a promoter sequence, signal peptide, terminator sequence, etc.) is “heterologous” to another sequence with which it is operably linked if the two sequences are not associated in nature.

(61) As used herein, the terms “host cell” and “host strain” refer to suitable hosts for expression vectors comprising DNA provided herein (e.g., the polynucleotides encoding the GLA variants). In some embodiments, the host cells are prokaryotic or eukaryotic cells that have been transformed or transfected with vectors constructed using recombinant DNA techniques as known in the art.

(62) The term “analogue” means a polypeptide having more than 70% sequence identity but less than 100% sequence identity (e.g., more than 75%, 78%, 80%, 83%, 85%, 88%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity) with a reference polypeptide. In some embodiments, analogues mean polypeptides that contain one or more non-naturally occurring amino acid residues including, but not limited, to homoarginine, ornithine and norvaline, as well as naturally occurring amino acids. In some embodiments, analogues also include one or more D-amino acid residues and non-peptide linkages between two or more amino acid residues.

(63) The term “therapeutic” refers to a compound administered to a subject who shows signs or symptoms of pathology having beneficial or desirable medical effects.

(64) The term “pharmaceutical composition” refers to a composition suitable for pharmaceutical use in a mammalian subject (e.g., human) comprising a pharmaceutically effective amount of an engineered GLA polypeptide encompassed by the invention and an acceptable carrier.

(65) The term “effective amount” means an amount sufficient to produce the desired result. One of general skill in the art may determine what the effective amount by using routine experimentation.

(66) The terms “isolated” and “purified” are used to refer to a molecule (e.g., an isolated nucleic acid, polypeptide, etc.) or other component that is removed from at least one other component with which it is naturally associated. The term “purified” does not require absolute purity, rather it is intended as a relative definition.

(67) The term “subject” encompasses mammals such as humans, non-human primates, livestock, companion animals, and laboratory animals (e.g., rodents and lagamorphs). It is intended that the term encompass females as well as males.

(68) As used herein, the term “patient” means any subject that is being assessed for, treated for, or is experiencing disease.

(69) The term “infant” refers to a child in the period of the first month after birth to approximately one (1) year of age. As used herein, the term “newborn” refers to child in the period from birth to the 28.sup.th day of life. The term “premature infant” refers to an infant born after the twentieth completed week of gestation, yet before full term, generally weighing ˜500 to ˜2499 grams at birth. A “very low birth weight infant” is an infant weighing less than 1500 g at birth.

(70) As used herein, the term “child” refers to a person who has not attained the legal age for consent to treatment or research procedures. In some embodiments, the term refers to a person between the time of birth and adolescence.

(71) As used herein, the term “adult” refers to a person who has attained legal age for the relevant jurisdiction (e.g., 18 years of age in the United States). In some embodiments, the term refers to any fully grown, mature organism. In some embodiments, the term “young adult” refers to a person less than 18 years of age, but who has reached sexual maturity.

(72) As used herein, “composition” and “formulation” encompass products comprising at least one engineered GLA of the present invention, intended for any suitable use (e.g., pharmaceutical compositions, dietary/nutritional supplements, feed, etc.).

(73) The terms “administration” and “administering” a composition mean providing a composition of the present invention to a subject (e.g., to a person suffering from the effects of Fabry disease).

(74) The term “carrier” when used in reference to a pharmaceutical composition means any of the standard pharmaceutical carrier, buffers, and excipients, such as stabilizers, preservatives, and adjuvants.

(75) The term “pharmaceutically acceptable” means a material that can be administered to a subject without causing any undesirable biological effects or interacting in a deleterious manner with any of the components in which it is contained and that possesses the desired biological activity.

(76) As used herein, the term “excipient” refers to any pharmaceutically acceptable additive, carrier, diluent, adjuvant, or other ingredient, other than the active pharmaceutical ingredient (API; e.g., the engineered GLA polypeptides of the present invention). Excipients are typically included for formulation and/or administration purposes.

(77) The term “therapeutically effective amount” when used in reference to symptoms of disease/condition refers to the amount and/or concentration of a compound (e.g., engineered GLA polypeptides) that ameliorates, attenuates, or eliminates one or more symptom of a disease/condition or prevents or delays the onset of symptom(s).

(78) The term “therapeutically effective amount” when used in reference to a disease/condition refers to the amount and/or concentration of a composition (e.g., engineered GLA polypeptides) that ameliorates, attenuates, or eliminates the disease/condition. In some embodiments, the term is use in reference to the amount of a composition that elicits the biological (e.g., medical) response by a tissue, system, or animal subject that is sought by the researcher, physician, veterinarian, or other clinician.

(79) It is intended that the terms “treating,” “treat” and “treatment” encompass preventative (e.g., prophylactic), as well as palliative treatment.

(80) Engineered GLA Expression and Activity:

(81) Two strategies for secreted GLA expression were utilized, using the yeast MFα signal peptide (MF-SP) or a longer leader sequence of 83 amino acids (MF-leader) to drive secretion of a yeast codon-optimized mature human GLA. Clones were expressed from a pYT-72 vector in S. cerevisiae strain INVSc1. Both approaches provided supernatants with measurable activity on the fluorogenic substrate 4-methylumbelliferyl α-D-galactopyranoside (4-MuGal). However, the construct with the yeast MFα signal peptide provided 3-fold higher activities and was used as the starting sequence for directed evolution.

(82) To identify mutational diversity, a 13-position conserved “homolog” combinatorial library and a 192-position site saturation mutagenesis library were constructed. Equivalent volumes of supernatant were screened in an unchallenged condition (no incubation, pH 4.8) or following a one-hour incubation in a low pH (3.9-4.2) or high pH (7.1-8.2) environment. GLA variants with increased activity due to increased GLA expression or GLA specific activity were identified based on their fold improvement over the parent GLA. GLA variants with increased stability were identified by dividing the fold-improvement observed under challenged conditions by the fold-improvement observed under unchallenged conditions. This approach reduces the bias towards selecting variants based on increased expression but without changes in specific activity at pH extremes. Composite activity scores (the product of fold-improvements for all three conditions) and stability (the product of stability scores) were used to rank mutations in improved variants for inclusion in subsequent GLA libraries.

(83) Engineered GLA:

(84) In some embodiments the engineered GLA which exhibits an improved property has at least about 85%, at least about 88%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or at about 100% amino acid sequence identity with SEQ ID NO:5, and an amino acid residue difference as compared to SEQ ID NO:5, at one or more amino acid positions (such as at 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 14, 15, 20 or more amino acid positions compared to SEQ ID NO:5, or a sequence having at least 85%, at least 88%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or greater amino acid sequence identity with SEQ ID NO:5). In some embodiment the residue difference as compared to SEQ ID NO:5, at one or more positions will include at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more conservative amino acid substitutions. In some embodiments, the engineered GLA polypeptide is a polypeptide listed in Table 2.1, 2.2, 2.4, 2.5, or Table 7.1.

(85) In some embodiments the engineered GLA which exhibits an improved property has at least about 85%, at least about 88%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or at about 100% amino acid sequence identity with SEQ ID NO:10, and an amino acid residue difference as compared to SEQ ID NO:10, at one or more amino acid positions (such as at 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 14, 15, 20 or more amino acid positions compared to SEQ ID NO:10, or a sequence having at least 85%, at least 88%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or greater amino acid sequence identity with SEQ ID NO:10). In some embodiment the residue difference as compared to SEQ ID NO:10, at one or more positions will include at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more conservative amino acid substitutions. In some embodiments, the engineered GLA polypeptide is a polypeptide listed in Table 2.3.

(86) In some embodiments the engineered GLA which exhibits an improved property has at least 85%, at least 88%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% amino acid sequence identity with SEQ ID NO:5. In some embodiments the engineered GLA which exhibits an improved property has at least 85%, at least 88%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% amino acid sequence identity with SEQ ID NO:10.

(87) In some embodiments, the engineered GLA polypeptide is selected from SEQ ID NOS:15, 13, 10, and 18.

(88) In some embodiments, the engineered GLA polypeptide comprises a functional fragment of an engineered GLA polypeptide encompassed by the invention. Functional fragments have at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% of the activity of the engineered GLA polypeptide from which is was derived (i.e., the parent engineered GLA). A functional fragment comprises at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% and even 99% of the parent sequence of the engineered GLA. In some embodiments the functional fragment is truncated by less than 5, less than 10, less than 15, less than 10, less than 25, less than 30, less than 35, less than 40, less than 45, and less than 50 amino acids.

(89) Polynucleotides Encoding Engineered Polypeptides, Expression Vectors and Host Cells:

(90) The present invention provides polynucleotides encoding the engineered GLA polypeptides described herein. In some embodiments, the polynucleotides are operatively linked to one or more heterologous regulatory sequences that control gene expression to create a recombinant polynucleotide capable of expressing the polypeptide. Expression constructs containing a heterologous polynucleotide encoding the engineered GLA polypeptides can be introduced into appropriate host cells to express the corresponding GLA polypeptide.

(91) As will be apparent to the skilled artisan, availability of a protein sequence and the knowledge of the codons corresponding to the various amino acids provide a description of all the polynucleotides capable of encoding the subject polypeptides. The degeneracy of the genetic code, where the same amino acids are encoded by alternative or synonymous codons, allows an extremely large number of nucleic acids to be made, all of which encode the engineered GLA polypeptide. Thus, having knowledge of a particular amino acid sequence, those skilled in the art could make any number of different nucleic acids by simply modifying the sequence of one or more codons in a way which does not change the amino acid sequence of the protein. In this regard, the present invention specifically contemplates each and every possible variation of polynucleotides that could be made encoding the polypeptides described herein by selecting combinations based on the possible codon choices, and all such variations are to be considered specifically disclosed for any polypeptide described herein, including the variants provided in Tables 2.1, 2.2, 2.3, 2.4, 2.5, and 6.1.

(92) In various embodiments, the codons are preferably selected to fit the host cell in which the protein is being produced. For example, preferred codons used in bacteria are used for expression in bacteria. Consequently, codon optimized polynucleotides encoding the engineered GLA polypeptides contain preferred codons at about 40%, 50%, 60%, 70%, 80%, or greater than 90% of codon positions of the full length coding region.

(93) In some embodiments, as described above, the polynucleotide encodes an engineered polypeptide having GLA activity with the properties disclosed herein, wherein the polypeptide comprises an amino acid sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identity to a reference sequence selected from SEQ ID NOS:5, and/or 10, or the amino acid sequence of any variant as disclosed in Tables 2.1, 2.2, 2.3, 2.4, 2.5, or 6.1, and one or more residue differences as compared to the reference polypeptide of SEQ ID NOS:5, and/or 10, or the amino acid sequence of any variant as disclosed in Tables 2.1, 2.2, 2.3, 2.4, 2.5, or 6.1, (for example 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more amino acid residue positions). In some embodiments, the reference sequence is selected from SEQ ID NO:5 and/or 10. In some embodiments, the polynucleotide encodes an engineered polypeptide having GLA activity with the properties disclosed herein, wherein the polypeptide comprises an amino acid sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to reference sequence SEQ ID NO:5, and one or more residue differences as compared to SEQ ID NO:5, at residue positions selected from those provided in Tables 2.1, 2.2, 2.4, 2.5, or 6.1, when optimally aligned with the polypeptide of SEQ ID NO:5.

(94) In some embodiments, the polynucleotide encodes an engineered polypeptide having GLA activity with the properties disclosed herein, wherein the polypeptide comprises an amino acid sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to reference sequence SEQ ID NO:10, and one or more residue differences as compared to SEQ ID NO:10, at residue positions selected from those provided in Tables 2.3, when optimally aligned with the polypeptide of SEQ ID NO:10.

(95) In some embodiments, the polynucleotide encoding the engineered GLA polypeptides comprises a polynucleotide sequence selected from a polynucleotide sequence encoding SEQ ID NOS:10, 13, 15, 18, 21, and 24. In some embodiments, the polynucleotide encoding an engineered GLA polypeptide has at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 93%, 95%, 96%, 97%, 98%, 99% nucleotide residue identity to SEQ ID NOS: 8, 9, 11, 12, 14, 16, 17, 19, 20, 22, and/or 23. In some embodiments, the polynucleotide encoding the engineered GLA polypeptides comprises a polynucleotide sequence selected from SEQ ID NOS:8, 9, 11, 12, 14, 16, 17, 19, 20, 22, and 23.

(96) In some embodiments, the polynucleotides are capable of hybridizing under highly stringent conditions to a reference polynucleotide sequence selected from SEQ ID NOS: 8, 9, 11, 12, 14, 16, 17, 19, 20, 22, and 23, or a complement thereof, or a polynucleotide sequence encoding any of the variant GLA polypeptides provided herein. In some embodiments, the polynucleotide capable of hybridizing under highly stringent conditions encodes a GLA polypeptide comprising an amino acid sequence that has one or more residue differences as compared to SEQ ID NO:5 and/or 10, at residue positions selected from any positions as set forth in Tables 2.1, 2.2, 2.3, 2.4, 2.5, and/or 6.1.

(97) In some embodiments, an isolated polynucleotide encoding any of the engineered GLA polypeptides provided herein is manipulated in a variety of ways to provide for expression of the polypeptide. In some embodiments, the polynucleotides encoding the polypeptides are provided as expression vectors where one or more control sequences is present to regulate the expression of the polynucleotides and/or polypeptides. Manipulation of the isolated polynucleotide prior to its insertion into a vector may be desirable or necessary depending on the expression vector. The techniques for modifying polynucleotides and nucleic acid sequences utilizing recombinant DNA methods are well known in the art.

(98) In some embodiments, the control sequences include among other sequences, promoters, leader sequences, polyadenylation sequences, propeptide sequences, signal peptide sequences, and transcription terminators. As known in the art, suitable promoters can be selected based on the host cells used. Exemplary promoters for filamentous fungal host cells, include promoters obtained from the genes for Aspergillus oryzae TAKA amylase, Rhizomucor miehei aspartic proteinase, Aspergillus niger neutral alpha-amylase, Aspergillus niger acid stable alpha-amylase, Aspergillus niger or Aspergillus awamori glucoamylase (glaA), Rhizomucor miehei lipase, Aspergillus oryzae alkaline protease, Aspergillus oryzae triose phosphate isomerase, Aspergillus nidulans acetamidase, and Fusarium oxysporum trypsin-like protease (See e.g., WO 96/00787), as well as the NA2-tpi promoter (a hybrid of the promoters from the genes for Aspergillus niger neutral alpha-amylase and Aspergillus oryzae triose phosphate isomerase), and mutant, truncated, and hybrid promoters thereof. Exemplary yeast cell promoters can be from the genes can be from the genes for Saccharomyces cerevisiae enolase (ENO-1), Saccharomyces cerevisiae galactokinase (GAL1), Saccharomyces cerevisiae alcohol dehydrogenase/glyceraldehyde-3-phosphate dehydrogenase (ADH2/GAP), and Saccharomyces cerevisiae 3-phosphoglycerate kinase. Other useful promoters for yeast host cells are known in the art (See e.g., Romanos et al., Yeast 8:423-488 [1992]). Exemplary promoters for use in mammalian cells include, but are not limited to those from cytomegalovirus (CMV), Simian vacuolating virus 40 (SV40), from Homo sapiens phosphorglycerate kinase, beta actin, elongation factor-1a or glyceraldehyde-3-phosphate dehydrogenase, or from Gallus gallus' β-actin.

(99) In some embodiments, the control sequence is a suitable transcription terminator sequence, a sequence recognized by a host cell to terminate transcription. The terminator sequence is operably linked to the 3′ terminus of the nucleic acid sequence encoding the polypeptide. Any terminator which is functional in the host cell of choice finds use in the present invention. For example, exemplary transcription terminators for filamentous fungal host cells can be obtained from the genes for Aspergillus oryzae TAKA amylase, Aspergillus niger glucoamylase, Aspergillus nidulans anthranilate synthase, Aspergillus niger alpha-glucosidase, and Fusarium oxysporum trypsin-like protease. Exemplary terminators for yeast host cells can be obtained from the genes for Saccharomyces cerevisiae enolase, Saccharomyces cerevisiae cytochrome C (CYC1), and Saccharomyces cerevisiae glyceraldehyde-3-phosphate dehydrogenase. Other useful terminators for yeast host cells are known in the art (See e.g., Romanos et al., supra). Exemplary terminators for mammalian cells include, but are not limited to those from cytomegalovirus (CMV), Simian vacuolating virus 40 (SV40), or from Homo sapiens growth hormone.

(100) In some embodiments, the control sequence is a suitable leader sequence, a non-translated region of an mRNA that is important for translation by the host cell. The leader sequence is operably linked to the 5′ terminus of the nucleic acid sequence encoding the polypeptide. Any leader sequence that is functional in the host cell of choice may be used. Exemplary leaders for filamentous fungal host cells are obtained from the genes for Aspergillus oryzae TAKA amylase and Aspergillus nidulans triose phosphate isomerase. Suitable leaders for yeast host cells include, but are not limited to those obtained from the genes for Saccharomyces cerevisiae enolase (ENO-1), Saccharomyces cerevisiae 3-phosphoglycerate kinase, Saccharomyces cerevisiae alpha-factor, and Saccharomyces cerevisiae alcohol dehydrogenase/glyceraldehyde-3-phosphate dehydrogenase (ADH2/GAP).

(101) The control sequence may also be a polyadenylation sequence, a sequence operably linked to the 3′ terminus of the nucleic acid sequence and which, when transcribed, is recognized by the host cell as a signal to add polyadenosine residues to transcribed mRNA. Any polyadenylation sequence which is functional in the host cell of choice may be used in the present invention. Exemplary polyadenylation sequences for filamentous fungal host cells include, but are not limited to those from the genes for Aspergillus oryzae TAKA amylase, Aspergillus niger glucoamylase, Aspergillus nidulans anthranilate synthase, Fusarium oxysporum trypsin-like protease, and Aspergillus niger alpha-glucosidase. Useful polyadenylation sequences for yeast host cells are also known in the art (See e.g., Guo and Sherman, Mol. Cell. Bio., 15:5983-5990 [1995]).

(102) In some embodiments, the control sequence is a signal peptide coding region that codes for an amino acid sequence linked to the amino terminus of a polypeptide and directs the encoded polypeptide into the cell's secretory pathway. The 5′ end of the coding sequence of the nucleic acid sequence may inherently contain a signal peptide coding region naturally linked in translation reading frame with the segment of the coding region that encodes the secreted polypeptide. Alternatively, the 5′ end of the coding sequence may contain a signal peptide coding region that is foreign to the coding sequence. Any signal peptide coding region that directs the expressed polypeptide into the secretory pathway of a host cell of choice finds use for expression of the engineered GLA polypeptides provided herein. Effective signal peptide coding regions for filamentous fungal host cells include, but are not limited to the signal peptide coding regions obtained from the genes for Aspergillus oryzae TAKA amylase, Aspergillus niger neutral amylase, Aspergillus niger glucoamylase, Rhizomucor miehei aspartic proteinase, Humicola insolens cellulase, and Humicola lanuginosa lipase. Useful signal peptides for yeast host cells include, but are not limited to those from the genes for Saccharomyces cerevisiae alpha-factor and Saccharomyces cerevisiae invertase. Useful signal peptides for mammalian host cells include but are not limited to those from the genes for immunoglobulin gamma (IgG).

(103) In some embodiments, the control sequence is a propeptide coding region that codes for an amino acid sequence positioned at the amino terminus of a polypeptide. The resultant polypeptide is referred to as a “proenzyme,” “propolypeptide,” or “zymogen,” in some cases). A propolypeptide can be converted to a mature active polypeptide by catalytic or autocatalytic cleavage of the propeptide from the propolypeptide.

(104) In another aspect, the present invention also provides a recombinant expression vector comprising a polynucleotide encoding an engineered GLA polypeptide, and one or more expression regulating regions such as a promoter and a terminator, a replication origin, etc., depending on the type of hosts into which they are to be introduced. in some embodiments, the various nucleic acid and control sequences described above are joined together to produce a recombinant expression vector which includes one or more convenient restriction sites to allow for insertion or substitution of the nucleic acid sequence encoding the variant GLA polypeptide at such sites. Alternatively, the polynucleotide sequence(s) of the present invention are expressed by inserting the polynucleotide sequence or a nucleic acid construct comprising the polynucleotide sequence into an appropriate vector for expression. In creating the expression vector, the coding sequence is located in the vector so that the coding sequence is operably linked with the appropriate control sequences for expression.

(105) The recombinant expression vector may be any vector (e.g., a plasmid or virus), that can be conveniently subjected to recombinant DNA procedures and can result in the expression of the variant GLA polynucleotide sequence. The choice of the vector will typically depend on the compatibility of the vector with the host cell into which the vector is to be introduced. The vectors may be linear or closed circular plasmids.

(106) In some embodiments, the expression vector is an autonomously replicating vector (i.e., a vector that exists as an extra-chromosomal entity, the replication of which is independent of chromosomal replication, such as a plasmid, an extra-chromosomal element, a minichromosome, or an artificial chromosome). The vector may contain any means for assuring self-replication. In some alternative embodiments, the vector may be one which, when introduced into the host cell, is integrated into the genome and replicated together with the chromosome(s) into which it has been integrated. Furthermore, a single vector or plasmid or two or more vectors or plasmids which together contain the total DNA to be introduced into the genome of the host cell, or a transposon may be used.

(107) In some embodiments, the expression vector preferably contains one or more selectable markers, which permit easy selection of transformed cells. A “selectable marker” is a gene the product of which provides for biocide or viral resistance, resistance to heavy metals, prototrophy to auxotrophs, and the like. Suitable markers for yeast host cells include, but are not limited to ADE2, HIS3, LEU2, LYS2, MET3, TRP1, and URA3. Selectable markers for use in a filamentous fungal host cell include, but are not limited to, amdS (acetamidase), argB (ornithine carbamoyltransferases), bar (phosphinothricin acetyltransferase), hph (hygromycin phosphotransferase), niaD (nitrate reductase), pyrG (orotidine-5′-phosphate decarboxylase), sC (sulfate adenyltransferase), and trpC (anthranilate synthase), as well as equivalents thereof. In another aspect, the present invention provides a host cell comprising a polynucleotide encoding at least one engineered GLA polypeptide of the present application, the polynucleotide being operatively linked to one or more control sequences for expression of the engineered GLA enzyme(s) in the host cell. Host cells for use in expressing the polypeptides encoded by the expression vectors of the present invention are well known in the art and include but are not limited to, fungal cells, such as yeast cells (e.g., Saccharomyces cerevisiae and Pichia pastoris [e.g., ATCC Accession No. 201178]); insect cells (e.g., Drosophila S2 and Spodoptera Sf9 cells), plant cells, animal cells (e.g., CHO, COS, and BHK), and human cells (e.g., HEK293T, human fibroblast, THP-1, Jurkat and Bowes melanoma cell lines).

(108) Accordingly, in another aspect, the present invention provides methods for producing the engineered GLA polypeptides, where the methods comprise culturing a host cell capable of expressing a polynucleotide encoding the engineered GLA polypeptide under conditions suitable for expression of the polypeptide. In some embodiments, the methods further comprise the steps of isolating and/or purifying the GLA polypeptides, as described herein.

(109) Appropriate culture media and growth conditions for the above-described host cells are well known in the art. Polynucleotides for expression of the GLA polypeptides may be introduced into cells by various methods known in the art. Techniques include, among others, electroporation, biolistic particle bombardment, liposome mediated transfection, calcium chloride transfection, and protoplast fusion.

(110) The engineered GLA with the properties disclosed herein can be obtained by subjecting the polynucleotide encoding the naturally occurring or engineered GLA polypeptide to mutagenesis and/or directed evolution methods known in the art, and as described herein. An exemplary directed evolution technique is mutagenesis and/or DNA shuffling (See e.g., Stemmer, Proc. Natl. Acad. Sci. USA 91:10747-10751 [1994]; WO 95/22625; WO 97/0078; WO 97/35966; WO 98/27230; WO 00/42651; WO 01/75767 and U.S. Pat. No. 6,537,746). Other directed evolution procedures that can be used include, among others, staggered extension process (StEP), in vitro recombination (See e.g., Zhao et al., Nat. Biotechnol., 16:258-261 [1998]), mutagenic PCR (See e.g., Caldwell et al., PCR Methods Appl., 3:S136-S140 [1994]), and cassette mutagenesis (See e.g., Black et al., Proc. Natl. Acad. Sci. USA 93:3525-3529 [1996]).

(111) For example, mutagenesis and directed evolution methods can be readily applied to polynucleotides to generate variant libraries that can be expressed, screened, and assayed. Mutagenesis and directed evolution methods are well known in the art (See e.g., U.S. Pat. Nos. 5,605,793, 5,811,238, 5,830,721, 5,834,252, 5,837,458, 5,928,905, 6,096,548, 6,117,679, 6,132,970, 6,165,793, 6,180,406, 6,251,674, 6,277,638, 6,287,861, 6,287,862, 6,291,242, 6,297,053, 6,303,344, 6,309,883, 6,319,713, 6,319,714, 6,323,030, 6,326,204, 6,335,160, 6,335,198, 6,344,356, 6,352,859, 6,355,484, 6,358,740, 6,358,742, 6,365,377, 6,365,408, 6,368,861, 6,372,497, 6,376,246, 6,379,964, 6,387,702, 6,391,552, 6,391,640, 6,395,547, 6,406,855, 6,406,910, 6,413,745, 6,413,774, 6,420,175, 6,423,542, 6,426,224, 6,436,675, 6,444,468, 6,455,253, 6,479,652, 6,482,647, 6,489,146, 6,506,602, 6,506,603, 6,519,065, 6,521,453, 6,528,311, 6,537,746, 6,573,098, 6,576,467, 6,579,678, 6,586,182, 6,602,986, 6,613,514, 6,653,072, 6,716,631, 6,946,296, 6,961,664, 6,995,017, 7,024,312, 7,058,515, 7,105,297, 7,148,054, 7,288,375, 7,421,347, 7,430,477, 7,534,564, 7,620,500, 7,620,502, 7,629,170, 7,702,464, 7,747,391, 7,747,393, 7,751,986, 7,776,598, 7,783,428, 7,795,030, 7,853,410, 7,868,138, 7,873,499, 7,904,249, 7,957,912, 8,383,346, 8,504,498, 8,849,575, 8,876,066, 8,768,871, and all related non-US counterparts; Ling et al., Anal. Biochem., 254(2):157-78 [1997]; Dale et al., Meth. Mol. Biol., 57:369-74 [1996]; Smith, Ann. Rev. Genet., 19:423-462 [1985]; Botstein et al., Science, 229:1193-1201 [1985]; Carter, Biochem. J., 237:1-7 [1986]; Kramer et al., Cell, 38:879-887 [1984]; Wells et al., Gene, 34:315-323 [1985]; Minshull et al., Curr. Op. Chem. Biol., 3:284-290 [1999]; Christians et al., Nat. Biotechnol., 17:259-264 [1999]; Crameri et al., Nature, 391:288-291 [1998]; Crameri, et al., Nat. Biotechnol., 15:436-438 [1997]; Zhang et al., Proc. Nat. Acad. Sci. U.S.A., 94:4504-4509 [1997]; Crameri et al., Nat. Biotechnol., 14:315-319 [1996]; Stemmer, Nature, 370:389-391 [1994]; Stemmer, Proc. Nat. Acad. Sci. USA, 91:10747-10751 [1994]; US Pat. Appln. Publn. Nos. 2008/0220990, US 2009/0312196, US2014/0005057, US2014/0214391, US2014/0221216; US2015/0050658, US2015/0133307, US2015/0134315 and all related non-US counterparts; WO 95/22625, WO 97/0078, WO 97/35966, WO 98/27230, WO 00/42651, WO 01/75767, and WO 2009/152336; all of which are incorporated herein by reference).

(112) In some embodiments, the enzyme variants obtained following mutagenesis treatment are screened by subjecting the enzyme variants to a defined temperature (or other assay conditions) and measuring the amount of enzyme activity remaining after heat treatments or other assay conditions. DNA containing the polynucleotide encoding the GLA polypeptide is then isolated from the host cell, sequenced to identify the nucleotide sequence changes (if any), and used to express the enzyme in a different or the same host cell. Measuring enzyme activity from the expression libraries can be performed using any suitable method known in the art (e.g., standard biochemistry techniques, such as HPLC analysis).

(113) For engineered polypeptides of known sequence, the polynucleotides encoding the enzyme can be prepared by standard solid-phase methods, according to known synthetic methods. In some embodiments, fragments of up to about 100 bases can be individually synthesized, then joined (e.g., by enzymatic or chemical litigation methods, or polymerase mediated methods) to form any desired continuous sequence. For example, polynucleotides and oligonucleotides disclosed herein can be prepared by chemical synthesis using the classical phosphoramidite method (See e.g., Beaucage et al., Tetra. Lett., 22:1859-69 [1981]; and Matthes et al., EMBO J., 3:801-05 [1984]), as it is typically practiced in automated synthetic methods. According to the phosphoramidite method, oligonucleotides are synthesized (e.g., in an automatic DNA synthesizer), purified, annealed, ligated and cloned in appropriate vectors.

(114) Accordingly, in some embodiments, a method for preparing the engineered GLA polypeptide can comprise: (a) synthesizing a polynucleotide encoding a polypeptide comprising an amino acid sequence selected from the amino acid sequence of any variant provided in Table 2.1, 2.2, 2.3, 2.4, 2.5, and/or 6.1, as well as SEQ ID NOS:10, 13, 15, 18, 21, and/or 24, and (b) expressing the GLA polypeptide encoded by the polynucleotide. In some embodiments of the method, the amino acid sequence encoded by the polynucleotide can optionally have one or several (e.g., up to 3, 4, 5, or up to 10) amino acid residue deletions, insertions and/or substitutions. In some embodiments, the amino acid sequence has optionally 1-2, 1-3, 1-4, 1-5, 1-6, 1-7, 1-8, 1-9, 1-10, 1-15, 1-20, 1-21, 1-22, 1-23, 1-24, 1-25, 1-30, 1-35, 1-40, 1-45, or 1-50 amino acid residue deletions, insertions and/or substitutions. In some embodiments, the amino acid sequence has optionally 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 30, 35, 40, 45, or 50 amino acid residue deletions, insertions and/or substitutions. In some embodiments, the amino acid sequence has optionally 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 18, 20, 21, 22, 23, 24, or 25 amino acid residue deletions, insertions and/or substitutions. In some embodiments, the substitutions can be conservative or non-conservative substitutions.

(115) The expressed engineered GLA polypeptide can be assessed for any desired improved property (e.g., activity, selectivity, stability, acid tolerance, protease sensitivity, etc.), using any suitable assay known in the art, including but not limited to the assays and conditions described herein.

(116) In some embodiments, any of the engineered GLA polypeptides expressed in a host cell are recovered from the cells and/or the culture medium using any one or more of the well-known techniques for protein purification, including, among others, lysozyme treatment, sonication, filtration, salting-out, ultra-centrifugation, and chromatography.

(117) Chromatographic techniques for isolation of the GLA polypeptides include, among others, reverse phase chromatography high performance liquid chromatography, ion exchange chromatography, hydrophobic interaction chromatography, gel electrophoresis, and affinity chromatography. Conditions for purifying a particular enzyme depends, in part, on factors such as net charge, hydrophobicity, hydrophilicity, molecular weight, molecular shape, etc., and will be apparent to those having skill in the art. In some embodiments, affinity techniques may be used to isolate the improved variant GLA enzymes. In some embodiments utilizing affinity chromatography purification, any antibody which specifically binds the variant GLA polypeptide finds use. In some embodiments utilizing affinity chromatography purification, proteins that bind to the glycans covalently attached to GLA find use. In still other embodiments utilizing affinity-chromatography purifications, any small molecule that binds to the GLA active site finds use. For the production of antibodies, various host animals, including but not limited to rabbits, mice, rats, etc., are immunized by injection with a GLA polypeptide (e.g., a GLA variant), or a fragment thereof. in some embodiments, the GLA polypeptide or fragment is attached to a suitable carrier, such as BSA, by means of a side chain functional group or linkers attached to a side chain functional group.

(118) In some embodiments, the engineered GLA polypeptide is produced in a host cell by a method comprising culturing a host cell (e.g., S. cerevisiae, Daucus carota, Nicotiana tabacum, H. sapiens (e.g., HEK293T), or Cricetulus griseus (e.g., CHO)) comprising a polynucleotide sequence encoding an engineered GLA polypeptide as described herein under conditions conducive to the production of the engineered GLA polypeptide and recovering the engineered GLA polypeptide from the cells and/or culture medium.

(119) In some embodiments, the invention encompasses a method of producing an engineered GLA polypeptide comprising culturing a recombinant eukaryotic cell comprising a polynucleotide sequence encoding an engineered GLA polypeptide having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to reference sequences SEQ ID NOS:5 and/or 10, and one or more amino acid residue differences as compared to SEQ ID NO:5 and/or 10, selected from those provided in Tables 2.1, 2.2, 2.4, 2.5, and/or 6.1, and/or combinations thereof when optimally aligned with the amino acid sequence of SEQ ID NO:5 and/or 10, under suitable culture conditions to allow the production of the engineered GLA polypeptide and optionally recovering the engineered GLA polypeptide from the culture and/or cultured bacterial cells.

(120) In some embodiments, once the engineered GLA polypeptides are recovered from the recombinant host cells or cell culture medium, they are further purified by any suitable method(s) known in the art. In some additional embodiments, the purified GLA polypeptides are combined with other ingredients and compounds to provide compositions and formulations comprising the engineered GLA polypeptide as appropriate for different applications and uses (e.g., pharmaceutical compositions). In some additional embodiments, the purified GLA polypeptides, or the formulated GLA polypeptides are lyophilized.

(121) Compositions:

(122) The present invention provides various compositions and formats, including but not limited to those described below. In some embodiments, the present invention provides engineered GLA polypeptides suitable for use in pharmaceutical and other compositions, such as dietary/nutritional supplements.

(123) Depending on the mode of administration, these compositions comprising a therapeutically effective amount of an engineered GLA according to the invention are in the form of a solid, semi-solid, or liquid. In some embodiments, the compositions include other pharmaceutically acceptable components such as diluents, buffers, excipients, salts, emulsifiers, preservatives, stabilizers, fillers, and other ingredients. Details on techniques for formulation and administration are well known in the art and described in the literature.

(124) In some embodiments, the engineered GLA polypeptides are formulated for use in pharmaceutical compositions. Any suitable format for use in delivering the engineered GLA polypeptides find use in the present invention, including but not limited to pills, tablets, gel tabs, capsules, lozenges, dragees, powders, soft gels, sol-gels, gels, emulsions, implants, patches, sprays, ointments, liniments, creams, pastes, jellies, paints, aerosols, chewing gums, demulcents, sticks, solutions, suspensions (including but not limited to oil-based suspensions, oil-in water emulsions, etc.), slurries, syrups, controlled release formulations, suppositories, etc. In some embodiments, the engineered GLA polypeptides are provided in a format suitable for injection or infusion (i.e., in an injectable formulation). In some embodiments, the engineered GLA polypeptides are provided in biocompatible matrices such as sol-gels, including silica-based (e.g., oxysilane) sol-gels. In some embodiments, the engineered GLA polypeptides are encapsulated. In some alternative embodiments, the engineered GLA polypeptides are encapsulated in nanostructures (e.g., nanotubes, nanotubules, nanocapsules, or microcapsules, microspheres, liposomes, etc.). Indeed, it is not intended that the present invention be limited to any particular delivery formulation and/or means of delivery. It is intended that the engineered GLA polypeptides be administered by any suitable means known in the art, including but not limited to parenteral, oral, topical, transdermal, intranasal, intraocular, intrathecal, via implants, etc.

(125) In some embodiments, the engineered GLA polypeptides are chemically modified by glycosylation, chemical crosslinking reagents, pegylation (i.e., modified with polyethylene glycol [PEG] or activated PEG, etc.) or other compounds (See e.g., Ikeda, Amino Acids 29:283-287 [2005]; U.S. Pat. Nos. 7,531,341, 7,534,595, 7,560,263, and 7,53,653; US Pat. Appln. Publ. Nos. 2013/0039898, 2012/0177722, etc.). Indeed, it is not intended that the present invention be limited to any particular delivery method and/or mechanism.

(126) In some additional embodiments, the engineered GLA polypeptides are provided in formulations comprising matrix-stabilized enzyme crystals. In some embodiments, the formulation comprises a cross-linked crystalline engineered GLA enzyme and a polymer with a reactive moiety that adheres to the enzyme crystals. The present invention also provides engineered GLA polypeptides in polymers.

(127) In some embodiments, compositions comprising the engineered GLA polypeptides of the present invention include one or more commonly used carrier compounds, including but not limited to sugars (e.g., lactose, sucrose, mannitol, and/or sorbitol), starches (e.g., corn, wheat, rice, potato, or other plant starch), cellulose (e.g., methyl cellulose, hydroxypropylmethyl cellulose, sodium carboxy-methylcellulose), gums (e.g., arabic, tragacanth, guar, etc.), and/or proteins (e.g., gelatin, collagen, etc.).

(128) In some embodiments, the present invention provides engineered GLA polypeptides suitable for use in decreasing the concentration of glycolipids in fluids such as blood, cerebrospinal fluid, etc. The dosage of engineered GLA polypeptide(s) administered depends upon the condition or disease, the general condition of the subject, and other factors known to those in the art. In some embodiments, the compositions are intended for single or multiple administrations. In some embodiments, it is contemplated that the concentration of engineered GLA polypeptide(s) in the composition(s) administered to a human with Fabry disease is sufficient to effectively treat, and/or ameliorate disease (e.g., Fabry disease). In some embodiments, the engineered GLA polypeptides are administered in combination with other pharmaceutical and/or dietary compositions.

EXPERIMENTAL

(129) The following Examples, including experiments and results achieved, are provided for illustrative purposes only and are not to be construed as limiting the present invention.

(130) In the experimental disclosure below, the following abbreviations apply: ppm (parts per million); M (molar); mM (millimolar), uM and μM (micromolar); nM (nanomolar); mol (moles); gm and g (gram); mg (milligrams); ug and μg (micrograms); L and 1 (liter); ml and mL (milliliter); cm (centimeters); mm (millimeters); um and μm (micrometers); sec. (seconds); min(s) (minute(s)); h(s) and hr(s) (hour(s)); U (units); MW (molecular weight); rpm (rotations per minute); ° C. (degrees Centigrade); CDS (coding sequence); DNA (deoxyribonucleic acid); RNA (ribonucleic acid); E. coli W3110 (commonly used laboratory E. coli strain, available from the Coli Genetic Stock Center [CGSC], New Haven, Conn.); HPLC (high pressure liquid chromatography); MWCO (molecular weight cut-off); SDS-PAGE (sodium dodecyl sulfate polyacrylamide gel electrophoresis); PES (polyethersulfone); CFSE (carboxyfluorescein succinimidyl ester); IPTG (isopropyl β-D-1-thiogalactopyranoside); PMBS (polymyxin B sulfate); NADPH (nicotinamide adenine dinucleotide phosphate); GIDH (glutamate dehydrogenase); FIOPC (fold improvements over positive control); PBMC (peripheral blood mononuclear cells); LB (Luria broth); MeOH (methanol); Athens Research (Athens Research Technology, Athens, Ga.); ProSpec (ProSpec Tany Technogene, East Brunswick, N.J.); Sigma-Aldrich (Sigma-Aldrich, St. Louis, Mo.); Ram Scientific (Ram Scientific, Inc., Yonkers, N.Y.); Pall Corp. (Pall, Corp., Pt. Washington, N.Y.); Millipore (Millipore, Corp., Billerica Mass.); Difco (Difco Laboratories, BD Diagnostic Systems, Detroit, Mich.); Molecular Devices (Molecular Devices, LLC, Sunnyvale, Calif.); Kuhner (Adolf Kuhner, AG, Basel, Switzerland); Axygen (Axygen, Inc., Union City, Calif.); Toronto Research Chemicals (Toronto Research Chemicals Inc., Toronto, Ontario, Canada); Cambridge Isotope Laboratories, (Cambridge Isotope Laboratories, Inc., Tewksbury, Mass.); Applied Biosystems (Applied Biosystems, part of Life Technologies, Corp., Grand Island, N.Y.), Agilent (Agilent Technologies, Inc., Santa Clara, Calif.); Thermo Scientific (part of Thermo Fisher Scientific, Waltham, Mass.); Corning (Corning, Inc., Palo Alto, Calif.); Megazyme (Megazyme International, Wicklow, Ireland); Enzo (Enzo Life Sciences, Inc., Farmingdale, N.Y.); GE Healthcare (GE Healthcare Bio-Sciences, Piscataway, N.J.); Pierce (Pierce Biotechnology (now part of Thermo Fisher Scientific), Rockford, Ill.); LI-COR (LI-COR Biotechnology, Lincoln, Nebr.); Amicus (Amicus Therapeutics, Cranbury, N.J.); Phenomenex (Phenomenex, Inc., Torrance, Calif.); Optimal (Optimal Biotech Group, Belmont, Calif.); and Bio-Rad (Bio-Rad Laboratories, Hercules, Calif.).

(131) The following polynucleotide and polypeptide sequences find use in the present invention. In some cases (as shown below), the polynucleotide sequence is followed by the encoded polypeptide.

(132) TABLE-US-00001 Polynucleotide sequence of full length human GLA cDNA (SEQ ID NO. 1): (SEQ ID NO: 1) ATGCAGCTGAGGAACCCAGAACTACATCTGGGCTGCGCGCTTGCGCTTCGCTTCCTGGCC CTCGTTTCCTGGGACATCCCTGGGGCTAGAGCACTGGACAATGGATTGGCAAGGACGCCT ACCATGGGCTGGCTGCACTGGGAGCGCTTCATGTGCAACCTTGACTGCCAGGAAGAGCC AGATTCCTGCATCAGTGAGAAGCTCTTCATGGAGATGGCAGAGCTCATGGTCTCAGAAG GCTGGAAGGATGCAGGTTATGAGTACCTCTGCATTGATGACTGTTGGATGGCTCCCCAAA GAGATTCAGAAGGCAGACTTCAGGCAGACCCTCAGCGCTTTCCTCATGGGATTCGCCAGC TAGCTAATTATGTTCACAGCAAAGGACTGAAGCTAGGGATTTATGCAGATGTTGGAAAT AAAACCTGCGCAGGCTTCCCTGGGAGTTTTGGATACTACGACATTGATGCCCAGACCTTT GCTGACTGGGGAGTAGATCTGCTAAAATTTGATGGTTGTTACTGTGACAGTTTGGAAAAT TTGGCAGATGGTTATAAGCACATGTCCTTGGCCCTGAATAGGACTGGCAGAAGCATTGTG TACTCCTGTGAGTGGCCTCTTTATATGTGGCCCTTTCAAAAGCCCAATTATACAGAAATC CGACAGTACTGCAATCACTGGCGAAATTTTGCTGACATTGATGATTCCTGGAAAAGTATA AAGAGTATCTTGGACTGGACATCTTTTAACCAGGAGAGAATTGTTGATGTTGCTGGACCA GGGGGTTGGAATGACCCAGATATGTTAGTGATTGGCAACTTTGGCCTCAGCTGGAATCAG CAAGTAACTCAGATGGCCCTCTGGGCTATCATGGCTGCTCCTTTATTCATGTCTAATGACC TCCGACACATCAGCCCTCAAGCCAAAGCTCTCCTTCAGGATAAGGACGTAATTGCCATCA ATCAGGACCCCTTGGGCAAGCAAGGGTACCAGCTTAGACAGGGAGACAACTTTGAAGTG TGGGAACGACCTCTCTCAGGCTTAGCCTGGGCTGTAGCTATGATAAACCGGCAGGAGATT GGTGGACCTCGCTCTTATACCATCGCAGTTGCTTCCCTGGGTAAAGGAGTGGCCTGTAAT CCTGCCTGCTTCATCACACAGCTCCTCCCTGTGAAAAGGAAGCTAGGGTTCTATGAATGG ACTTCAAGGTTAAGAAGTCACATAAATCCCACAGGCACTGTTTTGCTTCAGCTAGAAAAT ACAATGCAGATGTCATTAAAAGACTTACTTTAG Polypeptide sequence of full length human GLA: (SEQ ID NO: 2) MQLRNPELHLGCALALRFLALVSWDIPGARALDNGLARTPTMGWLHWERFMCNLDCQEEP DSCISEKLFMEMAELMVSEGWKDAGYEYLCIDDCWMAPQRDSEGRLQADPQRFPHGIRQLA NYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTFADWGVDLLKFDGCYCDSLENLAD GYKHMSLALNRTGRSIVYSCEWPLYMWPFQKPNYTEIRQYCNHWRNFADIDDSWKSIKSILD WTSFNQERIVDVAGPGGWNDPDMLVIGNFGLSWNQQVTQMALWAIMAAPLFMSNDLRHIS PQAKALLQDKDVIAINQDPLGKQGYQLRQGDNFEVWERPLSGLAWAVAMINRQEIGGPRSY TIAVASLGKGVACNPACFITQLLPVKRKLGFYEWTSRLRSHINPTGTVLLQLENTMQMSLKD LL Polynucleotide sequence of mature yeast codon-optimized (yCDS) human GLA: (SEQ ID NO: 3) TTGGATAACGGGTTAGCCCGTACACCTACTATGGGTTGGCTTCACTGGGAAAGATTCATG TGTAACTTAGATTGCCAAGAAGAGCCTGACAGCTGTATCTCAGAGAAACTATTCATGGA GATGGCTGAACTAATGGTAAGTGAAGGATGGAAGGATGCTGGTTATGAATACCTATGTA TTGATGATTGCTGGATGGCTCCACAGCGTGATTCAGAAGGTAGGTTACAAGCTGACCCCC AGAGATTCCCACATGGCATACGTCAGCTTGCAAACTACGTACACAGCAAGGGTCTAAAG TTAGGCATCTACGCTGATGTCGGAAACAAGACATGTGCTGGTTTCCCAGGTTCATTCGGT TACTATGACATAGATGCGCAGACGTTTGCTGATTGGGGTGTTGATTTGTTGAAGTTTGAT GGATGCTACTGCGATTCCCTGGAGAACCTAGCCGATGGGTACAAACACATGAGTTTGGCT CTAAACAGGACTGGTAGGAGCATCGTCTATAGTTGTGAATGGCCCTTGTACATGTGGCCG TTTCAGAAGCCAAACTACACTGAGATAAGACAATACTGTAACCATTGGCGTAACTTTGCT GACATAGATGATTCATGGAAGTCAATCAAATCTATCTTGGATTGGACTTCTTTCAACCAG GAAAGAATTGTTGATGTTGCAGGTCCAGGTGGATGGAATGACCCTGATATGCTTGTCATA GGGAACTTTGGGCTATCATGGAATCAACAAGTTACACAAATGGCTTTGTGGGCGATCATG GCCGCACCCCTATTCATGTCTAATGATCTACGTCACATATCACCCCAAGCAAAGGCTTTA CTTCAAGATAAGGATGTCATAGCGATCAACCAAGATCCTCTTGGTAAACAAGGTTATCAA TTGAGACAAGGTGACAACTTTGAAGTGTGGGAAAGACCATTGTCTGGACTTGCGTGGGC TGTTGCTATGATCAACCGTCAAGAGATCGGAGGGCCAAGATCTTACACTATCGCGGTAGC CTCTTTGGGTAAGGGTGTTGCGTGCAATCCTGCCTGCTTCATTACACAATTGCTTCCAGTT AAGAGAAAGTTGGGTTTCTATGAGTGGACATCTAGGCTAAGAAGTCACATCAATCCTACT GGTACGGTATTGTTGCAATTGGAGAACACAATGCAAATGTCTTTGAAAGATTTGTTA Polynucleotide sequence of mature human GLA (native hCDS): (SEQ ID NO: 4) CTGGACAATGGATTGGCAAGGACGCCTACCATGGGCTGGCTGCACTGGGAGCGCTTCAT GTGCAACCTTGACTGCCAGGAAGAGCCAGATTCCTGCATCAGTGAGAAGCTCTTCATGG AGATGGCAGAGCTCATGGTCTCAGAAGGCTGGAAGGATGCAGGTTATGAGTACCTCTGC ATTGATGACTGTTGGATGGCTCCCCAAAGAGATTCAGAAGGCAGACTTCAGGCAGACCC TCAGCGCTTTCCTCATGGGATTCGCCAGCTAGCTAATTATGTTCACAGCAAAGGACTGAA GCTAGGGATTTATGCAGATGTTGGAAATAAAACCTGCGCAGGCTTCCCTGGGAGTTTTGG ATACTACGACATTGATGCCCAGACCTTTGCTGACTGGGGAGTAGATCTGCTAAAATTTGA TGGTTGTTACTGTGACAGTTTGGAAAATTTGGCAGATGGTTATAAGCACATGTCCTTGGC CCTGAATAGGACTGGCAGAAGCATTGTGTACTCCTGTGAGTGGCCTCTTTATATGTGGCC CTTTCAAAAGCCCAATTATACAGAAATCCGACAGTACTGCAATCACTGGCGAAATTTTGC TGACATTGATGATTCCTGGAAAAGTATAAAGAGTATCTTGGACTGGACATCTTTTAACCA GGAGAGAATTGTTGATGTTGCTGGACCAGGGGGTTGGAATGACCCAGATATGTTAGTGA TTGGCAACTTTGGCCTCAGCTGGAATCAGCAAGTAACTCAGATGGCCCTCTGGGCTATCA TGGCTGCTCCTTTATTCATGTCTAATGACCTCCGACACATCAGCCCTCAAGCCAAAGCTCT CCTTCAGGATAAGGACGTAATTGCCATCAATCAGGACCCCTTGGGCAAGCAAGGGTACC AGCTTAGACAGGGAGACAACTTTGAAGTGTGGGAACGACCTCTCTCAGGCTTAGCCTGG GCTGTAGCTATGATAAACCGGCAGGAGATTGGTGGACCTCGCTCTTATACCATCGCAGTT GCTTCCCTGGGTAAAGGAGTGGCCTGTAATCCTGCCTGCTTCATCACACAGCTCCTCCCT GTGAAAAGGAAGCTAGGGTTCTATGAATGGACTTCAAGGTTAAGAAGTCACATAAATCC CACAGGCACTGTTTTGCTTCAGCTAGAAAATACAATGCAGATGTCATTAAAAGACTTACT T Polypeptide sequence of mature Human GLA (SEQ ID NO.5): (SEQ ID NO: 5) LDNGLARTPTMGWLHWERFMCNLDCQEEPDSCISEKLFMEMAELMVSEGWKDAGYEYLCI DDCWMAPQRDSEGRLQADPQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYY DIDAQTFADWGVDLLKFDGCYCDSLENLADGYKHMSLALNRTGRSIVYSCEWPLYMWPFQ KPNYTEIRQYCNHWRNFADIDDSWKSIKSILDWTSFNQERIVDVAGPGGWNDPDMLVIGNFG LSWNQQVTQMALWAIMAAPLFMSNDLRHISPQAKALLQDKDVIAINQDPLGKQGYQLRQG DNFEVWERPLSGLAWAVAMINRQEIGGPRSYTIAVASLGKGVACNPACFITQLLPVKRKLGF YEWTSRLRSHINPTGTVLLQLENTMQMSLKDLL Polynucleotide sequence of pCK110900i E. coli expression vector: (SEQ ID NO: 6) TCGAGTTAATTAAGGCAGTGAGCGCAACGCAATTAATGTGAGTTAGCTCACTCATTAGGC ACCCCAGGCTTTACACTTTATGCTTCCGGCTCGTATGTTGTGTGGAATTGTGAGCGGATA ACAATTTCACACAGGAAACGGCTATGACCATGATTACGGATTCACTGGCCGTCGTTTTAC AATCTAGAGGCCAGCCTGGCCATAAGGAGATATACATATGAGTATTCAACATTTCCGTGT CGCCCTTATTCCCTTTTCTGCGGCATTTTGCCTTCCTGTTTTTGCTCACCCAGAAACGCTG GTGAAAGTAAAAGATGCTGAAGATCAGTTGGGTGCACGAGTGGGTTACATCGAACTGGA TCTCAACAGCGGTAAGATCCTTGAGAGTTTTCGCCCCGAAGAGCGTTTTCCAATGATGAG CACTTTTAAAGTTCTGCTATGTGGCGCGGTATTATCCCGTGTTGACGCCGGGCAAGAGCA ACTCGGTCGCCGCATACACTATTCTCAGAATGACTTGGTTGAGTACTCACCAGTCACAGA AAAGCATCTTACGGATGGCATGACAGTAAGAGAATTATGCAGTGCTGCCATAACCATGA GTGATAACACTGCGGCCAACTTACTTCTGACAACGATCGGAGGACCGAAGGAGCTAACC GTTTTTTTGCACACCATGGGGGATCATGTAACTCGCCTTGATCGTTGGGAACCGGAGCTG AATGAAGCCATACCAAACGACGAGCGTGACACCACGATGCCTACAGCAATGGCAACAAC GTTGCGCAAACTATTAACTGGCGAACTACTTACTCTAGCTTCCCGGCAACAATTAATAGA CTGGATGGAGGCGGATAAAGTTGCAGGACCACTTCTGCGCTCGGCCCTTCCGGCTGGCTG GTTTATTGCTGATAAATCTGGAGCCGGTGAGCGTGGGTCTCGCGGTATCATTGCAGCACT GGGGCCAGATGGTAAGCCCTCCCGTATCGTAGTTATCTACACGACGGGGAGTCAGGCAA CTATGGATGAACGTAATAGACAGATCGCTGAGATAGGTGCCTCACTGATTAAGCATTGG GGCCAAACTGGCCACCATCACCATCACCATTAGGGAAGAGCAGATGGGCAAGCTTGACC TGTGAAGTGAAAAATGGCGCACATTGTGCGACATTTTTTTTTGAATTCTACGTAAAAAGC CGCCGATACATCGGCTGCTTTTTTTTTGATAGAGGTTCAAACTTGTGGTATAATGAAATA AGATCACTCCGGGGCGTATTTTTTGAGTTATCGAGATTTTCAGGAGCTAAGGAAGCTAAA ATGGAGAAAAAAATCACTGGATATACCACCGTTGATATATCCCAATGGCATCGTAAAGA ACATTTTGAGGCATTTCAGTCAGTTGCTCAATGTACCTATAACCAGACCGTTCAGCTGGA TATTACGGCCTTTTTAAAGACCGTAAAGAAAAATAAGCACAAGTTTTATCCGGCCTTTAT TCACATTCTTGCCCGCCTGATGAATGCTCATCCGGAGTTCCGTATGGCAATGAAAGACGG TGAGCTGGTGATATGGGATAGTGTTCACCCTTGTTACACCGTTTTCCATGAGCAAACTGA AACGTTTTCATCGCTCTGGAGTGAATACCACGACGATTTCCGGCAGTTTCTACACATATA TTCGCAAGATGTGGCGTGTTACGGTGAAAACCTGGCCTATTTCCCTAAAGGGTTTATTGA GAATATGTTTTTCGTCTCAGCCAATCCCTGGGTGAGTTTCACCAGTTTTGATTTAAACGTG GCCAATATGGACAACTTCTTCGCCCCCGTTTTCACCATGGGCAAATATTATACGCAAGGC GACAAGGTGCTGATGCCGCTGGCGATTCAGGTTCATCATGCCGTCTGTGATGGCTTCCAT GTCGGCAGAATGCTTAATGAATTACAACAGTACTGCGATGAGTGGCAGGGCGGGGCGTA ACTGCAGGAGCTCAAACAGCAGCCTGTATTCAGGCTGCTTTTTTCGTTTTGGTCTGCGCGT AATCTCTTGCTCTGAAAACGAAAAAACCGCCTTGCAGGGCGGTTTTTCGAAGGTTCTCTG AGCTACCAACTCTTTGAACCGAGGTAACTGGCTTGGAGGAGCGCAGTCACCAAAACTTG TCCTTTCAGTTTAGCCTTAACCGGCGCATGACTTCAAGACTAACTCCTCTAAATCAATTAC CAGTGGCTGCTGCCAGTGGTGCTTTTGCATGTCTTTCCGGGTTGGACTCAAGACGATAGT TACCGGATAAGGCGCAGCGGTCGGACTGAACGGGGGGTTCGTGCATACAGTCCAGCTTG GAGCGAACTGCCTACCCGGAACTGAGTGTCAGGCGTGGAATGAGACAAACGCGGCCATA ACAGCGGAATGACACCGGTAAACCGAAAGGCAGGAACAGGAGAGCGCACGAGGGAGCC GCCAGGGGGAAACGCCTGGTATCTTTATAGTCCTGTCGGGTTTCGCCACCACTGATTTGA GCGTCAGATTTCGTGATGCTTGTCAGGGGGGCGGAGCCTATGGAAAAACGGCTTTGCCG CGGCCCTCTCACTTCCCTGTTAAGTATCTTCCTGGCATCTTCCAGGAAATCTCCGCCCCGT TCGTAAGCCATTTCCGCTCGCCGCAGTCGAACGACCGAGCGTAGCGAGTCAGTGAGCGA GGAAGCGGAATATATCCTGTATCACATATTCTGCTGACGCACCGGTGCAGCCTTTTTTCT CCTGCCACATGAAGCACTTCACTGACACCCTCATCAGTGAACCACCGCTGGTAGCGGTGG TTTTTTTAGGCCTATGGCCTTTTTTTTTTGTGGGAAACCTTTCGCGGTATGGTATTAAAGC GCCCGGAAGAGAGTCAATTCAGGGTGGTGAATGTGAAACCAGTAACGTTATACGATGTC GCAGAGTATGCCGGTGTCTCTTATCAGACCGTTTCCCGCGTGGTGAACCAGGCCAGCCAC GTTTCTGCGAAAACGCGGGAAAAAGTGGAAGCGGCGATGGCGGAGCTGAATTACATTCC CAACCGCGTGGCACAACAACTGGCGGGCAAACAGTCGTTGCTGATTGGCGTTGCCACCT CCAGTCTGGCCCTGCACGCGCCGTCGCAAATTGTCGCGGCGATTAAATCTCGCGCCGATC AACTGGGTGCCAGCGTGGTGGTGTCGATGGTAGAACGAAGCGGCGTCGAAGCCTGTAAA GCGGCGGTGCACAATCTTCTCGCGCAACGCGTCAGTGGGCTGATCATTAACTATCCGCTG GATGACCAGGATGCCATTGCTGTGGAAGCTGCCTGCACTAATGTTCCGGCGTTATTTCTT GATGTCTCTGACCAGACACCCATCAACAGTATTATTTTCTCCCATGAAGACGGTACGCGA CTGGGCGTGGAGCATCTGGTCGCATTGGGTCACCAGCAAATCGCGCTGTTAGCGGGCCC ATTAAGTTCTGTCTCGGCGCGTCTGCGTCTGGCTGGCTGGCATAAATATCTCACTCGCAA TCAAATTCAGCCGATAGCGGAACGGGAAGGCGACTGGAGTGCCATGTCCGGTTTTCAAC AAACCATGCAAATGCTGAATGAGGGCATCGTTTCCACTGCGATGCTGGTTGCCAACGATC AGATGGCGCTGGGCGCAATGCGCGCCATTACCGAGTCCGGGCTGCGCGTTGGTGCGGAC ATCTCGGTAGTGGGATACGACGATACCGAAGACAGCTCATGTTATATCCCGCCGTTAACC ACCATCAAACAGGATTTTCGCCTGCTGGGGCAAACCAGCGTGGACCGCTTGCTGCAACTC TCTCAGGGCCAGGCGGTTAAGGGCAATCAGCTGTTGCCCGTCTCACTGGTGAAAAGAAA AACCACCCTGGCGCCCAATACGCAAACCGCCTCTCCCCGCGCGTTGGCCGATTCATTAAT GCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGGTACCCGATAAAA GCGGCTTCCTGACAGGAGGCCGTTTTGTTTC Polynucleotide sequence of pYT-72Bg1 secreted yeast expression vector: (SEQ ID NO: 7) TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTGTACAAATATCATA AAAAAAGAGAATCTTTTTAAGCAAGGATTTTCTTAACTTCTTCGGCGACAGCATCACCGA CTTCGGTGGTACTGTTGGAACCACCTAAATCACCAGTTCTGATACCTGCATCCAAAACCT TTTTAACTGCATCTTCAATGGCTTTACCTTCTTCAGGCAAGTTCAATGACAATTTCAACAT CATTGCAGCAGACAAGATAGTGGCGATAGGGTTGACCTTATTCTTTGGCAAATCTGGAGC GGAACCATGGCATGGTTCGTACAAACCAAATGCGGTGTTCTTGTCTGGCAAAGAGGCCA AGGACGCAGATGGCAACAAACCCAAGGAGCCTGGGATAACGGAGGCTTCATCGGAGAT GATATCACCAAACATGTTGCTGGTGATTATAATACCATTTAGGTGGGTTGGGTTCTTAAC TAGGATCATGGCGGCAGAATCAATCAATTGATGTTGAACTTTCAATGTAGGGAATTCGTT CTTGATGGTTTCCTCCACAGTTTTTCTCCATAATCTTGAAGAGGCCAAAACATTAGCTTTA TCCAAGGACCAAATAGGCAATGGTGGCTCATGTTGTAGGGCCATGAAAGCGGCCATTCT TGTGATTCTTTGCACTTCTGGAACGGTGTATTGTTCACTATCCCAAGCGACACCATCACCA TCGTCTTCCTTTCTCTTACCAAAGTAAATACCTCCCACTAATTCTCTAACAACAACGAAGT CAGTACCTTTAGCAAATTGTGGCTTGATTGGAGATAAGTCTAAAAGAGAGTCGGATGCA AAGTTACATGGTCTTAAGTTGGCGTACAATTGAAGTTCTTTACGGATTTTTAGTAAACCTT GTTCAGGTCTAACACTACCGGTACCCCATTTAGGACCACCCACAGCACCTAACAAAACG GCATCAGCCTTTTTGGAGGCTTCCAGCGCCTCATTTGGAAGTGGAACACCTGTAGCATCG ATAGCAGCCCCCCCAATTAAATGATTTTCGAAATCGAACTTGACATTGGAACGAACATCA GAAATAGCTTTAAGAACCTTAATGGCTTCGGCTGTGATTTCTTGACCAACGTGGTCACCT GGCAAAACGACGATTTTTTTAGGGGCAGACATTACAATGGTATATCCTTGAAATATATAT AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAATGCAGCTTCTCAATGATATTCGAATAC GCTTTGAGGAGATACAGCCTAATATCCGACAAACTGTTTTACAGATTTACGATCGTACTT GTTACCCATCATTGAATTTTGAACATCCGAACCTGGGAGTTTTCCCTGAAACAGATAGTA TATTTGAACCTGTATAATAATATATAGTCTAGCGCTTTACGGAAGACAATGTATGTATTT CGGTTCCTGGAGAAACTATTGCATCTATTGCATAGGTAATCTTGCACGTCGCATCCCCGG TTCATTTTCTGCGTTTCCATCTTGCACTTCAATAGCATATCTTTGTTAACGAAGCATCTGT GCTTCATTTTGTAGAACAAAAATGCAACGCGAGAGCGCTAATTTTTCAAACAAAGAATCT GAGCTGCATTTTTACAGAACAGAAATGCAACGCGAAAGCGCTATTTTACCAACGAAGAA TCTGTGCTTCATTTTTGTAAAACAAAAATGCAACGCGAGAGCGCTAATTTTTCAAACAAA GAATCTGAGCTGCATTTTTACAGAACAGAAATGCAACGCGAGAGCGCTATTTTACCAAC AAAGAATCTATACTTCTTTTTTGTTCTACAAAAATGCATCCCGAGAGCGCTATTTTTCTAA CAAAGCATCTTAGATTACTTTTTTTCTCCTTTGTGCGCTCTATAATGCAGTCTCTTGATAA CTTTTTGCACTGTAGGTCCGTTAAGGTTAGAAGAAGGCTACTTTGGTGTCTATTTTCTCTT CCATAAAAAAAGCCTGACTCCACTTCCCGCGTTTACTGATTACTAGCGAAGCTGCGGGTG CATTTTTTCAAGATAAAGGCATCCCCGATTATATTCTATACCGATGTGGATTGCGCATACT TTGTGAACAGAAAGTGATAGCGTTGATGATTCTTCATTGGTCAGAAAATTATGAACGGTT TCTTCTATTTTGTCTCTATATACTACGTATAGGAAATGTTTACATTTTCGTATTGTTTTCGA TTCACTCTATGAATAGTTCTTACTACAATTTTTTTGTCTAAAGAGTAATACTAGAGATAAA CATAAAAAATGTAGAGGTCGAGTTTAGATGCAAGTTCAAGGAGCGAAAGGTGGATGGGT AGGTTATATAGGGATATAGCACAGAGATATATAGCAAAGAGATACTTTTGAGCAATGTT TGTGGAAGCGGTATTCGCAATATTTTAGTAGCTCGTTACAGTCCGGTGCGTTTTTGGTTTT TTGAAAGTGCGTCTTCAGAGCGCTTTTGGTTTTCAAAAGCGCTCTGAAGTTCCTATACTTT CTAGAGAATAGGAACTTCGGAATAGGAACTTCAAAGCGTTTCCGAAAACGAGCGCTTCC GAAAATGCAACGCGAGCTGCGCACATACAGCTCACTGTTCACGTCGCACCTATATCTGCG TGTTGCCTGTATATATATATACATGAGAAGAACGGCATAGTGCGTGTTTATGCTTAAATG CGTACTTATATGCGTCTATTTATGTAGGATGAAAGGTAGTCTAGTACCTCCTGTGATATTA TCCCATTCCATGCGGGGTATCGTATGCTTCCTTCAGCACTACCCTTTAGCTGTTCTATATG CTGCCACTCCTCAATTGGATTAGTCTCATCCTTCAATGCTATCATTTCCTTTGATATTGGA TCATATGCATAGTACCGAGAAACTAGTGCGAAGTAGTGATCAGGTATTGCTGTTATCTGA TGAGTATACGTTGTCCTGGCCACGGCAGAAGCACGCTTATCGCTCCAATTTCCCACAACA TTAGTCAACTCCGTTAGGCCCTTCATTGAAAGAAATGAGGTCATCAAATGTCTTCCAATG TGAGATTTTGGGCCATTTTTTATAGCAAAGATTGAATAAGGCGCATTTTTCTTCAAAGCTT TATTGTACGATCTGACTAAGTTATCTTTTAATAATTGGTATTCCTGTTTATTGCTTGAAGA ATTGCCGGTCCTATTTACTCGTTTTAGGACTGGTTCAGAATTCCTCAAAAATTCATCCAAA TATACAAGTGGATCGATGATAAGCTGTCAAACATGAGAATTCTTGAAGACGAAAGGGCC TCGTGATACGCCTATTTTTATAGGTTAATGTCATGATAATAATGGTTTCTTAGACGTCAGG TGGCACTTTTCGGGGAAATGTGCGCGGAACCCCTATTTGTTTATTTTTCTAAATACATTCA AATATGTATCCGCTCATGAGACAATAACCCTGATAAATGCTTCAATAATATTGAAAAAGG AAGAGTATGAGTATTCAACATTTCCGTGTCGCCCTTATTCCCTTTTTTGCGGCATTTTGCC TTCCTGTTTTTGCTCACCCAGAAACGCTGGTGAAAGTAAAAGATGCTGAAGATCAGTTGG GTGCACGAGTGGGTTACATCGAACTGGATCTCAACAGCGGTAAGATCCTTGAGAGTTTTC GCCCCGAAGAACGTTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGCGCGGTAT TATCCCGTGTTGACGCCGGGCAAGAGCAACTCGGTCGCCGCATACACTATTCTCAGAATG ACTTGGTTGAGTACTCACCAGTCACAGAAAAGCATCTTACGGATGGCATGACAGTAAGA GAATTATGCAGTGCTGCCATAACCATGAGTGATAACACTGCGGCCAACTTACTTCTGACA ACGATCGGAGGACCGAAGGAGCTAACCGCTTTTTTGCACAACATGGGGGATCATGTAAC TCGCCTTGATCGTTGGGAACCGGAGCTGAATGAAGCCATACCAAACGACGAGCGTGACA CCACGATGCCTGCAGCAATGGCAACAACGTTGCGCAAACTATTAACTGGCGAACTACTT ACTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAGGCGGATAAAGTTGCAGGACC ACTTCTGCGCTCGGCCCTTCCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCGGTGA GCGTGGGTCTCGCGGTATCATTGCAGCACTGGGGCCAGATGGTAAGCCCTCCCGTATCGT AGTTATCTACACGACGGGGAGTCAGGCAACTATGGATGAACGAAATAGACAGATCGCTG AGATAGGTGCCTCACTGATTAAGCATTGGTAACTGTCAGACCAAGTTTACTCATATATAC TTTAGATTGATTTAAAACTTCATTTTTAATTTAAAAGGATCTAGGTGAAGATCCTTTTTGA TAATCTCATGACCAAAATCCCTTAACGTGAGTTTTCGTTCCACTGAGCGTCAGACCCCGT AGAAAAGATCAAAGGATCTTCTTGAGATCCTTTTTTTCTGCGCGTAATCTGCTGCTTGCA AACAAAAAAACCACCGCTACCAGCGGTGGTTTGTTTGCCGGATCAAGAGCTACCAACTC TTTTTCCGAAGGTAACTGGCTTCAGCAGAGCGCAGATACCAAATACTGTCCTTCTAGTGT AGCCGTAGTTAGGCCACCACTTCAAGAACTCTGTAGCACCGCCTACATACCTCGCTCTGC TAATCCTGTTACCAGTGGCTGCTGCCAGTGGCGATAAGTCGTGTCTTACCGGGTTGGACT CAAGACGATAGTTACCGGATAAGGCGCAGCGGTCGGGCTGAACGGGGGGTTCGTGCACA CAGCCCAGCTTGGAGCGAACGACCTACACCGAACTGAGATACCTACAGCGTGAGCTATG AGAAAGCGCCACGCTTCCCGAAGGGAGAAAGGCGGACAGGTATCCGGTAAGCGGCAGG GTCGGAACAGGAGAGCGCACGAGGGAGCTTCCAGGGGGAAACGCCTGGTATCTTTATAG TCCTGTCGGGTTTCGCCACCTCTGACTTGAGCGTCGATTTTTGTGATGCTCGTCAGGGGGG CGGAGCCTATGGAAAAACGCCAGCAACGCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGG CCTTTTGCTCACATGTTCTTTCCTGCGTTATCCCCTGATTCTGTGGATAACCGTATTACCG CCTTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCGAGTCAGTG AGCGAGGAAGCGGAAGAGCGCCTGATGCGGTATTTTCTCCTTACGCATCTGTGCGGTATT TCACACCGCATATGGTGCACTCTCAGTACAATCTGCTCTGATGCCGCATAGTTAAGCCAG TATACACTCCGCTATCGCTACGTGACTGGGTCATGGCTGCGCCCCGACACCCGCCAACAC CCGCTGACGCGCCCTGACGGGCTTGTCTGCTCCCGGCATCCGCTTACAGACAAGCTGTGA CCGTCTCCGGGAGCTGCATGTGTCAGAGGTTTTCACCGTCATCACCGAAACGCGCGAGGC AGCTGCGGTAAAGCTCATCAGCGTGGTCGTGAAGCGATTCACAGATGTCTGCCTGTTCAT CCGCGTCCAGCTCGTTGAGTTTCTCCAGAAGCGTTAATGTCTGGCTTCTGATAAAGCGGG CCATGTTAAGGGCGGTTTTTTCCTGTTTGGTCACTGATGCCTCCGTGTAAGGGGGATTTCT GTTCATGGGGGTAATGATACCGATGAAACGAGAGAGGATGCTCACGATACGGGTTACTG ATGATGAACATGCCCGGTTACTGGAACGTTGTGAGGGTAAACAACTGGCGGTATGGATG CGGCGGGACCAGAGAAAAATCACTCAGGGTCAATGCCAGCGCTTCGTTAATACAGATGT AGGTGTTCCACAGGGTAGCCAGCAGCATCCTGCGATGCAGATCCGGAACATAATGGTGC AGGGCGCTGACTTCCGCGTTTCCAGACTTTACGAAACACGGAAACCGAAGACCATTCAT GTTGTTGCTCAGGTCGCAGACGTTTTGCAGCAGCAGTCGCTTCACGTTCGCTCGCGTATC GGTGATTCATTCTGCTAACCAGTAAGGCAACCCCGCCAGCCTAGCCGGGTCCTCAACGAC AGGAGCACGATCATGCGCACCCGTGGCCAGGACCCAACGCTGCCCGAGATGCGCCGCGT GCGGCTGCTGGAGATGGCGGACGCGATGGATATGTTCTGCCAAGGGTTGGTTTGCGCATT CACAGTTCTCCGCAAGAATTGATTGGCTCCAATTCTTGGAGTGGTGAATCCGTTAGCGAG GTGCCGCCGGCTTCCATTCAGGTCGAGGTGGCCCGGCTCCATGCACCGCGACGCAACGC GGGGAGGCAGACAAGGTATAGGGCGGCGCCTACAATCCATGCCAACCCGTTCCATGTGC TCGCCGAGGCGGCATAAATCGCCGTGACGATCAGCGGTCCAATGATCGAAGTTAGGCTG GTAAGAGCCGCGAGCGATCCTTGAAGCTGTCCCTGATGGTCGTCATCTACCTGCCTGGAC AGCATGGCCTGCAACGCGGGCATCCCGATGCCGCCGGAAGCGAGAAGAATCATAATGGG GAAGGCCATCCAGCCTCGCGTCGCGAACGCCAGCAAGACGTAGCCCAGCGCGTCGGCCG CCATGCCGGCGATAATGGCCTGCTTCTCGCCGAAACGTTTGGTGGCGGGACCAGTGACG AAGGCTTGAGCGAGGGCGTGCAAGATTCCGAATACCGCAAGCGACAGGCCGATCATCGT CGCGCTCCAGCGAAAGCGGTCCTCGCCGAAAATGACCCAGAGCGCTGCCGGCACCTGTC CTACGAGTTGCATGATAAAGAAGACAGTCATAAGTGCGGCGACGATAGTCATGCCCCGC GCCCACCGGAAGGAGCTGACTGGGTTGAAGGCTCTCAAGGGCATCGGTCGAGGATCTGG GCAAAACGTAGGGGCAAACAAACGGAAAAATCGTTTCTCAAATTTTCTGATGCCAAGAA CTCTAACCAGTCTTATCTAAAAATTGCCTTATGATCCGTCTCTCCGGTTACAGCCTGTGTA ACTGATTAATCCTGCCTTTCTAATCACCATTCTAATGTTTTAATTAAGGGATTTTGTCTTC ATTAACGGCTTTCGCTCATAAAAATGTTATGACGTTTTGCCCGCAGGCGGGAAACCATCC ACTTCACGAGACTGATCTCCTCTGCCGGAACACCGGGCATCTCCAACTTATAAGTTGGAG AAATAAGAGAATTTCAGATTGAGAGAATGAAAAAAAAAAAAAAAAAAAGGCAGAGGAG AGCATAGAAATGGGGTTCACTTTTTGGTAAAGCTATAGCATGCCTATCACATATAAATAG AGTGCCAGTAGCGACTTTTTTCACACTCGAAATACTCTTACTACTGCTCTCTTGTTGTTTT TATCACTTCTTGTTTCTTCTTGGTAAATAGAATATCAAGCTACAAAAAGCATACAATCAA CTATCAACTATTAACTATATCGTAATACACAGGATCCACCATGAAGGCTGCTGCGCTTTC CTGCCTCTTCGGCAGTACCCTTGCCGTTGCAGGCGCCATTGAATCGAGAAAGGTTCACCA GAAGCCCCTCGCGAGATCTGAACCTTTTTACCCGTCGCCATGGATGAATCCCAACGCCAT CGGCTGGGCGGAGGCCTATGCCCAGGCCAAGTCCTTTGTCTCCCAAATGACTCTGCTAGA GAAGGTCAACTTGACCACGGGAGTCGGCTGGGGGGAGGAGCAGTGCGTCGGCAACGTG GGCGCGATCCCTCGCCTTGGACTTCGCAGTCTGTGCATGCATGACTCCCCTCTCGGCGTG CGAGGAACCGACTACAACTCAGCGTTCCCCTCTGGCCAGACCGTTGCTGCTACCTGGGAT CGCGGTCTGATGTACCGTCGCGGCTACGCAATGGGCCAGGAGGCCAAAGGCAAGGGCAT CAATGTCCTTCTCGGACCAGTCGCCGGCCCCCTTGGCCGCATGCCCGAGGGCGGTCGTAA CTGGGAAGGCTTCGCTCCGGATCCCGTCCTTACCGGCATCGGCATGTCCGAGACGATCAA GGGCATTCAGGATGCTGGCGTCATCGCTTGTGCGAAGCACTTTATTGGAAACGAGCAGG AGCACTTCAGACAGGTGCCAGAAGCCCAGGGATACGGTTACAACATCAGCGAAACCCTC TCCTCCAACATTGACGACAAGACCATGCACGAGCTCTACCTTTGGCCGTTTGCCGATGCC GTCCGGGCCGGCGTCGGCTCTGTCATGTGCTCGTACAACCAGGGCAACAACTCGTACGCC TGCCAGAACTCGAAGCTGCTGAACGACCTCCTCAAGAACGAGCTTGGGTTTCAGGGCTTC GTCATGAGCGACTGGTGGGCACAGCACACTGGCGCAGCAAGCGCCGTGGCTGGTCTCGA TATGTCCATGCCGGGCGACACCATGGTCAACACTGGCGTCAGTTTCTGGGGCGCCAATCT CACCCTCGCCGTCCTCAACGGCACAGTCCCTGCCTACCGTCTCGACGACATGTGCATGCG CATCATGGCCGCCCTCTTCAAGGTCACCAAGACCACCGACCTGGAACCGATCAACTTCTC CTTCTGGACCCGCGACACTTATGGCCCGATCCACTGGGCCGCCAAGCAGGGCTACCAGG AGATTAATTCCCACGTTGACGTCCGCGCCGACCACGGCAACCTCATCCGGAACATTGCCG CCAAGGGTACGGTGCTGCTGAAGAATACCGGCTCTCTACCCCTGAACAAGCCAAAGTTC GTGGCCGTCATCGGCGAGGATGCTGGGCCGAGCCCCAACGGGCCCAACGGCTGCAGCGA CCGCGGCTGTAACGAAGGCACGCTCGCCATGGGCTGGGGATCCGGCACAGCCAACTATC CGTACCTCGTTTCCCCCGACGCCGCGCTCCAGGCGCGGGCCATCCAGGACGGCACGAGG TACGAGAGCGTCCTGTCCAACTACGCCGAGGAAAATACAAAGGCTCTGGTCTCGCAGGC CAATGCAACCGCCATCGTCTTCGTCAATGCCGACTCAGGCGAGGGCTACATCAACGTGG ACGGTAACGAGGGCGACCGTAAGAACCTGACTCTCTGGAACAACGGTGATACTCTGGTC AAGAACGTCTCGAGCTGGTGCAGCAACACCATCGTCGTCATCCACTCGGTCGGCCCGGTC CTCCTGACCGATTGGTACGACAACCCCAACATCACGGCCATTCTCTGGGCTGGTCTTCCG GGCCAGGAGTCGGGCAACTCCATCACCGACGTGCTTTACGGCAAGGTCAACCCCGCCGC CCGCTCGCCCTTCACTTGGGGCAAGACCCGCGAAAGCTATGGCGCGGACGTCCTGTACA AGCCGAATAATGGCAATTGGGCGCCCCAACAGGACTTCACCGAGGGCGTCTTCATCGAC TACCGCTACTTCGACAAGGTTGACGATGACTCGGTCATCTACGAGTTCGGCCACGGCCTG AGCTACACCACCTTCGAGTACAGCAACATCCGCGTCGTCAAGTCCAACGTCAGCGAGTA CCGGCCCACGACGGGCACCACGATTCAGGCCCCGACGTTTGGCAACTTCTCCACCGACCT CGAGGACTATCTCTTCCCCAAGGACGAGTTCCCCTACATCCCGCAGTACATCTACCCGTA CCTCAACACGACCGACCCCCGGAGGGCCTCGGGCGATCCCCACTACGGCCAGACCGCCG AGGAGTTCCTCCCGCCCCACGCCACCGATGACGACCCCCAGCCGCTCCTCCGGTCCTCGG GCGGAAACTCCCCCGGCGGCAACCGCCAGCTGTACGACATTGTCTACACAATCACGGCC GACATCACGAATACGGGCTCCGTTGTAGGCGAGGAGGTACCGCAGCTCTACGTCTCGCT GGGCGGTCCCGAGGATCCCAAGGTGCAGCTGCGCGACTTTGACAGGATGCGGATCGAAC CCGGCGAGACGAGGCAGTTCACCGGCCGCCTGACGCGCAGAGATCTGAGCAACTGGGAC GTCACGGTGCAGGACTGGGTCATCAGCAGGTATCCCAAGACGGCATATGTTGGGAGGAG CAGCCGGAAGTTGGATCTCAAGATTGAGCTTCCTTGATAAGTCGACCTCGACTTTGTTCC CACTGTACTTTTAGCTCGTACAAAATACAATATACTTTTCATTTCTCCGTAAACAACATGT TTTCCCATGTAATATCCTTTTCTATTTTTCGTTCCGTTACCAACTTTACACATACTTTATAT AGCTATTCACTTCTATACACTAAAAAACTAAGACAATTTTAATTTTGCTGCCTGCCATATT TCAATTTGTTATAAATTCCTATAATTTATCCTATTAGTAGCTAAAAAAAGATGAATGTGA ATCGAATCCTAAGAGAATTGGATCTGATCCACAGGACGGGTGTGGTCGCCATGATCGCG TAGTCGATAGTGGCTCCAAGTAGCGAAGCGAGCAGGACTGGGCGGCGGCCAAAGCGGTC GGACAGTGCTCCGAGAACGGGTGCGCATAGAAATTGCATCAACGCATATAGCGCTAGCA GCACGCCATAGTGACTGGCGATGCTGTCGGAATGGACGATATCCCGCAAGAGGCCCGGC AGTACCGGCATAACCAAGCCTATGCCTACAGCATCCAGGGTGACGGTGCCGAGGATGAC GATGAGCGCATTGTTAGATTTCATACACGGTGCCTGACTGCGTTAGCAATTTAACTGTGA TAAACTACCGCATTAAAGCTTTTTCTTTCCAATTTTTTTTTTTTCGTCATTATAAAAATCAT TACGACCGAGATTCCCGGGTAATAACTGATATAATTAAATTGAAGCTCTAATTTGTGAGT TTAGTATACATGCATTTACTTATAATACAGTTTTTTAGTTTTGCTGGCCGCATCTTCTCAA ATATGCTTCCCAGCCTGCTTTTCTGTAACGTTCACCCTCTACCTTAGCATCCCTTCCCTTTG CAAATAGTCCTCTTCCAACAATAATAATGTCAGATCCTGTAGAGACCACATCATCCACGG TTCTATACTGTTGACCCAATGCGTCTCCCTTGTCATCTAAACCCACACCGGGTGTCATAAT CAACCAATCGTAACCTTCATCTCTTCCACCCATGTCTCTTTGAGCAATAAAGCCGATAAC AAAATCTTTGTCGCTCTTCGCAATGTCAACAGTACCCTTAGTATATTCTCCAGTAGATAG GGAGCCCTTGCATGACAATTCTGCTAACATCAAAAGGCCTCTAGGTTCCTTTGTTACTTCT TCTGCCGCCTGCTTCAAACCGCTAACAATACCTGGGCCCACCACACCGTGTGCATTCGTA ATGTCTGCCCATTCTGCTATTCTGTATACACCCGCAGAGTACTGCAATTTGACTGTATTAC CAATGTCAGCAAATTTTCTGTCTTCGAAGAGTAAAAAATTGTACTTGGCGGATAATGCCT TTAGCGGCTTAACTGTGCCCTCCATGGAAAAATCAGTCAAGATATCCACATGTGTTTTTA GTAAACAAATTTTGGGACCTAATGCTTCAACTAACTCCAGTAATTCCTTGGTGGTACGAA CATCCAATGAAGCACACAAGTTTGTTTGCTTTTCGTGCATGATATTAAATAGCTTGGCAG CAACAGGACTAGGATGAGTAGCAGCACGTTCCTTATATGTAGCTTTCGACATGATTTATC TTCGTTTCCTGCAGGTTTTTGTTCTGTGCAGTTGGGTTAAGAATACTGGGCAATTTCATGT TTCTTCAACACTACATATGCGTATATATACCAATCTAAGTCTGTGCTCCTTCCTTCGTTCT TCCTTCTGTTCGGAGATTACCGAATCAAAAAAATTTCAAGGAAACCGAAATCAAAAAAA AGAATAAAAAAAAAATGATGAATTGAAAAGCTTATCGATCCTACCCCTTGCGCTAAAGA AGTATATGTGCCTACTAACGCTTGTCTTTGTCTCTGTCACTAAACACTGGATTATTACTCC CAGATACTTATTTTGGACTAATTTAAATGATTTCGGATCAACGTTCTTAATATCGCTGAAT CTTCCACAATTGATGAAAGTAGCTAGGAAGAGGAATTGGTATAAAGTTTTTGTTTTTGTA AATCTCGAAGTATACTCAAACGAATTTAGTATTTTCTCAGTGATCTCCCAGATGCTTTCAC CCTCACTTAGAAGTGCTTTAAGCATTTTTTTACTGTGGCTATTTCCCTTATCTGCTTCTTCC GATGATTCGAACTGTAATTGCAAACTACTTACAATATCAGTGATATCAGATTGATGTTTT TGTCCATAGTAAGGAATAATTGTAAATTCCCAAGCAGGAATCAATTTCTTTAATGAGGCT TCCAGAATTGTTGCTTTTTGCGTCTTGTATTTAAACTGGAGTGATTTATTGACAATATCGA AACTCAGCGAATTGCTTATGATAGTATTATAGCTCATGAATGTGGCTCTCTTGATTGCTGT TCCGTTATGTGTAATCATCCAACATAAATAGGTTAGTTCAGCAGCACATAATGCTATTTT CTCACCTGAAGGTCTTTCAAACCTTTCCACAAACTGACGAACAAGCACCTTAGGTGGTGT TTTACATAATATATCAAATTGTGGCATGCTTAGCGCCGATCTTGTGTGCAATTGATATCTA GTTTCAACTACTCTATTTATCTTGTATCTTGCAGTATTCAAACACGCTAACTCGAAAAACT AACTTTAATTGTCCTGTTTGTCTCGCGTTCTTTCGAAAAATGCACCGGCCGCGCATTATTT GTACTGCGAAAATAATTGGTACTGCGGTATCTTCATTTCATATTTTAAAAATGCACCTTTG CTGCTTTTCCTTAATTTTTAGACGGCCCGCAGGTTCGTTTTGCGGTACTATCTTGTGATAA AAAGTTGTTTTGACATGTGATCTGCACAGATTTTATAATGTAATAAGCAAGAATACATTA TCAAACGAACAATACTGGTAAAAGAAAACCAAAATGGACGACATTGAAACAGCCAAGA ATCTGACGGTAAAAGCACGTACAGCTTATAGCGTCTGGGATGTATGTCGGCTGTTTATTG AAATGATTGCTCCTGATGTAGATATTGATATAGAGAGTAAACGTAAGTCTGATGAGCTAC TCTTTCCAGGATATGTCATAAGGCCCATGGAATCTCTCACAACCGGTAGGCCGTATGGTC TTGATTCTAGCGCAGAAGATTCCAGCGTATCTTCTGACTCCAGTGCTGAGGTAATTTTGC CTGCTGCGAAGATGGTTAAGGAAAGGTTTGATTCGATTGGAAATGGTATGCTCTCTTCAC AAGAAGCAAGTCAGGCTGCCATAGATTTGATGCTACAGAATAACAAGCTGTTAGACAAT AGAAAGCAACTATACAAATCTATTGCTATAATAATAGGAAGATTGCCCGAGAAAGACAA GAAGAGAGCTACCGAAATGCTCATGAGAAAAATGGATTGTACACAGTTATTAGTCCCAC CAGCTCCAACGGAAGAAGATGTTATGAAGCTCGTAAGCGTCGTTACCCAATTGCTTACTT TAGTTCCACCAGATCGTCAAGCTGCTTTAATAGGTGATTTATTCATCCCGGAATCTCTAA AGGATATATTCAATAGTTTCAATGAACTGGCGGCAGAGAATCGTTTACAGCAAAAAAAG AGTGAGTTGGAAGGAAGGACTGAAGTGAACCATGCTAATACAAATGAAGAAGTTCCCTC CAGGCGAACAAGAAGTAGAGACACAAATGCAAGAGGAGCATATAAATTACAAAACACC ATCACTGAGGGCCCTAAAGCGGTTCCCACGAAAAAAAGGAGAGTAGCAACGAGGGTAA GGGGCAGAAAATCACGTAATACTTCTAGGGTATGATCCAATATCAAAGGAAATGATAGC ATTGAAGGATGAGACTAATCCAATTGAGGAGTGGCAGCATATAGAACAGCTAAAGGGTA GTGCTGAAGGAAGCATACGATACCCCGCATGGAATGGGATAATATCACAGGAGGTACTA GACTACCTTTCATCCTACATAAATAGACGCATATAAGTACGCATTTAAGCATAAACACGC ACTATGCCGTTCTTCTCATGTATATATATATACAGGCAACACGCAGATATAGGTGCGACG TGAACAGTGAGCTGTATGTGCGCAGCTCGCGTTGCATTTTCGGAAGCGCTCGTTTTCGGA AACGCTTTGAAGTTCCTATTCCGAAGTTCCTATTCTCTAGAAAGTATAGGAACTTCAGAG CGCTTTTGAAAACCAAAAGCGCTCTGAAGACGCACTTTCAAAAAACCAAAAACGCACCG GACTGTAACGAGCTACTAAAATATTGCGAATACCGCTTCCACAAACATTGCTCAAAAGTA TCTCTTTGCTATATATCTCTGTGCTATATCCCTATATAACCTACCCATCCACCTTTCGCTCC TTGAACTTGCATCTAAACTCGACCTCTACATCAACAGGCTTCCAATGCTCTTCAAATTTTA CTGTCAAGTAGACCCATACGGCTGTAATATGCTGCTCTTCATAATGTAAGCTTATCTTTAT CGAATCGTGTGAAAAACTACTACCGCGATAAACCTTTACGGTTCCCTGAGATTGAATTAG TTCCTTTAGTATATGATACAAGACACTTTTGAACTTTGTACGACGAATTTTGAGGTTCGCC ATCCTCTGGCTATTTCCAATTATCCTGTCGGCTATTATCTCCGCCTCAGTTTGATCTTCCGC TTCAGACTGCCATTTTTCACATAATGAATCTATTTCACCCCACAATCCTTCATCCGCCTCC GCATCTTGTTCCGTTAAACTATTGACTTCATGTTGTACATTGTTTAGTTCACGAGAAGGGT CCTCTTCAGGCGGTAGCTCCTGATCTCCTATATGACCTTTATCCTGTTCTCTTTCCACAAA CTTAGAAATGTATTCATGAATTATGGAGCACCTAATAACATTCTTCAAGGCGGAGAAGTT TGGGCCAGATGCCCAATATGCTTGACATGAAAACGTGAGAATGAATTTAGTATTATTGTG ATATTCTGAGGCAATTTTATTATAATCTCGAAGATAAGAGAAGAATGCAGTGACCTTTGT ATTGACAAATGGAGATTCCATGTATCTAAAAAATACGCCTTTAGGCCTTCTGATACCCTT TCCCCTGCGGTTTAGCGTGCCTTTTACATTAATATCTAAACCCTCTCCGATGGTGGCCTTT AACTGACTAATAAATGCAACCGATATAAACTGTGATAATTCTGGGTGATTTATGATTCGA TCGACAATTGTATTGTACACTAGTGCAGGATCAGGCCAATCCAGTTCTTTTTCAATTACC GGTGTGTCGTCTGTATTCAGTACATGTCCAACAAATGCAAATGCTAACGTTTTGTATTTCT TATAATTGTCAGGAACTGGAAAAGTCCCCCTTGTCGTCTCGATTACACACCTACTTTCATC GTACACCATAGGTTGGAAGTGCTGCATAATACATTGCTTAATACAAGCAAGCAGTCTCTC GCCATTCATATTTCAGTTATTTTCCATTACAGCTGATGTCATTGTATATCAGCGCTGTAAA AATCTATCTGTTACAGAAGGTTTTCGCGGTTTTTATAAACAAAACTTTCGTTACGAAATC GAGCAATCACCCCAGCTGCGTATTTGGAAATTCGGGAAAAAGTAGAGCAACGCGAGTTG CATTTTTTACACCATAATGCATGATTAACTTCGAGAAGGGATTAAGGCTAATTTCACTAG TATGTTTCAAAAACCTCAATCTGTCCATTGAATGCCTTATAAAACAGCTATAGATTGCAT AGAAGAGTTAGCTACTCAATGCTTTTTGTCAAAGCTTACTGATGATGATGTGTCTACTTTC AGGCGGGTCTGTAGTAAGGAGAATGACATTATAAAGCTGGCACTTAGAATTCCACGGAC TATAGACTATACTAGTATACTCCGTCTACTGTACGATACACTTCCGCTCAGGTCCTTGTCC TTTAACGAGGCCTTACCACTCTTTTGTTACTCTATTGATCCAGCTCAGCAAAGGCAGTGTG ATCTAAGATTCTATCTTCGCGATGTAGTAAAACTAGCTAGACCGAGAAAGAGACTAGAA ATGCAAAAGGCACTTCTACAATGGCTGCCATCATTATTATCCGATGTGACGCTGCA Polynucleotide sequence of Variant No. 73 yCDS: (SEQ ID NO: 8) TTGGATAACGGGTTAGCCCGTACACCTACTATGGGTTGGCTTCACTGGGAAAGATTCATG TGTAACTTAGATTGCCAAGAAGAGCCTGACAGCTGTATCTCAGAGAAACTATTCATGGA GATGGCTGAACTAATGGTAAGTGAAGGATGGAAGGATGCTGGTTATGAATACCTATGTA TTGATGATTGCTGGATGGCTCCACAGCGTGATTCAGAAGGTAGGTTACAAGCTGACCCCC AGAGATTCCCACATGGCATACGTCAGCTTGCAAACTACGTACACAGCAAGGGTCTAAAG TTAGGCATCTACGCTGATGTCGGAAACAAGACATGTGCTGGTTTCCCAGGTTCATTCGGT TACTATGACATAGATGCGCAGACGTTTGCTGATTGGGGTGTTGATTTGTTGAAGTTTGAT GGATGCTACTGCGATTCCCTGGAGAACCTAGCCGATGGGTACAAACACATGAGTTTGGCT CTAAACAGGACTGGTAGGAGCATCGTCTATAGTTGTGAATGGCCCTTGTACATGTGGCCG TTTCAGAAGCCAAACTACACTGAGATAAGACAATACTGTAACCATTGGCGTAACTTTGCT GACATAGATGATTCATGGGCTTCAATCAAATCTATCTTGGATTGGACTTCTTTCAACCAG GAAAGAATTGTTGATGTTGCAGGTCCAGGTGGATGGAATGACCCTGATATGCTTGTCATA GGGAACTTTGGGCTATCATGGAATCAACAAGTTACACAAATGGCTTTGTGGGCGATCATG GCCGCACCCCTATTCATGTCTAATGATCTACGTCACATATCACCCCAAGCAAAGGCTTTA CTTCAAGATAAGGATGTCATAGCGATCAACCAAGATCCTCTTGGTAAACAAGGTTATCAA TTGAGACAAGGTGACAACTTTGAAGTGTGGGAAAGACCATTGTCTGGACTTGCGTGGGC TGTTGCTATGATCAACCGTCAAGAGATCGGAGGGCCAAGATCTTACACTATCGCGGTAGC CTCTTTGGGTAAGGGTGTTGCGTGCAATCCTGCCTGCTTCATTACACAATTGCTTCCAGTT AAGAGAAAGTTGGGTTTCTATGAGTGGACATCTAGGCTAAGAAGTCACATCAATCCTACT GGTACGGTATTGTTGCAATTGGAGAACACAATGCAAATGTCTTTGAAAGATTTGTTA Polynucleotide sequence of Variant No. 73: (SEQ ID NO: 9) CTGGACAATGGATTGGCAAGGACGCCTACCATGGGCTGGCTGCACTGGGAGCGCTTCAT GTGCAACCTTGACTGCCAGGAAGAGCCAGATTCCTGCATCAGTGAGAAGCTCTTCATGG AGATGGCAGAGCTCATGGTCTCAGAAGGCTGGAAGGATGCAGGTTATGAGTACCTCTGC ATTGATGACTGTTGGATGGCTCCCCAAAGAGATTCAGAAGGCAGACTTCAGGCAGACCC TCAGCGCTTTCCTCATGGGATTCGCCAGCTAGCTAATTATGTTCACAGCAAAGGACTGAA GCTAGGGATTTATGCAGATGTTGGAAATAAAACCTGCGCAGGCTTCCCTGGGAGTTTTGG ATACTACGACATTGATGCCCAGACCTTTGCTGACTGGGGAGTAGATCTGCTAAAATTTGA TGGTTGTTACTGTGACAGTTTGGAAAATTTGGCAGATGGTTATAAGCACATGTCCTTGGC CCTGAATAGGACTGGCAGAAGCATTGTGTACTCCTGTGAGTGGCCTCTTTATATGTGGCC CTTTCAAAAGCCCAATTATACAGAAATCCGACAGTACTGCAATCACTGGCGAAATTTTGC TGACATTGATGATTCCTGGGCGAGTATAAAGAGTATCTTGGACTGGACATCTTTTAACCA GGAGAGAATTGTTGATGTTGCTGGACCAGGGGGTTGGAATGACCCAGATATGTTAGTGA TTGGCAACTTTGGCCTCAGCTGGAATCAGCAAGTAACTCAGATGGCCCTCTGGGCTATCA TGGCTGCTCCTTTATTCATGTCTAATGACCTCCGACACATCAGCCCTCAAGCCAAAGCTCT CCTTCAGGATAAGGACGTAATTGCCATCAATCAGGACCCCTTGGGCAAGCAAGGGTACC AGCTTAGACAGGGAGACAACTTTGAAGTGTGGGAACGACCTCTCTCAGGCTTAGCCTGG GCTGTAGCTATGATAAACCGGCAGGAGATTGGTGGACCTCGCTCTTATACCATCGCAGTT GCTTCCCTGGGTAAAGGAGTGGCCTGTAATCCTGCCTGCTTCATCACACAGCTCCTCCCT GTGAAAAGGAAGCTAGGGTTCTATGAATGGACTTCAAGGTTAAGAAGTCACATAAATCC CACAGGCACTGTTTTGCTTCAGCTAGAAAATACAATGCAGATGTCATTAAAAGACTTACT T Polypeptide sequence of Variant No. 73: (SEQ ID NO: 10) LDNGLARTPTMGWLHWERFMCNLDCQEEPDSCISEKLFMEMAELMVSEGWKDAGYEYLCI DDCWMAPQRDSEGRLQADPQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYY DIDAQTFADWGVDLLKFDGCYCDSLENLADGYKHMSLALNRTGRSIVYSCEWPLYMWPFQ KPNYTEIRQYCNHWRNFADIDDSWASIKSILDWTSFNQERIVDVAGPGGWNDPDMLVIGNFG LSWNQQVTQMALWAIMAAPLFMSNDLRHISPQAKALLQDKDVIAINQDPLGKQGYQLRQG DNFEVWERPLSGLAWAVAMINRQEIGGPRSYTIAVASLGKGVACNPACFITQLLPVKRKLGF YEWTSRLRSHINPTGTVLLQLENTMQMSLKDLL Polynucleotide sequence of Variant No. 218 yCDS: (SEQ ID NO: 11) TTGGATAACGGGTTAGCCCGTACACCTACTATGGGTTGGCTTCACTGGGAAAGATTCATG TGTAACTTAGATTGCCAAGAAGAGCCTGACAGCTGTATCTCAGAGAAACTATTCATGGA GATGGCTGAACTAATGGTAAGTGAAGGATGGAAGGATGCTGGTTATGAATACCTATGTA TTGATGATTGCTGGATGGCTCCACAGCGTGATTCAGAAGGTAGGTTACAAGCTGACCCCC AGAGATTCCCACATGGCATACGTCAGCTTGCAAACTACGTACACAGCAAGGGTCTAAAG TTAGGCATCTACGCTGATGTCGGAAACAAGACATGTGCTGGTTTCCCAGGTTCATTCGGT TACTATGACATAGATGCGCAGACGTTTGCTGATTGGGGTGTTGATTTGTTGAAGTTTGAT GGATGCTACTGCGATTCCCTGGAGAACCTAGCCGATGGGTACAAACACATGAGTTTGGCT CTAAACAGGACTGGTAGGAGCATCGTCTATAGTTGTGAATGGCCCTTGTACATGTGGCCG TTTCAGAAGCCAAACTACACTGAGATAAGACAATACTGTAACCATTGGCGTAACTTTGCT GACATAGATGATTCATGGGCTTCAATCAAATCTATCTTGGATTGGACTTCTTTCAACCAG GAAAGAATTGTTGATGTTGCAGGTCCAGGTGGATGGAATGACCCTGATATGCTTGTCATA GGGAACTTTGGGCTATCATGGAATCAACAAGTTACACAAATGGCTTTGTGGGCGATCATG GCCGCACCCCTATTCATGTCTAATGATCTACGTCACATATCACCCCAAGCAAAGGCTTTA CTTCAAGATAAGGATGTCATAGCGATCAACCAAGATCCTCTTGGTAAACAAGGTTATCAA TTGAGACAAGGTGACAACTTTGAAGTGTGGGAAAGACCATTGTCTGGACTTGCGTGGGC TGTTGCTATTATCAACCGTCAAGAGATCGGAGGGCCAAGATCTTACACTATCGCGGTAGC CTCTTTGGGTAAGGGTGTTGCGTGCAATCCTGCCTGCTTCATTACACAATTGCTTCCAGTT AAGAGAAAGTTGGGTTTCTATAACTGGACATCTAGGCTAAAAAGTCACATTAATCCTACT GGTACGGTATTGTTGCAATTGGAGAACACAATGCAAATGTCTTTGAAAGATTTGTTA Polynucleotide sequence of Variant No. 218 hCDS: (SEQ ID NO: 12) CTGGACAATGGATTGGCAAGGACGCCTACCATGGGCTGGCTGCACTGGGAGCGCTTCAT GTGCAACCTTGACTGCCAGGAAGAGCCAGATTCCTGCATCAGTGAGAAGCTCTTCATGG AGATGGCAGAGCTCATGGTCTCAGAAGGCTGGAAGGATGCAGGTTATGAGTACCTCTGC ATTGATGACTGTTGGATGGCTCCCCAAAGAGATTCAGAAGGCAGACTTCAGGCAGACCC TCAGCGCTTTCCTCATGGGATTCGCCAGCTAGCTAATTATGTTCACAGCAAAGGACTGAA GCTAGGGATTTATGCAGATGTTGGAAATAAAACCTGCGCAGGCTTCCCTGGGAGTTTTGG ATACTACGACATTGATGCCCAGACCTTTGCTGACTGGGGAGTAGATCTGCTAAAATTTGA TGGTTGTTACTGTGACAGTTTGGAAAATTTGGCAGATGGTTATAAGCACATGTCCTTGGC CCTGAATAGGACTGGCAGAAGCATTGTGTACTCCTGTGAGTGGCCTCTTTATATGTGGCC CTTTCAAAAGCCCAATTATACAGAAATCCGACAGTACTGCAATCACTGGCGAAATTTTGC TGACATTGATGATTCCTGGGCGAGTATAAAGAGTATCTTGGACTGGACATCTTTTAACCA GGAGAGAATTGTTGATGTTGCTGGACCAGGGGGTTGGAATGACCCAGATATGTTAGTGA TTGGCAACTTTGGCCTCAGCTGGAATCAGCAAGTAACTCAGATGGCCCTCTGGGCTATCA TGGCTGCTCCTTTATTCATGTCTAATGACCTCCGACACATCAGCCCTCAAGCCAAAGCTCT CCTTCAGGATAAGGACGTAATTGCCATCAATCAGGACCCCTTGGGCAAGCAAGGGTACC AGCTTAGACAGGGAGACAACTTTGAAGTGTGGGAACGACCTCTCTCAGGCTTAGCCTGG GCTGTAGCTATTATAAACCGGCAGGAGATTGGTGGACCTCGCTCTTATACCATCGCAGTT GCTTCCCTGGGTAAAGGAGTGGCCTGTAATCCTGCCTGCTTCATCACACAGCTCCTCCCT GTGAAAAGGAAGCTAGGGTTCTATAACTGGACTTCAAGGTTAAAAAGTCACATAAATCC CACAGGCACTGTTTTGCTTCAGCTAGAAAATACAATGCAGATGTCATTAAAAGACTTACT T Polypeptide sequence of Variant No. 218: (SEQ ID NO: 13) LDNGLARTPTMGWLHWERFMCNLDCQEEPDSCISEKLFMEMAELMVSEGWKDAGYEYLCI DDCWMAPQRDSEGRLQADPQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYY DIDAQTFADWGVDLLKFDGCYCDSLENLADGYKHMSLALNRTGRSIVYSCEWPLYMWPFQ KPNYTEIRQYCNHWRNFADIDDSWASIKSILDWTSFNQERIVDVAGPGGWNDPDMLVIGNFG LSWNQQVTQMALWAIMAAPLFMSNDLRHISPQAKALLQDKDVIAINQDPLGKQGYQLRQG DNFEVWERPLSGLAWAVAIINRQEIGGPRSYTIAVASLGKGVACNPACFITQLLPVKRKLGFY NVVTSRLKSHINPTGTVLLQLENTMQMSLKDLL Polynucleotide sequence of Variant No. 326 yCDS: (SEQ ID NO: 14) TTGGATAACGGGTTAGCCCGTACACCTACTATGGGTTGGCTTCACTGGGAAAGATTCATG TGTAACTTAGATTGCCAAGAAGAGCCTGACAGCTGTATCTCAGAGAAACTATTCATGGA GATGGCTGAACGGATGGTAAGTGAAGGATGGAAGGATGCTGGTTATGAATACCTATGTA TTGATGATTGCTGGATGGCTCCACAGCGTGATTCAGAAGGTAGGTTACAAGCTGACCCCC AGAGATTCCCACATGGCATACGTCAGCTTGCAAACTACGTACACAGCAAAGGTCTAAAG TTAGGCATCTACGCTGATGTCGGAAACAAGACATGTGCTGGTTTCCCAGGTTCATTCGGT TACTATGACATAGATGCGCAGACGTTTGCTGATTGGGGTGTTGATTTGTTGAAGTTTGAT GGATGCTACTGCGATTCCCTGGAGAACCTAGCCGATGGGTACAAACACATGAGTTTGGCT CTAAACAGGACTGGTAGGAGCATCGTCTATAGTTGTGAATGGCCCTTGTACATGTGGCCG TTTCAGAAGCCAAACTACACTGAGATAAGACAATACTGTAACCATTGGCGTAACTTTGCT GACATAGATGATTCATGGGCTTCAATCAAATCTATCTTGGATTGGACTTCTCGTAACCAG GAAAGAATTGTTGATGTTGCAGGTCCAGGTGGATGGAATGACCCTGATATGCTTGTCATA GGGAACTTTGGGCTATCATGGGACCAACAAGTTACACAAATGGCTTTGTGGGCGATCAT GGCCGCACCCCTATTCATGTCTAATGATCTACGTCACATATCACCCCAAGCAAAGGCTTT ACTTCAAGATAAGGATGTCATAGCGATCAACCAAGATCCTCTTGGTAAACAAGGTTATCA ATTGAGAAAAGGTGACAACTTTGAAGTGTGGGAAAGACCATTGTCTGGAGATGCGTGGG CTGTTGCTATTATCAACCGTCAAGAGATCGGAGGGCCAAGATCTTACACTATCCCGGTAG CCTCTTTGGGTAAGGGTGTTGCGTGCAATCCTGCCTGCTTCATTACACAATTGCTTCCAGT TAAGAGACAATTGGGTTTCTATAACTGGACCTCTAGGCTAAAAAGTCACATTAATCCTAC TGGTACGGTATTGTTGCAATTGGAGAACACAATGCAAATGTCTTTGAAAGATTTGTTA Polypeptide sequence of Variant No. 326: (SEQ ID NO: 15) LDNGLARTPTMGWLHWERFMCNLDCQEEPDSCISEKLFMEMAERMVSEGWKDAGYEYLCI DDCWMAPQRDSEGRLQADPQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYY DIDAQTFADWGVDLLKFDGCYCDSLENLADGYKHMSLALNRTGRSIVYSCEWPLYMWPFQ KPNYTEIRQYCNHWRNFADIDDSWASIKSILDWTSRNQERIVDVAGPGGWNDPDMLVIGNF GLSWDQQVTQMALWAIMAAPLFMSNDLRHISPQAKALLQDKDVIAINQDPLGKQGYQLRK GDNFEVWERPLSGDAWAVAIINRQEIGGPRSYTIPVASLGKGVACNPACFITQLLPVKRQLGF YNVVTSRLKSHINPTGTVLLQLENTMQMSLKDLL Polynucleotide sequence of Variant No. 206 yCDS: (SEQ ID NO: 16) TTGGATAACGGGTTAGCCCGTACACCTACTATGGGTTGGCTTCACTGGGAAAGATTCATG TGTAACTTAGATTGCCAAGAAGAGCCTGACAGCTGTATCTCAGAGAAACTATTCATGGA GATGGCTGAACTAATGGTAAGTGAAGGATGGAAGGATGCTGGTTATGAATACCTATGTA TTGATGATTGCTGGATGGCTCCACAGCGTGATTCAGAAGGTAGGTTACAAGCTGACCCCC AGAGATTCCCACATGGCATACGTCAGCTTGCAAACTACGTACACAGCAAGGGTCTAAAG TTAGGCATCTACGCTGATGTCGGAAACAAGACATGTGCTGGTTTCCCAGGTTCATTCGGT TACTATGACATAGATGCGCAGACGTTTGCTGATTGGGGTGTTGATTTGTTGAAGTTTGAT GGATGCTACTGCGATTCCCTGGAGAACCTAGCCGATGGGTACAAACACATGAGTTTGGCT CTAAACAGGACTGGTAGGAGCATCGTCTATAGTTGTGAATGGCCCTTGTACATGTGGCCG TTTCAGAAGCCAAACTACACTGAGATAAGACAATACTGTAACCATTGGCGTAACTTTGCT GACATAGATGATTCATGGGCTTCAATCAAATCTATCTTGGATTGGACTTCTTTCAACCAG GAAAGAATTGTTGATGTTGCAGGTCCAGGTGGATGGAATGACCCTGATATGCTTGTCATA GGGAACTTTGGGCTATCATGGAATCAACAAGTTACACAAATGGCTTTGTGGGCGATCATG GCCGCACCCCTATTCATGTCTAATGATCTACGTCACATATCACCCCAAGCAAAGGCTTTA CTTCAAGATAAGGATGTCATAGCGATCAACCAAGATCCTCTTGGTAAACAAGGTTATCAA TTGAGACAAGGTGACAACTTTGAAGTGTGGGAAAGACCATTGTCTGGACTTGCGTGGGC TGTTGCTATGATCAACCGTCAAGAGATCGGAGGGCCAAGATCTTACACTATCGCGGTAGC CTCTTTGGGTAAGGGTGTTGCGTGCAATCCTGCCTGCTTCATTACACAATTGCTTCCAGTT AAGAGAAAGTTGGGTTTCTATAATTGGACCTCTAGGCTAAGAAGTCACATCAATCCTACT GGTACGGTATTGTTGCAATTGGAGAACACAATGCAAATGTCTTTGAAAGATTTGTTA Polynucleotide sequence of Variant No. 206 hCDS: (SEQ ID NO: 17) CTGGACAATGGATTGGCAAGGACGCCTACCATGGGCTGGCTGCACTGGGAGCGCTTCAT GTGCAACCTTGACTGCCAGGAAGAGCCAGATTCCTGCATCAGTGAGAAGCTCTTCATGG AGATGGCAGAGCTCATGGTCTCAGAAGGCTGGAAGGATGCAGGTTATGAGTACCTCTGC ATTGATGACTGTTGGATGGCTCCCCAAAGAGATTCAGAAGGCAGACTTCAGGCAGACCC TCAGCGCTTTCCTCATGGGATTCGCCAGCTAGCTAATTATGTTCACAGCAAAGGACTGAA GCTAGGGATTTATGCAGATGTTGGAAATAAAACCTGCGCAGGCTTCCCTGGGAGTTTTGG ATACTACGACATTGATGCCCAGACCTTTGCTGACTGGGGAGTAGATCTGCTAAAATTTGA TGGTTGTTACTGTGACAGTTTGGAAAATTTGGCAGATGGTTATAAGCACATGTCCTTGGC CCTGAATAGGACTGGCAGAAGCATTGTGTACTCCTGTGAGTGGCCTCTTTATATGTGGCC CTTTCAAAAGCCCAATTATACAGAAATCCGACAGTACTGCAATCACTGGCGAAATTTTGC TGACATTGATGATTCCTGGGCGAGTATAAAGAGTATCTTGGACTGGACATCTTTTAACCA GGAGAGAATTGTTGATGTTGCTGGACCAGGGGGTTGGAATGACCCAGATATGTTAGTGA TTGGCAACTTTGGCCTCAGCTGGAATCAGCAAGTAACTCAGATGGCCCTCTGGGCTATCA TGGCTGCTCCTTTATTCATGTCTAATGACCTCCGACACATCAGCCCTCAAGCCAAAGCTCT CCTTCAGGATAAGGACGTAATTGCCATCAATCAGGACCCCTTGGGCAAGCAAGGGTACC AGCTTAGACAGGGAGACAACTTTGAAGTGTGGGAACGACCTCTCTCAGGCTTAGCCTGG GCTGTAGCTATGATAAACCGGCAGGAGATTGGTGGACCTCGCTCTTATACCATCGCAGTT GCTTCCCTGGGTAAAGGAGTGGCCTGTAATCCTGCCTGCTTCATCACACAGCTCCTCCCT GTGAAAAGGAAGCTAGGGTTCTATAACTGGACTTCAAGGTTAAGAAGTCACATAAATCC CACAGGCACTGTTTTGCTTCAGCTAGAAAATACAATGCAGATGTCATTAAAAGACTTACT T Polypeptide sequence of Variant No. 206: (SEQ ID NO: 18) LDNGLARTPTMGWLHWERFMCNLDCQEEPDSCISEKLFMEMAELMVSEGWKDAGYEYLCI DDCWMAPQRDSEGRLQADPQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYY DIDAQTFADWGVDLLKFDGCYCDSLENLADGYKHMSLALNRTGRSIVYSCEWPLYMWPFQ KPNYTEIRQYCNHWRNFADIDDSWASIKSILDWTSFNQERIVDVAGPGGWNDPDMLVIGNFG LSWNQQVTQMALWAIMAAPLFMSNDLRHISPQAKALLQDKDVIAINQDPLGKQGYQLRQG DNFEVWERPLSGLAWAVAMINRQEIGGPRSYTIAVASLGKGVACNPACFITQLLPVKRKLGF YNWTSRLRSHINPTGTVLLQLENTMQMSLKDLL Polynucleotide sequence of Variant No. 205 yCDS: (SEQ ID NO: 19) TTGGATAACGGGTTAGCCCGTACACCTACTATGGGTTGGCTTCACTGGGAAAGATTCATG TGTAACTTAGATTGCCAAGAAGAGCCTGACAGCTGTATCTCAGAGAAACTATTCATGGA GATGGCTGAACTAATGGTAAGTGAAGGATGGAAGGATGCTGGTTATGAATACCTATGTA TTGATGATTGCTGGATGGCTCCACAGCGTGATTCAGAAGGTAGGTTACAAGCTGACCCCC AGAGATTCCCACATGGCATACGTCAGCTTGCAAACTACGTACACAGCAAGGGTCTAAAG TTAGGCATCTACGCTGATGTCGGAAACAAGACATGTGCTGGTTTCCCAGGTTCATTCGGT TACTATGACATAGATGCGCAGACGTTTGCTGATTGGGGTGTTGATTTGTTGAAGTTTGAT GGATGCTACTGCGATTCCCTGGAGAACCTAGCCGATGGGTACAAACACATGAGTTTGGCT CTAAACAGGACTGGTAGGAGCATCGTCTATAGTTGTGAATGGCCCTTGTACATGTGGCCG TTTCAGAAGCCAAACTACACTGAGATAAGACAATACTGTAACCATTGGCGTAACTTTGCT GACATAGATGATTCATGGGCTTCAATCAAATCTATCTTGGATTGGACTTCTTTCAACCAG GAAAGAATTGTTGATGTTGCAGGTCCAGGTGGATGGAATGACCCTGATATGCTTGTCATA GGGAACTTTGGGCTATCATGGAATCAACAAGTTACACAAATGGCTTTGTGGGCGATCATG GCCGCACCCCTATTCATGTCTAATGATCTACGTCACATATCACCCCAAGCAAAGGCTTTA CTTCAAGATAAGGATGTCATAGCGATCAACCAAGATCCTCTTGGTAAACAAGGTTATCAA TTGAGACAAGGTGACAACTTTGAAGTGTGGGAAAGACCATTGTCTGGACTTGCGTGGGC TGTTGCTATGATCAACCGTCAAGAGATCGGAGGGCCAAGATCTTACACTATCGCGGTAGC CTCTTTGGGTAAGGGTGTTGCGTGCAATCCTGCCTGCTTCATTACACAATTGCTTCCAGTT AAGAGAAAGTTGGGTTTCTATGATTGGGACTCTAGGCTAAGAAGTCACATCAATCCTACT GGTACGGTATTGTTGCAATTGGAGAACACAATGCAAATGTCTTTGAAAGATTTGTTA Polynucleotide sequence of Variant No. 205 hCDS: (SEQ ID NO: 20) CTGGACAATGGATTGGCAAGGACGCCTACCATGGGCTGGCTGCACTGGGAGCGCTTCAT GTGCAACCTTGACTGCCAGGAAGAGCCAGATTCCTGCATCAGTGAGAAGCTCTTCATGG AGATGGCAGAGCTCATGGTCTCAGAAGGCTGGAAGGATGCAGGTTATGAGTACCTCTGC ATTGATGACTGTTGGATGGCTCCCCAAAGAGATTCAGAAGGCAGACTTCAGGCAGACCC TCAGCGCTTTCCTCATGGGATTCGCCAGCTAGCTAATTATGTTCACAGCAAAGGACTGAA GCTAGGGATTTATGCAGATGTTGGAAATAAAACCTGCGCAGGCTTCCCTGGGAGTTTTGG ATACTACGACATTGATGCCCAGACCTTTGCTGACTGGGGAGTAGATCTGCTAAAATTTGA TGGTTGTTACTGTGACAGTTTGGAAAATTTGGCAGATGGTTATAAGCACATGTCCTTGGC CCTGAATAGGACTGGCAGAAGCATTGTGTACTCCTGTGAGTGGCCTCTTTATATGTGGCC CTTTCAAAAGCCCAATTATACAGAAATCCGACAGTACTGCAATCACTGGCGAAATTTTGC TGACATTGATGATTCCTGGGCGAGTATAAAGAGTATCTTGGACTGGACATCTTTTAACCA GGAGAGAATTGTTGATGTTGCTGGACCAGGGGGTTGGAATGACCCAGATATGTTAGTGA TTGGCAACTTTGGCCTCAGCTGGAATCAGCAAGTAACTCAGATGGCCCTCTGGGCTATCA TGGCTGCTCCTTTATTCATGTCTAATGACCTCCGACACATCAGCCCTCAAGCCAAAGCTCT CCTTCAGGATAAGGACGTAATTGCCATCAATCAGGACCCCTTGGGCAAGCAAGGGTACC AGCTTAGACAGGGAGACAACTTTGAAGTGTGGGAACGACCTCTCTCAGGCTTAGCCTGG GCTGTAGCTATGATAAACCGGCAGGAGATTGGTGGACCTCGCTCTTATACCATCGCAGTT GCTTCCCTGGGTAAAGGAGTGGCCTGTAATCCTGCCTGCTTCATCACACAGCTCCTCCCT GTGAAAAGGAAGCTAGGGTTCTATGATTGGGATTCAAGGTTAAGAAGTCACATAAATCC CACAGGCACTGTTTTGCTTCAGCTAGAAAATACAATGCAGATGTCATTAAAAGACTTACT T Polypeptide sequence of Variant No. 205: (SEQ ID NO: 21) LDNGLARTPTMGWLHWERFMCNLDCQEEPDSCISEKLFMEMAELMVSEGWKDAGYEYLCI DDCWMAPQRDSEGRLQADPQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYY DIDAQTFADWGVDLLKFDGCYCDSLENLADGYKHMSLALNRTGRSIVYSCEWPLYMWPFQ KPNYTEIRQYCNHWRNFADIDDSWASIKSILDWTSFNQERIVDVAGPGGWNDPDMLVIGNFG LSWNQQVTQMALWAIMAAPLFMSNDLRHISPQAKALLQDKDVIAINQDPLGKQGYQLRQG DNFEVWERPLSGLAWAVAMINRQEIGGPRSYTIAVASLGKGVACNPACFITQLLPVKRKLGF YDWDSRLRSHINPTGTVLLQLENTMQMSLKDLL Polynucleotide sequence of Variant No. 76 yCDS: (SEQ ID NO: 22) TTGGATAACGGGTTAGCCCGTACACCTACTATGGGTTGGCTTCACTGGGAAAGATTCATG TGTAACTTAGATTGCCAAGAAGAGCCTGACAGCTGTATCTCAGAGAAACTATTCATGGA GATGGCTGAACTAATGGTAAGTGAAGGATGGAAGGATGCTGGTTATGAATACCTATGTA TTGATGATTGCTGGATGGCTCCACAGCGTGATTCAGAAGGTAGGTTACAAGCTGACCCCC AGAGATTCCCACATGGCATACGTCAGCTTGCAAACTACGTACACAGCAAGGGTCTAAAG TTAGGCATCTACGCTGATGTCGGAAACAAGACATGTGCTGGTTTCCCAGGTTCATTCGGT TACTATGACATAGATGCGCAGACGTTTGCTGATTGGGGTGTTGATTTGTTGAAGTTTGAT GGATGCTACTGCGATTCCCTGGAGAACCTAGCCGATGGGTACAAACACATGAGTTTGGCT CTAAACAGGACTGGTAGGAGCATCGTCTATAGTTGTGAATGGCCCTTGTACATGTGGCCG TTTCAGAAGCCAAACTACACTGAGATAAGACAATACTGTAACCATTGGCGTAACTTTGCT GACATAGATGATTCATGGAGGTCAATCAAATCTATCTTGGATTGGACTTCTTTCAACCAG GAAAGAATTGTTGATGTTGCAGGTCCAGGTGGATGGAATGACCCTGATATGCTTGTCATA GGGAACTTTGGGCTATCATGGAATCAACAAGTTACACAAATGGCTTTGTGGGCGATCATG GCCGCACCCCTATTCATGTCTAATGATCTACGTCACATATCACCCCAAGCAAAGGCTTTA CTTCAAGATAAGGATGTCATAGCGATCAACCAAGATCCTCTTGGTAAACAAGGTTATCAA TTGAGACAAGGTGACAACTTTGAAGTGTGGGAAAGACCATTGTCTGGACTTGCGTGGGC TGTTGCTATGATCAACCGTCAAGAGATCGGAGGGCCAAGATCTTACACTATCGCGGTAGC CTCTTTGGGTAAGGGTGTTGCGTGCAATCCTGCCTGCTTCATTACACAATTGCTTCCAGTT AAGAGAAAGTTGGGTTTCTATGAGTGGACATCTAGGCTAAGAAGTCACATCAATCCTACT GGTACGGTATTGTTGCAATTGGAGAACACAATGCAAATGTCTTTGAAAGATTTGTTA Polynucleotide sequence of Variant No. 76 hCDS: (SEQ ID NO: 23) CTGGACAATGGATTGGCAAGGACGCCTACCATGGGCTGGCTGCACTGGGAGCGCTTCAT GTGCAACCTTGACTGCCAGGAAGAGCCAGATTCCTGCATCAGTGAGAAGCTCTTCATGG AGATGGCAGAGCTCATGGTCTCAGAAGGCTGGAAGGATGCAGGTTATGAGTACCTCTGC ATTGATGACTGTTGGATGGCTCCCCAAAGAGATTCAGAAGGCAGACTTCAGGCAGACCC TCAGCGCTTTCCTCATGGGATTCGCCAGCTAGCTAATTATGTTCACAGCAAAGGACTGAA GCTAGGGATTTATGCAGATGTTGGAAATAAAACCTGCGCAGGCTTCCCTGGGAGTTTTGG ATACTACGACATTGATGCCCAGACCTTTGCTGACTGGGGAGTAGATCTGCTAAAATTTGA TGGTTGTTACTGTGACAGTTTGGAAAATTTGGCAGATGGTTATAAGCACATGTCCTTGGC CCTGAATAGGACTGGCAGAAGCATTGTGTACTCCTGTGAGTGGCCTCTTTATATGTGGCC CTTTCAAAAGCCCAATTATACAGAAATCCGACAGTACTGCAATCACTGGCGAAATTTTGC TGACATTGATGATTCCTGGCGTAGTATAAAGAGTATCTTGGACTGGACATCTTTTAACCA GGAGAGAATTGTTGATGTTGCTGGACCAGGGGGTTGGAATGACCCAGATATGTTAGTGA TTGGCAACTTTGGCCTCAGCTGGAATCAGCAAGTAACTCAGATGGCCCTCTGGGCTATCA TGGCTGCTCCTTTATTCATGTCTAATGACCTCCGACACATCAGCCCTCAAGCCAAAGCTCT CCTTCAGGATAAGGACGTAATTGCCATCAATCAGGACCCCTTGGGCAAGCAAGGGTACC AGCTTAGACAGGGAGACAACTTTGAAGTGTGGGAACGACCTCTCTCAGGCTTAGCCTGG GCTGTAGCTATGATAAACCGGCAGGAGATTGGTGGACCTCGCTCTTATACCATCGCAGTT GCTTCCCTGGGTAAAGGAGTGGCCTGTAATCCTGCCTGCTTCATCACACAGCTCCTCCCT GTGAAAAGGAAGCTAGGGTTCTATGAATGGACTTCAAGGTTAAGAAGTCACATAAATCC CACAGGCACTGTTTTGCTTCAGCTAGAAAATACAATGCAGATGTCATTAAAAGACTTACT T Polypeptide sequence of Variant No. 76: (SEQ ID NO: 24) LDNGLARTPTMGWLHWERFMCNLDCQEEPDSCISEKLFMEMAELMVSEGWKDAGYEYLCI DDCWMAPQRDSEGRLQADPQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYY DIDAQTFADWGVDLLKFDGCYCDSLENLADGYKHMSLALNRTGRSIVYSCEWPLYMWPFQ KPNYTEIRQYCNHWRNFADIDDSWRSIKSILDWTSFNQERIVDVAGPGGWNDPDMLVIGNFG LSWNQQVTQMALWAIMAAPLFMSNDLRHISPQAKALLQDKDVIAINQDPLGKQGYQLRQG DNFEVWERPLSGLAWAVAMINRQEIGGPRSYTIAVASLGKGVACNPACFITQLLPVKRKLGF YEWTSRLRSHINPTGTVLLQLENTMQMSLKDLL Polynucleotide sequence of Mfalpha signal peptide: (SEQ ID NO: 25) ATGAGATTTCCTTCAATTTTTACTGCAGTTTTATTCGCAGCATCCTCCGCATTAGCT Polypeptide sequence of Mfalpha signal peptide: (SEQ ID NO: 26) MRFPSIFTAVLFAASSALA Polynucleotide sequence of MMO435: (SEQ ID NO: 27) ttaactatatcgtaatacacaggatccaccATGAGATTTCCTTCAATTTTTACTG Polynucleotide sequence of MMO439: (SEQ ID NO: 28) AGTAGGTGTACGGGCTAACCCGTTATCCAAAGCTAATGCGGAGGATGC Polynucleotide sequence of MMO514: (SEQ ID NO: 29) TTTTACTGCAGTTTTATTCGCAGCATCCTCCGCATTAGCTTTGGATAACGGGTTAGCCCG Polynucleotide sequence of MMO481: (SEQ ID NO: 30) GAGCTAAAAGTACAGTGGGAACAAAGTCGAGGTCGACTTATAACAAATCTTTCAAAGAC A Polynucleotide sequence of Synthetic mammalian signal peptide: (SEQ ID NO: 31) ATGGAATGGAGCTGGGTCTTTCTCTTCTTCCTGTCAGTAACGACTGGTGTCCACTCC Polynucleotide sequence of LAKE Fw: (SEQ ID NO. 32) CGATCGAAGCTTCGCCACCA Polynucleotide sequence of Br reverse: (SEQ ID NO: 33) CTTGCCAATCCATTGTCCAGGGAGTGGACACCAGTCGTTA Polynucleotide sequence of Br Fw: (SEQ ID NO: 34) TAACGACTGGTGTCCACTCCCTGGACAATGGATTGGCAAG Polynucleotide sequence of hGLA Rv: (SEQ ID NO: 35) CGATCGGCGGCCGCTCAAAGTAAGTCTTTTAATGACA Polynucleotide sequence of SP-GLA (yCDS): (SEQ ID NO: 36) ATGAGATTTCCTTCAATTTTTACTGCAGTTTTATTCGCAGCATCCTCCGCATTAGCTTTGG ATAACGGGTTAGCCCGTACACCTACTATGGGTTGGCTTCACTGGGAAAGATTCATGTGTA ACTTAGATTGCCAAGAAGAGCCTGACAGCTGTATCTCAGAGAAACTATTCATGGAGATG GCTGAACTAATGGTAAGTGAAGGATGGAAGGATGCTGGTTATGAATACCTATGTATTGA TGATTGCTGGATGGCTCCACAGCGTGATTCAGAAGGTAGGTTACAAGCTGACCCCCAGA GATTCCCACATGGCATACGTCAGCTTGCAAACTACGTACACAGCAAGGGTCTAAAGTTA GGCATCTACGCTGATGTCGGAAACAAGACATGTGCTGGTTTCCCAGGTTCATTCGGTTAC TATGACATAGATGCGCAGACGTTTGCTGATTGGGGTGTTGATTTGTTGAAGTTTGATGGA TGCTACTGCGATTCCCTGGAGAACCTAGCCGATGGGTACAAACACATGAGTTTGGCTCTA AACAGGACTGGTAGGAGCATCGTCTATAGTTGTGAATGGCCCTTGTACATGTGGCCGTTT CAGAAGCCAAACTACACTGAGATAAGACAATACTGTAACCATTGGCGTAACTTTGCTGA CATAGATGATTCATGGAAGTCAATCAAATCTATCTTGGATTGGACTTCTTTCAACCAGGA AAGAATTGTTGATGTTGCAGGTCCAGGTGGATGGAATGACCCTGATATGCTTGTCATAGG GAACTTTGGGCTATCATGGAATCAACAAGTTACACAAATGGCTTTGTGGGCGATCATGGC CGCACCCCTATTCATGTCTAATGATCTACGTCACATATCACCCCAAGCAAAGGCTTTACT TCAAGATAAGGATGTCATAGCGATCAACCAAGATCCTCTTGGTAAACAAGGTTATCAATT GAGACAAGGTGACAACTTTGAAGTGTGGGAAAGACCATTGTCTGGACTTGCGTGGGCTG TTGCTATGATCAACCGTCAAGAGATCGGAGGGCCAAGATCTTACACTATCGCGGTAGCCT CTTTGGGTAAGGGTGTTGCGTGCAATCCTGCCTGCTTCATTACACAATTGCTTCCAGTTAA GAGAAAGTTGGGTTTCTATGAGTGGACATCTAGGCTAAGAAGTCACATCAATCCTACTGG TACGGTATTGTTGCAATTGGAGAACACAATGCAAATGTCTTTGAAAGATTTGTTA Polynucleotide Sequence of MFleader-GLA (yCDS): (SEQ ID NO: 37) ATGAGATTTCCTTCAATTTTTACTGCAGTTTTATTCGCAGCATCCTCCGCATTAGCTGCTC CAGTCAACACTACAACAGAAGATGAAACGGCACAAATTCCGGCTGAAGCTGTCATCGGT TACTTAGATTTAGAAGGGGATTTCGATGTTGCTGTTTTGCCATTTTCCAACAGCACAAAT AACGGGTTATTGTTTATAAATACTACTATTGCCAGCATTGCTGCTAAAGAAGAAGGGGTA TCTTTGGATAAAAGATTGGATAACGGGTTAGCCCGTACACCTACTATGGGTTGGCTTCAC TGGGAAAGATTCATGTGTAACTTAGATTGCCAAGAAGAGCCTGACAGCTGTATCTCAGA GAAACTATTCATGGAGATGGCTGAACTAATGGTAAGTGAAGGATGGAAGGATGCTGGTT ATGAATACCTATGTATTGATGATTGCTGGATGGCTCCACAGCGTGATTCAGAAGGTAGGT TACAAGCTGACCCCCAGAGATTCCCACATGGCATACGTCAGCTTGCAAACTACGTACACA GCAAGGGTCTAAAGTTAGGCATCTACGCTGATGTCGGAAACAAGACATGTGCTGGTTTCC CAGGTTCATTCGGTTACTATGACATAGATGCGCAGACGTTTGCTGATTGGGGTGTTGATT TGTTGAAGTTTGATGGATGCTACTGCGATTCCCTGGAGAACCTAGCCGATGGGTACAAAC ACATGAGTTTGGCTCTAAACAGGACTGGTAGGAGCATCGTCTATAGTTGTGAATGGCCCT TGTACATGTGGCCGTTTCAGAAGCCAAACTACACTGAGATAAGACAATACTGTAACCATT GGCGTAACTTTGCTGACATAGATGATTCATGGAAGTCAATCAAATCTATCTTGGATTGGA CTTCTTTCAACCAGGAAAGAATTGTTGATGTTGCAGGTCCAGGTGGATGGAATGACCCTG ATATGCTTGTCATAGGGAACTTTGGGCTATCATGGAATCAACAAGTTACACAAATGGCTT TGTGGGCGATCATGGCCGCACCCCTATTCATGTCTAATGATCTACGTCACATATCACCCC AAGCAAAGGCTTTACTTCAAGATAAGGATGTCATAGCGATCAACCAAGATCCTCTTGGTA AACAAGGTTATCAATTGAGACAAGGTGACAACTTTGAAGTGTGGGAAAGACCATTGTCT GGACTTGCGTGGGCTGTTGCTATGATCAACCGTCAAGAGATCGGAGGGCCAAGATCTTA CACTATCGCGGTAGCCTCTTTGGGTAAGGGTGTTGCGTGCAATCCTGCCTGCTTCATTAC ACAATTGCTTCCAGTTAAGAGAAAGTTGGGTTTCTATGAGTGGACATCTAGGCTAAGAAG TCACATCAATCCTACTGGTACGGTATTGTTGCAATTGGAGAACACAATGCAAATGTCTTT GAAAGATTTGTTA Polypeptide Sequence of MFleader: (SEQ ID NO: 38) MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYLDLEGDFDVAVLPFSNSTNNGLL FINTTIASIAAKEEGVSLDKR Polynucleotide sequence of Variant No. 395 yCDS: (SEQ ID NO: 39) TTGGATAACGGGTTAGCCCGTACACCTACTATGGGTTGGCTTCACTGGGAAAGATTCATG TGTAACTTAGATTGCCAAGAAGAGCCTGACAGCTGTATCTCAGAGAAACTATTCATGGA GATGGCTGAACGGATGGTAAGTGAAGGATGGAAGGATGCTGGTTATGAATACCTATGTA TTGATGATTGCTGGATGGCTCCACAGCGTGATTCAGAAGGTAGGTTACAAGCTGACCCCC AGAGATTCCCACATGGCATACGTCAGCTTGCAAACCATGTACACAGCAAAGGTCTAAAG TTAGGCATCTACGCTGATGTCGGAAACAAGACATGTGCTGGTTTCCCAGGTTCATTCGGT TACTATGACATAGATGCGCAGACGTTTGCTGATTGGGGTGTTGATTTGTTGAAGTTTGAT GGATGCTACTGCGATTCCCTGGAGAACCTAGCCGATGGGTACAAACACATGAGTTTGGCT CTAAACAGGACTGGTAGGAGCATCGTCTATAGTTGTGAATGGCCCTTGTACATGTGGCCG TTTCAGAAGCCAAACTACACTGAGATAAGACAATACTGTAACCATTGGCGTAACTTTGCT GACATAGATGATTCATGGGCTTCAATCAAATCTATCTTGGATTGGACTTCTCGTAACCAG GAAAGAATTGTTGATGTTGCAGGTCCAGGTGGATGGAATGACCCTGATATGCTTGTCATA GGGAACTTTGGGCTATCATGGGACCAACAAGTTACACAAATGGCTTTGTGGGCGATCAT GGCCGCACCCCTATTCATGTCTAATGATCTACGTCACATATCACCCCAAGCAAAGGCTTT ACTTCAAGATAAGGATGTCATAGCGATCAACCAAGATCCTCTTGGTAAACAAGGTTATCA ATTGAGAAAAGGTGACAACTTTGAAGTGTGGGAAAGACCATTGTCTGGAGATGCGTGGG CTGTTGCTATTATCAACCGTCAAGAGATCGGAGGGCCAAGATCTTACACTATCCCGGTAG CCTCTTTGGGTAAGGGTGTTGCGTGCAATCCTGCCTGCTTCATTACACAATTGCTTCCAGT TAAGAGACAATTGGGTTTCTATAACTGGACCTCTAGGCTAAAAAGTCACATTAATCCTAC TGGTACGGTATTGTTGCAATTGGAGAACACAATGCAAATGTCTTTGAAAGATTTGTTA Polypeptide sequence of Variant No. 395: (SEQ ID NO: 40) LDNGLARTPTMGWLHWERFMCNLDCQEEPDSCISEKLFMEMAERMVSEGWKDAGYEYLCI DDCWMAPQRDSEGRLQADPQRFPHGIRQLANHVHSKGLKLGIYADVGNKTCAGFPGSFGYY DIDAQTFADWGVDLLKFDGCYCDSLENLADGYKHMSLALNRTGRSIVYSCEWPLYMWPFQ KPNYTEIRQYCNHWRNFADIDDSWASIKSILDWTSRNQERIVDVAGPGGWNDPDMLVIGNF GLSWDQQVTQMALWAIMAAPLFMSNDLRHISPQAKALLQDKDVIAINQDPLGKQGYQLRK GDNFEVWERPLSGDAWAVAIINRQEIGGPRSYTIPVASLGKGVACNPACFITQLLPVKRQLGF YNVVTSRLKSHINPTGTVLLQLENTMQMSLKDLL Polynucleotide sequence of Variant No. 402 yCDS: (SEQ ID NO: 41) TTGGATAACGGGTTAGCCCGTACACCTACTATGGGTTGGCTTCACTGGGAAAGATTCATG TGTAACTTAGATTGCCAAGAAGAGCCTGACAGCTGTATCTCAGAGAAACTATTCATGGA GATGGCTGAACGGATGGTAAGTGAAGGATGGAAGGATGCTGGTTATGAATACCTATGTA TTGATGATTGCTGGATGGCTCCACAGCGTGATTCAGAAGGTAGGTTACAAGCTGACCCCC AGAGATTCCCACATGGCATACGTCAGCTTGCAAACTACGTACACAGCAAAGGTCTAAAG TTAGGCATCTACGCTGATGTCGGAAACAAGACATGTGCTGGTTTCCCAGGTTCATTCGGT TACTATGACATAGATGCGCAGACGTTTGCTGATTGGGGTGTTGATTTGTTGAAGTTTGAT GGATGCTACTGCGATTCCCTGGAGAACCTAGCCGATGGGTACAAACACATGAGTTTGGCT CTAAACAGGACTGGTAGGCCGATCGTCTATAGTTGTGAATGGCCCTTGTACATGTGGCCG TTTCAGAAGCCAAACTACACTGAGATAAGACAATACTGTAACCATTGGCGTAACTTTGCT GACATAGATGATTCATGGGCTTCAATCAAATCTATCTTGGATTGGACTTCTCGTAACCAG GAAAGAATTGTTGATGTTGCAGGTCCAGGTGGATGGAATGACCCTGATATGCTTGTCATA GGGAACTTTGGGCTATCATGGGACCAACAAGTTACACAAATGGCTTTGTGGGCGATCAT GGCCGCACCCCTATTCATGTCTAATGATCTACGTCACATATCACCCCAAGCAAAGGCTTT ACTTCAAGATAAGGATGTCATAGCGATCAACCAAGATCCTCTTGGTAAACAAGGTTATCA ATTGAGAAAAGGTGACAACTTTGAAGTGTGGGAAAGACCATTGTCTGGAGATGCGTGGG CTGTTGCTATTATCAACCGTCAAGAGATCGGAGGGCCAAGATCTTACACTATCCCGGTAG CCTCTTTGGGTAAGGGTGTTGCGTGCAATCCTGCCTGCTTCATTACACAATTGCTTCCAGT TAAGAGACAATTGGGTTTCTATAACTGGACCTCTAGGCTAAAAAGTCACATTAATCCTAC TGGTACGGTATTGTTGCAATTGGAGAACACAATGCAAATGTCTTTGAAAGATTTGTTA Polypeptide sequence of Variant No. 402: (SEQ ID NO: 42) LDNGLARTPTMGWLHWERFMCNLDCQEEPDSCISEKLFMEMAERMVSEGWKDAGYEYLCI DDCWMAPQRDSEGRLQADPQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYY DIDAQTFADWGVDLLKFDGCYCDSLENLADGYKHMSLALNRTGRPIVYSCEWPLYMWPFQ KPNYTEIRQYCNHWRNFADIDDSWASIKSILDWTSRNQERIVDVAGPGGWNDPDMLVIGNF GLSWDQQVTQMALWAIMAAPLFMSNDLRHISPQAKALLQDKDVIAINQDPLGKQGYQLRK GDNFEVWERPLSGDAWAVAIINRQEIGGPRSYTIPVASLGKGVACNPACFITQLLPVKRQLGF YNVVTSRLKSHINPTGTVLLQLENTMQMSLKDLL Polynucleotide sequence of Variant No. 625 yCDS: (SEQ ID NO: 43) TTGGATAACGGGTTAGCCCGTACACCTACTATGGGTTGGCTTCACTGGGAAAGATTCATG TGTAACTTAGATTGCCAAGAAGAGCCTGACAGCTGTATCTCAGAGAAACTATTCATGGA GATGGCTGAACGGATGGTAACCGAAGGATGGAAGGATGCTGGTTATGAATACCTATGTA TTGATGATTGCTGGATGGCTCCACAGCGTGATTCAGAAGGTAGGTTACAAGCTGACCCCC AGAGATTCCCACATGGCATACGTCAGCTTGCAAACCATGTACACAGCAAAGGTCTAAAG TTAGGCATCTACGCTGATGTCGGAAACAAGACATGTGCTGGTTTCCCAGGTTCATTCGGT TACTATGACATAGATGCGCAGACGTTTGCTGATTGGGGTGTTGATTTGTTGAAGTTTGAT GGATGCTACTGCGATTCCCTGGAGAACCTAGCCGATGGGTACAAACACATGAGTTTGGCT CTAAACAGGACTGGTAGGCCGATCGTCTATAGTTGTGAATGGCCCTTGTACATGTGGCCG TTTCAGAAGCCAAACTACACTGAGATAAGACAATACTGTAACCATTGGCGTAACTTTGCT GACATAGATGATTCATGGGCTTCAATCAAATCTATCTTGGATTGGACTTCTCGTAACCAG GAAAGAATTGTTGATGTTGCAGGTCCAGGTGGATGGAATGACCCTGATATGCTTGTCATA GGGAACTTTGGGCTATCATGGGACCAACAAGTTACACAAATGGCTTTGTGGGCGATCAT GGCCGCACCCCTATTCATGTCTAATGATCTACGTGCGATATCACCCCAAGCAAAGGCTTT ACTTCAAGATAAGGATGTCATAGCGATCAACCAAGATCCTCTTGGTAAACAAGGTTATCA ATTGAGAAAAGGTGACAACTTTGAAGTGTGGGAAAGACCATTGTCTGGAGATGCGTGGG CTGTTGCTATTATCAACCGTCAAGAGATCGGAGGGCCAAGATCTTACACTATCCCGGTAG CCTCTTTGGGTAAGGGTGTTGCGTGCAATCCTGCCTGCTTCATTACACAATTGCTTCCAGT TAAGAGACAATTGGGTTTCTATAACTGGACCTCTAGGCTAAAAAGTCACATTAATCCTAC TGGTACGGTATTGTTGCAATTGGAGAACACAATGCAAACCTCTTTGAAAGATTTGTTA Polypeptide sequence of Variant No. 625: (SEQ ID NO: 44) LDNGLARTPTMGWLHWERFMCNLDCQEEPDSCISEKLFMEMAERMVTEGWKDAGYEYLCI DDCWMAPQRDSEGRLQADPQRFPHGIRQLANHVHSKGLKLGIYADVGNKTCAGFPGSFGYY DIDAQTFADWGVDLLKFDGCYCDSLENLADGYKHMSLALNRTGRPIVYSCEWPLYMWPFQ KPNYTEIRQYCNHWRNFADIDDSWASIKSILDWTSRNQERIVDVAGPGGWNDPDMLVIGNF GLSWDQQVTQMALWAIMAAPLFMSNDLRAISPQAKALLQDKDVIAINQDPLGKQGYQLRK GDNFEVWERPLSGDAWAVAIINRQEIGGPRSYTIPVASLGKGVACNPACFITQLLPVKRQLGF YNVVTSRLKSHINPTGTVLLQLENTMQTSLKDLL Polynucleotide sequence of Variant No. 648 yCDS: (SEQ ID NO: 45) TTGGATAACGGGTTAGCCCGTACACCTCCGATGGGTTGGCTTCACTGGGAAAGATTCATG TGTAACTTAGATTGCCAAGAAGAGCCTGACAGCTGTATCTCAGAGAAACTATTCGAAGA GATGGCTGAACGGATGGTAACCGAAGGATGGAAGGATGCTGGTTATGAATACCTATGTA TTGATGATTGCTGGATGGCTCCACAGCGTGATTCAGAAGGTAGGTTACAAGCTGACCCCC AGAGATTCCCACATGGCATACGTCAGCTTGCAAACCATGTACACAGCAAAGGTCTAAAG TTAGGCATCTACGCTGATGTCGGAAACAAGACATGTGCTGGTTTCCCAGGTTCATTCGGT TACTATGACATAGATGCGCAGACGTTTGCTGATTGGGGTGTTGATTTGTTGAAGTTTGAT GGATGCTACTGCGATTCCCTGGAGAACCTAGCCGATGGGTACAAACACATGAGTTTGGCT CTAAACAGGACTGGTAGGCCGATCGTCTATAGTTGTGAATGGCCCTTGTACATGTGGCCG TTTCAGAAGCCAAACTACACTGAGATAAGACAATACTGTAACCATTGGCGTAACTTTGCT GACATAGATGATTCATGGGCTTCAATCAAATCTATCTTGGATTGGACTTCTCGTAACCAG GAAAGAATTGTTGATGTTGCAGGTCCAGGTGGATGGAATGACCCTGATATGCTTGTCATA GGGAACTTTGGGCTATCATGGGACCAACAAGTTACACAAATGGCTTTGTGGGCGATCAT GGCCGGCCCCCTATTCATGTCTAATGATCTACGTGCGATATCACCCCAAGCAAAGGCTTT ACTTCAAGATAAGGATGTCATAGCGATCAACCAAGATCCTCTTGGTAAACAAGGTTATCA ATTGAGAAAAGGTGACAACTTTGAAGTGTGGGAAAGACCATTGTCTGGAGATGCGTGGG CTGTTGCTATTATCAACCGTCAAGAGATCGGAGGGCCAAGATCTTACACTATCCCGGTAG CCTCTTTGGGTAAGGGTGTTGCGTGCAATCCTGCCTGCTTCATTACACAATTGCTTCCAGT TAAGAGACAATTGGGTTTCTATAACGCAACCTCTAGGCTAAAAAGTCACATTAATCCTAC TGGTACGGTATTGTTGCAATTGGAGAACACAATGCAAACCTCTTTGAAAGATTTGTTA Polypeptide sequence of Variant No. 648: (SEQ ID NO: 46) LDNGLARTPPMGWLHWERFMCNLDCQEEPDSCISEKLFEEMAERMVTEGWKDAGYEYLCI DDCWMAPQRDSEGRLQADPQRFPHGIRQLANHVHSKGLKLGIYADVGNKTCAGFPGSFGYY DIDAQTFADWGVDLLKFDGCYCDSLENLADGYKHMSLALNRTGRPIVYSCEWPLYMWPFQ KPNYTEIRQYCNHWRNFADIDDSWASIKSILDWTSRNQERIVDVAGPGGWNDPDMLVIGNF GLSWDQQVTQMALWAIMAGPLFMSNDLRAISPQAKALLQDKDVIAINQDPLGKQGYQLRK GDNFEVWERPLSGDAWAVAIINRQEIGGPRSYTIPVASLGKGVACNPACFITQLLPVKRQLGF YNATSRLKSHINPTGTVLLQLENTMQTSLKDLL

Example 1

GLA Gene Acquisition and Construction of Expression Vectors

(133) A synthetic gene coding for a WT human GLA was designed for optimized gene expression in Saccharomyces cerevisiae (SEQ ID NO:3), assembled, and subcloned into the E. coli expression vector pCK100900i (SEQ ID NO:6).

(134) A chimeric GLA expression construct encoding a 19 amino acid S. cerevisae MFalpha signal peptide fused to the mature form of yeast-optimized GLA was generated in a yeast expression vector designed for secreted expression, as follows. A fragment coding for the MFalpha signal peptide (SEQ ID NO:25) was amplified by PCR using the oligonucleotides MM0435 (SEQ ID NO:27) and MM0439 (SEQ ID NO:28) from S288C genomic DNA, and a fragment coding for a synthetic GLA (SEQ ID NO:3) was amplified using primers MM0514 (SEQ ID NO:29) and MM0481 (SEQ ID NO:30). Additional sequence at the 5′ ends of these oligonucleotides provide homology for yeast recombination cloning when cotransformed with linearized plasmid pYT-72Bgl (SEQ ID NO:7). In the resulting vector, the expression of fusion protein SP-GLA (SEQ ID NO:36) is driven by the ADH2 promoter. A fusion construct encoding a fusion of an 83 amino acid MFalpha leader peptide (SEQ ID NO:38) N-terminally fused to GLA (SEQ ID NO:37) was cloned using the same techniques. Recombination cloning and gene expression were performed in S. cerevisiae strain INVSc1. Directed evolution techniques generally known by those skilled in the art were used to generate libraries of gene variants from this plasmid construct (See e.g., U.S. Pat. No. 8,383,346 and WO2010/144103).

(135) A chimeric GLA expression construct encoding a synthetic signal peptide fused to a synthetic gene coding for the mature human GLA coding sequence for secreted expression in transient transfections was generated as follows. Oligonucleotides PLEV113Fw (SEQ ID NO:32) and SPGLARv (SEQ ID NO:33) were used to amplify a fragment coding for a synthetic signal peptide (SEQ ID NO:31) using PCR. A second fragment coding for the native human coding sequence for the mature form of GLA (SEQ ID NO:4) was amplified using oligonucleotides SPGLAFw (SEQ ID NO:34) and GLARv (SEQ ID NO:35). Splicing by Overlap Extension PCR was used to recombine these fragments, and the resulting chimeric fragment was ligated into the HindIII/Not I linearized mammalian expression vector pLEV113. Directed evolution techniques generally known by those skilled in the art were used to generate specific gene variants from this plasmid construct.

Example 2

High-Throughput Growth and Assays

(136) High-Throughput (HTP) Growth of GLA and GLA Variants

(137) Yeast (INVSc1) cells transformed with vectors expressing GLA and GLA variants using the lithium acetate method were selected on SD-Ura agar plates. After 72 h incubation at 30° C. colonies were placed into the wells of Axygen® 1.1 ml 96-well deep well plates filled with 200 μl/well SD-Ura broth (2 g/L SD-Ura, 6.8 g/L yeast nitrogen base without amino acids [Sigma Aldrich]), 3.06 g/L sodium dihydrogen phosphate, 0.804 g/L disodium hydrogen phosphate, pH 6.0 supplemented with 6% glucose. The cells were allowed to grow for 20-24 hours in a Kuhner shaker (250 rpm, 30° C., and 85% relative humidity). Overnight culture samples (20 μL) were transferred into Corning Costar® 96-well deep plates filled with 380 μL of SD-ura broth supplemented with 2% glucose. The plates were incubated for 66-84 h in a Kuhner shaker (250 rpm, 30° C., and 85% relative humidity). The cells were then pelleted (4000 rpm×20 min), and the supernatants isolated and stored at 4° C. prior to analysis.

(138) HTP-Analysis of Supernatants

(139) GLA variant activity was determined by measuring the hydrolysis of 4-methylumbelliferyl α-D-galactopyranoside (MUGal). For this assay, 5-50 μL of yeast culture supernatant produced as described above, was mixed with 0-45 μL of McIlvaine Buffer (McIlvaine, J. Biol. Chem., 49:183-186 [1921]), pH 4.8 and 50 μL of 2 mM MUGal in 50 mM citrate, 200 mM KCl, pH 4.6 in a 96-well, black, opaque bottom plate. The reactions were mixed briefly and incubated at 37° C. for 30-180 minutes, prior to quenching with 100 μL of 1 M sodium carbonate. Hydrolysis was analyzed using a SpectraMax® M2 microplate reader monitoring fluorescence (Ex. 355 nm, Em. 448 nm).

(140) HTP-Analysis of Supernatants Pretreated with Acid

(141) GLA variants were challenged with acidic buffer to simulate the extreme pHs that the variants may encounter in lysosomes. First, 50 μL of yeast culture supernatant and 50 uL of McIlvaine buffer (pH 3.3-4.3) were added to the wells of a 96-well round bottom plate. The plates were sealed with a PlateLoc Thermal Microplate Sealer (Agilent) and incubated at 37° C. for 1-3 h. For the assay, 10-50 μL of acid-pH-challenged sample was mixed with 0-40 μL of McIlvaine buffer pH 4.8, 25 μL of 1 M citrate buffer pH 4.3 and 25 μL of 4 mM MUGal in McIlvaine buffer pH 4.8. The reactions were mixed briefly and incubated at 37° C. for 30-180 minutes, prior to quenching with 100 μL of 1 M sodium carbonate. Hydrolysis was analyzed using a SpectraMax® M2 microplate reader monitoring fluorescence (Ex. 355 nm, Em. 448 nm).

(142) HTP-Analysis of Supernatants Pretreated with Base

(143) GLA variants were challenged with basic (neutral) buffer to simulate the pHs that the variants encounter in the blood following their administration to a patient. First, 50 μL of yeast culture supernatant and 50 uL of McIlvaine buffer (pH 7.0-8.2) or 200 mM sodium bicarbonate (pH 9.1-9.7) were added to the wells of a 96-well round bottom plate. The plates were sealed and incubated at 37° C. for 1-18 h. For the assay, 10-50 μL of basic-pH-challenged sample was mixed with 0-40 μL of McIlvaine buffer pH 4.8, 25 μL of 1 M citrate buffer pH 4.3 and 25 μL of 4 mM MUGal in McIlvaine buffer pH 4.8. The reactions were mixed briefly and incubated at 37° C. for 30-180 minutes, prior to quenching with 100 μL of 1 M sodium carbonate. Hydrolysis was analyzed using a SpectraMax® M2 microplate reader monitoring fluorescence (Ex. 355 nm, Em. 448 nm).

(144) HTP-Analysis of Supernatants Pretreated with Bovine Serum

(145) GLA variants were challenged with bovine serum to simulate the conditions the variants encounter following infusion into a patient. First, 20 μL of yeast culture supernatant and 80 μL of bovine serum were added to the wells of a 96-well round bottom plate. The plates were sealed and incubated at 37° C. for 1 h. For the assay, 50 μL of serum-challenged sample was mixed with 25 μL of 1 M citrate buffer pH 4.3 and 25 μL of 4 mM MUGal in McIlvaine buffer pH 4.8. The reactions were mixed briefly and incubated at 37° C. for 180 minutes, prior to quenching with 100 μL of 1 M sodium carbonate. Hydrolysis was analyzed using a SpectraMax® M2 microplate reader monitoring fluorescence (Ex. 355 nm, Em. 448 nm).

(146) TABLE-US-00002 TABLE 2.1 Relative Activity of GLA Variants After No Challenge (NC) or Challenge at the Indicated pH.sup.1,2 Variant pH pH SEQ ID # NC 4.3 7.0 Amino Acid Differences Relative to SEQ ID NO: 5 NO: 1 + + + A337S 47 2 + + + E43D 48 3 + + + E43D/E48D 49 4 + +++ + E43D/E48D/I208V/N247D/Q299R/Q302K/R373K/I376V 50 5 ++ ++ ++ E43D/E48D/I208V/R373K 51 6 + +++ + E43D/E48D/I208V/R373K/I376V 52 7 + ++ + E43D/E48D/N247D/Q299R/Q302K/R373K/I376V 53 8 ++ +++ +++ E43D/E48D/N247D/Q302K/R373K 54 9 + +++ + E43D/E48D/Q302K/R373K/I376V 55 10 ++ +++ ++ E43D/I208V/N247D 56 11 + +++ ++ E43D/I208V/N247D/Q299R/R373K/I376V 57 12 + ++ + E43D/I208V/Q299R/R373K/I376V 58 13 ++ +++ ++ E43D/N247D/R373K/I376V 59 14 + +++ ++ E43D/R373K/I376V 60 15 + + + E48D/I208V/Q299R/Q302K/R373K 61 16 + ++ + E48D/R373K/I376V 62 17 + + + E48G/R373K 63 18 + + ++ F217S 64 19 + ++ + I208V/N247D/Q299R/Q302K/R373K/I376V 65 20 + +++ ++ I208V/N247D/Q299R/R373K/I376V 66 21 + +++ ++ I208V/N247D/R373K/I376V 67 22 + + + I208V/Q299R/I376V 68 23 + +++ ++ I208V/Q302K/R373K/I376V 69 24 + ++ + I376V 70 25 + + + K36Q 71 26 + + + P179S/R373K 72 27 + + + Q299R/M322V/R373K 73 28 + + + Q299R/Q302K/R373K 74 29 + + + Q299R/Q302K/R373K/I376V 75 30 + ++ + Q302K/I376V 76 31 + + + R373K 77 32 + ++ + R373K/I376V 78 .sup.1Relative activity was calculated as activity of the variant/activity of WT GLA (SEQ ID NO: 5 (encoded by SEQ ID NO: 3). .sup.2+ = 0.5 to 1.5 relative activity over WT GLA (SEQ ID NO: 5); ++ = >1.5 to 2.5 relative activity over WT GLA (SEQ ID NO: 5); and +++ = >2.5 relative activity over WT GLA (SEQ ID NO: 5).

(147) TABLE-US-00003 TABLE 2.2 Relative Activity of GLA Variants After No Challenge (NC) or Challenge at the Indicated pH.sup.1,2,3 Variant pH pH SEQ ID # NC 4.2 7.1 Amino Acid Differences Relative to SEQ ID NO: 5 NO: 33 + + + A199H/E367S 79 34 + ++ ++ A337P 80 35 ++ ++ ++ A339S 81 36 + ++ ++ A350G 82 37 + + + D105A 83 38 − + − D105S 84 39 + ++ ++ D124N/E147G/N161K/R162Q/T163V/R165A/I167S/ 85 V168I/Y169V/S170—/M177S/F217E 40 ++ ++ ++ D396R 86 41 + + + D396T 87 42 +++ +++ +++ E367N 88 43 + + + E367T 89 44 + ++ + E387K 90 45 ++ ++ ++ E387Q 91 46 + +++ + E387R 92 47 + ++ + E387T 93 48 + + + E40D 94 49 + + + F180R 95 50 ++ ++ ++ F180S 96 51 ++ ++ + F198S 97 52 ++ + ++ F217D 98 53 + ++ ++ F217R 99 54 + + + F352I 100 55 ++ +++ ++ F352V/F365I 101 56 ++ ++ ++ F365I 102 57 ++ ++ ++ F365K 103 58 ++ ++ ++ F365L 104 59 + + + F365R 105 60 + + + F365T 106 61 ++ ++ ++ F365V 107 62 ++ + ++ G303Q/R373V 108 63 + + ++ H155A 109 64 + + ++ H155L 110 65 + + + H155R 111 66 + + + H155T 112 67 ++ + ++ H375E 113 68 + ++ + H84S 114 69 + + + I102L 115 70 + + + I102L/L394V 116 71 ++ + ++ I123T/T369N 117 72 + + + I167V 118 73 + +++ ++ K206A 10 74 + +++ ++ K206M 119 75 + +++ ++ K206Q 120 76 + +++ ++ K206R 24 77 + ++ + K206T/V359S 121 78 ++ ++ ++ K343D 122 79 ++ ++ ++ K343G 123 80 + + + K362Q 124 81 + + + K362R 125 82 + + + K36D 126 83 + ++ + K36E 127 84 ++ ++ ++ K395* 128 85 + + + K395G 129 86 ++ ++ ++ K395P 130 87 + ++ + K395R 131 88 + ++ + K395S 132 89 ++ + + K395T 133 90 + + + K96I 134 91 + + ++ K96L 135 92 + + + K96R 136 93 ++ +++ + K96R/L397V 137 94 + + + L100F 138 95 + + + L158A 139 96 + + + L158I 140 97 + + + L158M 141 98 + + + L158R 142 99 + + + L23M 143 100 + + + L23T 144 101 +++ +++ +++ L316D 145 102 +++ +++ +++ L316E 146 103 ++ ++ ++ L384F 147 104 ++ ++ ++ L386V 148 105 +++ ++ ++ L394A 149 106 ++ ++ +++ L394R 150 107 +++ +++ +++ L394S 151 108 +++ +++ +++ L394T 152 109 ++ ++ +++ L397* 153 110 +++ ++ +++ L397D 154 111 ++ ++ ++ L397H 155 112 + ++ + L397I 156 113 ++ + +++ L397Q 157 114 ++ ++ ++ L397R 158 115 ++ ++ +++ L397T 159 116 ++ ++ ++ L398E 160 117 ++ ++ ++ L398G 161 118 ++ ++ ++ L398N 162 119 ++ ++ ++ L398Q 163 120 ++ ++ ++ L398R 164 121 + ++ ++ L44R/L384F 165 122 ++ ++ ++ L44T 166 123 − + − M20D/Q302K 167 124 ++ ++ + M253F 168 125 + + + M322I 169 126 +++ +++ +++ M390D 170 127 ++ ++ ++ M390R 171 128 + + + M390T 172 129 + ++ ++ M392G 173 130 + ++ + M392P 174 131 ++ + ++ M392S 175 132 + + + M39Y 176 133 + + + N388R 177 134 + + + N91Q 178 135 ++ +++ ++ Q190S/T369D 179 136 + + + Q249A 180 137 + + + Q302A 181 138 ++ ++ ++ Q385H 182 139 + + + Q385I 183 140 ++ ++ ++ Q385L 184 141 + + + Q391G 185 142 + + + Q80A 186 143 + + + Q80H 187 144 + ++ + Q80V 188 145 + + + Q88A 189 146 + + + Q88F 190 147 ++ ++ ++ Q88H 191 148 + ++ + Q88R 192 149 ++ + ++ Q88S 193 150 + + + R162H 194 151 + + + R162S 195 152 ++ ++ ++ R221K/A350G 196 153 + + ++ R221T 197 154 ++ + ++ R301I/K362T 198 155 + + + R301L 199 156 ++ + ++ R371S 200 157 ++ + ++ R371V 201 158 ++ + ++ R87K 202 159 + + + R87P/L398R 203 160 + ++ + S166A 204 161 + + + S166H 205 162 + + + S166K 206 163 + + + S31D 207 164 + − − S34D/M392P 208 165 + − − S34G 209 166 ++ + + S34H/M390R 210 167 + + + S34R 211 168 ++ ++ ++ S374M 212 169 ++ ++ ++ S374T 213 170 ++ ++ ++ S393E 214 171 ++ ++ ++ S393G 215 172 + + + S393H 216 173 ++ ++ ++ S393P 217 174 + + + S47I 218 175 + ++ + S47R 219 176 + + + S47T 220 177 + ++ + S95D 221 178 ++ +++ ++ S95E 222 179 + + + S95Q 223 180 ++ ++ +++ T369D 224 181 + + + T369S 225 182 ++ + + T389S 226 183 + + + V133I 227 184 ++ + + V168A 228 185 + ++ + V168L 229 186 ++ ++ +++ V345N 230 187 + + + V345Y 231 188 + + + V359E 232 189 + + + V93I 233 190 ++ + ++ W178H 234 191 + ++ + W178S 235 .sup.1Relative activity was calculated as activity of the variant/activity of WT GLA (SEQ ID NO: 5 (encoded by SEQ ID NO: 3). .sup.2Variant # 73 (Rd2BB) has the polynucleotide sequence of SEQ ID NO: 8 and polypeptide sequence of SEQ ID NO: 10. .sup.3− = <0.5 relative activity to WT GLA (SEQ ID NO: 5); + = 0.5 to 1.5 relative activity over WT GLA (SEQ ID NO: 5); ++ = >1.5 to 2.5 relative activity over WT GLA (SEQ ID NO: 5); and +++ = >2.5 relative activity over WT GLA (SEQ ID NO: 5).

(148) TABLE-US-00004 TABLE 2.3 Relative Activity of GLA Variants After No Challenge (NC) or Challenge at the Indicated pH Variant pH pH Amino Acid Differences SEQ # NC 4.2 7.6 Relative to SEQ ID NO: 10 ID NO: 192 + + + A206E 236 193 + + + A206G 237 194 ++ ++ ++ A206R 238 195 + + + A206S 239 196 + + + A350G 240 197 ++ ++ ++ A350G/K362Q/T369A 241 198 ++ ++ +++ A350G/T369D 242 199 ++ ++ ++ A350G/T369S 243 200 + + + C143A 244 201 + + + C143T 245 202 + + + C59A 246 203 ++ ++ +++ E367A/T369D 247 204 + + + E367D 248 205 ++ ++ ++ E367D/T369D 21 206 +++ +++ +++ E367N 18 207 ++ +++ +++ E367N/R373K 249 208 ++ +++ +++ E367N/R373K/I376V 250 209 + + + E367P/T369D 251 210 ++ ++ ++ F365L/E367N 252 211 ++ ++ ++ F365L/E367N/I376V 253 212 ++ ++ ++ F365L/E367N/R373K/I376V 254 213 + − − H15Q/ 255 214 +++ +++ +++ K343D/F365L/E367N 256 215 + + + K343G 257 216 ++ +++ +++ K343G/F365L/E367N/R373K 258 217 ++ ++ ++ L316D 259 218 +++ +++ +++ M322I/E367N/R373K 13 219 + + + M322I/R373K 260 220 + + ++ M322V/R373K/I376V 261 221 + + + M390I 262 222 ++ ++ + P228Q/T369D 263 223 + ++ ++ Q302K/A337P/A350G/K362Q 264 224 ++ +++ +++ Q302K/M322V/E367N 265 225 + + + R165S 266 226 + + ++ R221T/F365L 267 227 − − − R325H 268 228 + + + R373K 269 229 + − + R373K/I376V 270 230 + − + S374R 271 231 ++ ++ ++ T369D 272 232 ++ ++ ++ T369S 273 1. Relative activity was calculated as activity of the variant/activity of Rd2BB (SEQ ID NO: 10) 2. Variant # 218 (Rd3BB) has the polynucleotide sequence of SEQ ID NO: 11 and polypeptide sequence of SEQ ID NO: 13. 3. − = <0.5 relative activity to Rd2BB (SEQ ID NO: 10); + = 0.5 to 1.5 relative activity over Rd2BB (SEQ ID NO: 10); ++ = >1.5 to 2.5 relative activity over Rd2BB (SEQ ID NO: 10); and +++ = >2.5 relative activity over Rd2BB (SEQ ID NO: 10).

(149) TABLE-US-00005 TABLE 2.4 Relative Activity of GLA Variants After No Challenge (NC) or Challenge at the Indicated pH or Condition.sup.1,2 Variant pH pH Amino Acid Differences Relative to SEQ ID NO: 5 SEQ ID # NC 4.2 7.6 Serum (WT GLA) NO: 233 +++ +++ +++ +++ K206A/F217R/N247D/L316D/A350G/E367D/T369D 274 234 +++ +++ +++ +++ K206A/F217R/N247D/Q302K/A350G/E367D/T369D 275 235 +++ +++ +++ +++ K206A/F217R/N247D/Q302K/L316D/A337P/A350G/ 276 E367D/T369D 236 +++ ++ +++ ++ K206A/F217R/Q302K/E367D/T369D 277 237 +++ +++ +++ +++ K206A/F217R/Q302K/L316D/A337P/A350G/E367D/ 278 T369D 238 ++ +++ +++ ++ K206A/I208V/M322V/K343G/F365L/R373K/I376V 279 239 +++ +++ +++ ++ K206A/I208V/R221K/N247D/M322I/K343D/F365L/ 280 R373K/I376V 240 − + + + K206A/L269I/P349L/R373K 281 241 ++ +++ +++ ++ K206A/N247D/M322V/K343D/R373K/I376V 282 242 +++ +++ +++ +++ K206A/N247D/M322V/K343G/F365L/R373K 283 243 +++ +++ +++ +++ K206A/N247D/Q302K/A337P/K343G/A350G 284 244 +++ +++ +++ +++ K206A/N247D/Q302K/L316D/A350G 285 245 ++ +++ +++ ++ K206A/N247D/Q302K/M322V/F365L/R373K/I376V 286 246 +++ +++ +++ +++ K206A/Q302K/L316D/A337P 287 247 +++ +++ +++ +++ K206A/R221K/N247D/M322V/K343D/R373K 288 248 + + + + K206A/R221T/M322V/K343G/R373K 289 249 ++ ++ +++ ++ K206A/R221T/M322V/R373K 290 250 + + + + K96I/K206A/F217R 291 251 ++ + ++ + K96I/K206A/F217R/N247D 292 252 +++ +++ +++ +++ K96I/K206A/F217R/N247D/A350G/E367D/T369D 293 253 +++ +++ +++ +++ K961/K206A/F217R/N247D/Q302K/L316D/A337P/ 294 E367D/T369D 254 + + + + L100F/K206A 295 255 +++ +++ +++ ++ L100F/K206A/I208V/R221K/N247D/Q302K/M322I/ 296 K343D/F365L/I376V 256 ++ +++ +++ +++ L100F/K206A/I208V/R221K/N247D/Q302K/M322V/ 297 K343D/F365L/I376V 257 ++ ++ ++ ++ L100F/K206A/I208V/R221T/N247D/K343D/F365L/ 298 I376V 258 +++ ++ +++ ++ L100F/K206A/I208V/R221T/Q302K/M322I/K343D/ 299 I376V 259 + + + + L100F/K206A/M322V/F365L/R373K/I376V 300 260 + + + + L100F/K206A/N247D/F365L/R373K/I376V 301 261 ++ ++ ++ + L100F/K206A/N247D/M322V/K343D/I376V 302 262 ++ +++ +++ +++ L100F/K206A/R221K/N247D/Q302K/M322V/F365L/ 303 R373K/I376V 263 + ++ ++ +++ L100F/K206A/R221K/N247D/Q302K/M322V/I376V 304 264 ++ ++ +++ ++ L100F/K206A/R221K/N247D/Q302K/M322V/K343D/ 305 R373K/I376V 265 + + + + L100F/K206A/R221K/R373K/I376V 306 266 ++ ++ +++ ++ L100F/K206A/R221T/M322I/K343E/F365L/R373K 307 267 +++ +++ +++ +++ L100F/K206A/R221T/N247D/Q302K/K343D/F365L/ 308 R373K 268 + + + + L100F/K206A/R373K/I376V 309 269 − + + + L37I/K206A/R221K/N247D/M322I/R373K 310 270 + + + + L44R/C143Y/K206A/A337P/A350G 311 271 − + + + L44R/E187G/K206A/A337P/A350G 312 272 + + + + L44R/K206A 313 273 + + + + L44R/K206A/E367D/T369D 314 274 + + + + L44R/K206A/F217R/A350G 315 275 ++ ++ ++ ++ L44R/K206A/F217R/N247D/A337P 316 276 +++ +++ +++ +++ L44R/K206A/F217R/N247D/L316D/A337P/A350G/ 317 E367D/T369D 277 +++ +++ +++ +++ L44R/K206A/F217R/N247D/L316D/A337P/E367D/ 318 T369D 278 +++ +++ +++ +++ L44R/K206A/F217R/N247D/L316D/A350G/E367D/ 319 T369D 279 ++ +++ +++ +++ L44R/K206A/F217R/N247D/Q302K/A350G 320 280 + + + + L44R/K206A/F217R/Q302K/E367D/T369D 321 281 + + + + L44R/K206A/I208V/R221K/M322V/K343D/F365L/ 322 R373K 282 + + + + L44R/K206A/N247D/A337P 323 283 +++ +++ +++ +++ L44R/K206A/N247D/Q302K/A337P/A350G/E367D/ 324 T369D 284 +++ +++ +++ +++ L44R/K206A/R221T/N247D/M322I/K343D/F365L/ 325 I376V 285 + + ++ + L44R/K96I/K206A 326 286 + + ++ + L44R/K96I/K206A/F217R/N247D 327 287 +++ +++ +++ ++ L44R/K96I/K206A/F217R/N247D/Q302K/A337P/ 328 A350G 288 +++ +++ +++ +++ L44R/K96I/K206A/F217R/N247D/Q302K/A337P/ 329 K343D/A350G/E367D/T369D 289 + ++ ++ ++ L44R/K96I/K206A/F217R/Q302K/A350G 330 290 +++ +++ +++ +++ L44R/K96I/K206A/N247D/L316D/A337P/A350G/ 331 E367D/T369D 291 + + + + L44R/L100F/K206A/F365L 332 292 +++ ++ +++ ++ L44R/L100F/K206A/I208V/Q219H/N247D/Q302K/ 333 M322V/K343D/R373K/I376V 293 ++ + ++ + L44R/L100F/K206A/I208V/R221K/N247D/Q302K/ 334 M322V/F365L/I376V 294 ++ ++ +++ + L44R/L100F/K206A/I208V/R221T/N247D/M322V/ 335 I376V 295 +++ +++ +++ +++ L44R/L100F/K206A/I208V/R221T/N247D/Q302K/ 336 M322I/K343D/F365L/R373K/I376V .sup.1Relative activity was calculated as activity of the variant/activity of Rd2BB (SEQ ID NO: 10 (encoded by SEQ ID NO: 8). .sup.2− = <0.5 relative activity to Rd2BB (SEQ ID NO: 10); + = 0.5 to 1.5 relative activity over Rd2BB (SEQ ID NO: 10); ++ = >1.5 to 2.5 relative activity over Rd2BB (SEQ ID NO: 10); and +++ = >2.5 relative activity over Rd2BB (SEQ ID NO: 10).

(150) TABLE-US-00006 TABLE 2.5 Relative Activity of GLA Variants After No Challenge (NC) or Challenge at the Indicated pH or Condition .sup.1, 2, 3 Variant pH pH Amino Acid Differences Relative to SEQ ID NO: 5 SEQ # NC 4.0 8.2 Serum (WT GLA) ID NO: 296 + − − + A66T/K206A/F2I7R/L316D/M322I/A337P/K343G/ 337 A350G/E367N/R373K 297 − − − − K206A/F217R/G230V/N247D/Q302K/M322I/E367N/ 338 T369S/R373K 298 ++ +++ +++ +++ K206A/F217R/N247D/L316D/M322I/A337P/A350G/ 339 K362Q/E367N/R373K 299 + − − − K206A/F217R/N247D/Q249H/Q302K/M322I/K343G/ 340 A350G/E367T/R373K/L397F 300 + ++ ++ ++ K206A/I208V/R221T/N247D/M322V/K343G/E367N/ 341 R373K 301 + + + − K206A/M322I/E367N/R373K 342 302 + + + + K206A/M322V/K343G/E367N/R373K 343 303 ++ ++ ++ + K206A/N247D/M322I/A337E/K343D/F365L/E367N/ 344 R373K/I376V 304 ++ ++ ++ ++ K206A/Q302K/L316D/M322I/A337P/A350G/K362Q/ 345 E367N/T369S/R373K 305 + + + ++ K206A/Q302K/L316D/M322I/A337P/K343D/E367N/ 346 T369S/R373K 306 + ++ ++ ++ K206A/R221K/N247D/Q302K/M322I/E367N/R373K 347 307 + + + + K206A/R221K/Q302K/M322I/K343G/E367N/R373K/ 348 I376V 308 − − − + K96I/K206A/F217R/M322I/E367N/T369S/R373K 349 309 + ++ +++ ++ K96I/K206A/F217R/N247D/Q302K/M322I/A337P/ 350 K343G/A350G/E367N/R373K 310 − + + + K96I/K206A/N247D/M322I/A350G/E367N/T369S/ 351 R373K 311 + + ++ + K96I/K206A/N247D/Q302K/L316D/M322I/A337P/ 352 A350G/E367N/T369S/R373K 312 ++ +++ +++ +++ K96I/K206A/N247D/Q302K/L316D/M322I/A337P/ 353 A350G/K362Q/E367N/T369S/R373K 313 + + − + L100F/A125S/K206A/I208V/R221K/Q302K/M322I/ 354 K343G/E367N/R373K 314 + ++ ++ + L100F/K206A/I208V/N247D/Q302K/M322V/K343D/ 355 E367N/R373K/I376V 315 + + + + L100F/K206A/I208V/Q302K/M322V/F365L/E367N/ 356 R373K/I376V 316 + + + + L100F/K206A/I208V/R221K/M322V/K343D/E367N/ 357 R373K 317 + + − − L100F/K206A/I208V/R221K/M322V/K343D/F365L/ 358 E367N/R373K 318 + + ++ + L100F/K206A/I208V/R221T/M322V/E367N/R373K/ 359 I376V 319 + + + + L100F/K206A/M322I/E367N/R373K/I376V 360 320 + + + + L100F/K206A/N247D/Q302K/M322I/E367N/R373K 361 321 ++ ++ +++ + L100F/K206A/R221K/N247D/M322I/K343G/E367N/ 362 R373K 322 + + ++ + L100F/K206A/R221T/Q302K/M322I/K343D/E367N/ 363 R373K 323 − − − + L100F/L160I/K206A/R221K/M322V/E367N/R373K 364 324 − − − − L23S/K206A/M322I/E367N/R373K 365 325 ++ +++ +++ +++ L44R/K206A/F217R/N247D/L316D/M322I/A337P/ 366 K343G/K362Q/E367N/R373K 326 ++ +++ +++ +++ L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 367 A337P/K362Q/E367N/R373K 327 ++ +++ +++ +++ L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 368 K343D/A350G/K362Q/E367N/R373K 328 + + + + L44R/K206A/F217R/Q302K/M322I/A337P/A350G/ 369 E367N/T369S/R373K 329 + ++ ++ ++ L44R/K206A/I208V/N247D/Q302K/M322I/K343D/ 370 E367N/R373K 330 ++ ++ + + L44R/K206A/I208V/R221K/M322I/K343D/E367N/ 371 R373K 331 + ++ ++ + L44R/K206A/I208V/R221K/N247D/Q302K/M322I/ 372 K343D/E367N/R373K/I376V 332 + + + + L44R/K206A/I208V/R221T/Q302K/M322I/K343G/ 373 F365L/E367N/R373K/I376V 333 ++ ++ ++ + L44R/K206A/L316D/M322I/A337P/A350G/E367N/ 374 T369S/R373K 334 + ++ +++ ++ L44R/K206A/N247D/L316D/M322I/A350G/K362Q/ 375 E367N/T369S/R373K 335 ++ +++ +++ +++ L44R/K206A/N247D/Q302K/L316D/M322I/A337P/ 376 K343G/A350G/K362Q/E367N/T369S/R373K 336 + + + − L44R/K206A/N247D/Q302K/M322I/A350G/E367N/ 377 T369S/R373K 337 + ++ ++ ++ L44R/K206A/N247D/Q302K/M322I/K343D/E367N/ 378 R373K 338 ++ +++ +++ +++ L44R/K96I/K206A/F217R/N247D/L316D/M322I/ 379 A337P/A350G/K362Q/E367N/R373K 339 + + ++ + L44R/K96I/K206A/F217R/N247D/M322I/A350G/ 380 K362Q/E367N/R373K 340 + + + + L44R/K96I/K206A/F217R/N247D/M322I/A350G/ 381 K362Q/E367N/T369S/R373K 341 − + + + L44R/K96I/K206A/F217R/N247D/M322I/E367N/ 382 T369S/R373K 342 ++ +++ +++ +++ L44R/K96I/K206A/F217R/N247D/Q302K/L316D/ 383 M322I/A337P/E367N/R373K 343 + + + + L44R/K96I/K206A/F217R/N247D/Q302K/M322I/ 384 E367N/T369S/R373K 344 + + + ++ L44R/K96I/K206A/F217R/N247D/Q302K/M322I/ 385 K362Q/E367N/R373K 345 + ++ +++ + L44R/K96I/K206A/F217R/Q219P/N247D/M253K/ 386 S266F/D284E/Q290P/L293F/Q302K/V308G/S314F/ M322I/A337P/K343E/E367N/R373K 346 + + ++ + L44R/K96I/K206A/F217R/Q302K/M322I/A350G/ 387 K362Q/E367N/T369S/R373K 347 − − − − L44R/K96I/K206A/M322I/A337P/E367N/T369S/ 388 R373K 348 + + + + L44R/L100F/K206A/I208V/R221K/M322I/K343G/ 389 F365L/E367N/R373K 349 + + ++ + L44R/L100F/K206A/I208V/R221T/N247D/M322I/ 390 F365L/E367N/R373K 350 + ++ +++ + L44R/L100F/K206A/I208V/R221T/N247D/M322V/ 391 E367N/R373K/I376V 351 + + ++ + L44R/L100F/K206A/I208V/R221T/Q302K/M322I/ 392 E367N/R373K/I376V 352 + + + + L44R/L100F/K206A/Q302K/M322I/E367N/R373K/ 393 I376V 353 − − − + L44R/L100F/K206A/R221K/M322I/F365L/E367N/ 394 R373K/I376V 354 − + + + L44R/L100F/K206A/R221T/M322I/F365L/E367N/ 395 R373K 355 + ++ ++ + L44R/L100F/K206A/R221T/N247D/M322I/K343D/ 396 E367N/R373K/I376V 356 + + ++ + L44R/L100F/K206A/R221T/N247D/Q302K/M322I/ 397 E367N/R373K 357 + ++ +++ + L44R/L100F/K206A/R221T/N247D/Q302K/M322V/ 398 E367N/R373K/I376V 358 + + ++ + L44R/L100F/K206A/R221T/Q302K/M322I/E367N/ 399 R373K 359 + + +++ + L44R/L100F/Q181L/K206A/R221T/N247D/Q302K/ 400 M322V/E367N/R373K/I376V .sup.1 Relative activity was calculated as activity of the variant/activity of Rd3BB (SEQ ID NO: 13 (encoded by SEQ ID NO: 11). .sup.2 Variant # 326 (Rd4BB) has the polynucleotide sequence of SEQ ID NO: 14 and polypeptide sequence of SEQ ID NO: 15. .sup.3 − = <0.5 relative activity to Rd3BB (SEQ ID NO: 13); + = 0.5 to 1.5 relative activity over Rd3BB (SEQ ID NO: 13); ++ = >1.5 to 2.5 relative activity over Rd3BB (SEQ ID NO: 13); and +++ = >2.5 relative activity over Rd3BB (SEQ ID NO: 13).

(151) TABLE-US-00007 TABLE 2.6 Relative Activity of GLA Variants After No Challenge (NC) or Challenge at the Indicated pH or Condition .sup.1, 2, 3, 4 Variant pH pH Amino acid differences relative to SEQ ID NO: 5 SEQ # NC 3.7 9.65 (WT GLA) ID NO: 360 + + + L44E/K206A/F217R/N247D/Q302K/L316D/M322I/ 401 A337P/K362Q/E367N/R373K 361 + + + L44R/S47R/K206A/F217R/N247D/Q302K/L316D/ 402 M322I/A337P/K362Q/E367N/R373K 362 + + + L44C/K206A/F217R/N247D/Q302K/L316D/M322I/ 403 A337P/K362Q/E367N/R373K 363 + + + L44R/S47D/K206A/F217R/N247D/Q302K/L316D/ 404 M322I/A337P/K362Q/E367N/R373K 364 + + − M39H/L44R/K206A/F217R/N247D/Q302K/L316D/ 405 M322I/A337P/K362Q/E367N/R373K 365 + + + L44R/S47N/K206A/F217R/N247D/Q302K/L316D/ 406 M322I/A337P/K362Q/E367N/R373K 366 + + + L44R/S47V/K206A/F217R/N247D/Q302K/L316D/ 407 M322I/A337P/K362Q/E367N/R373K 367 + + − M39R/L44R/K206A/F217R/N247D/Q302K/L316D/ 408 M322I/A337P/K362Q/E367N/R373K 368 + + + L44A/K206A/F217R/N247D/Q302K/L316D/M322I/ 409 A337P/K362Q/E367N/R373K 369 + + − L44S/K206A/F217R/N247D/Q302K/L316D/M322I/ 410 A337P/K362Q/E367N/R373K 370 + ++ + L44Q/K206A/F217R/N247D/Q302K/L316D/M322I/ 411 A337P/K362Q/E367N/R373K 371 + − + L44W/K206A/F217R/N247D/Q302K/L316D/M322I/ 412 A337P/K362Q/E367N/R373K 372 + − + L44V/K206A/F217R/N247D/Q302K/L316D/M322I/ 413 A337P/K362Q/E367N/R373K 373 − − − M41R/L44R/K206A/F217R/N247D/Q302K/L316D/ 414 M322I/A337P/K362Q/E367N/R373K 374 + + + L44M/K206A/F217R/N247D/Q302K/L316D/M322I/ 415 A337P/K362Q/E367N/R373K 375 + + + L44R/S47I/K206A/F217R/N247D/Q302K/L316D/ 416 M322I/A337P/K362Q/E367N/R373K 376 − − − M41P/L44R/K206A/F217R/N247D/Q302K/L316D/ 417 M322I/A337P/K362Q/E367N/R373K 377 + ++ − M39T/L44R/K206A/F217R/N247D/Q302K/L316D/ 418 M322I/A337P/K362Q/E367N/R373K 378 + − + L44T/K206A/F217R/N247D/Q302K/L316D/M322I/ 419 A337P/K362Q/E367N/R373K 379 + ++ + L44R/S47T/K206A/F217R/N247D/Q302K/L316D/ 420 M322I/A337P/K362Q/E367N/R373K 380 + + − L44R/Y92K/K206A/F217R/N247D/Q302K/L316D/ 421 M322I/A337P/K362Q/E367N/R373K 381 + + − L44R/Y92S/K206A/F217R/N247D/Q302K/L316D/ 422 M322I/A337P/K362Q/E367N/R373K 382 − − − L44R/H94N/K206A/F217R/N247D/Q302K/L316D/ 423 M322I/A337P/K362Q/E367N/R373K 383 + − − L44R/Y92C/K206A/F217R/N247D/Q302K/L316D/ 424 M322I/A337P/K362Q/E367N/R373K 384 + + − L44R/Y92V/K206A/F217R/N247D/Q302K/L316D/ 425 M322I/A337P/K362Q/E367N/R373K 385 + + − L44R/Y92A/K206A/F217R/N247D/Q302K/L316D/ 426 M322I/A337P/K362Q/E367N/R373K 386 − + − L44R/H94R/K206A/F217R/N247D/Q302K/L316D/ 427 M322I/A337P/K362Q/E367N/R373K 387 + + − L44R/V93T/K206A/F217R/N247D/Q302K/L316D/ 428 M322I/A337P/K362Q/E367N/R373K 388 + − + L44R/V93L/K206A/F217R/N247D/Q302K/L316D/ 429 M322I/A337P/K362Q/E367N/R373K 389 + + − L44R/V93S/K206A/F217R/N247D/Q302K/L316D/ 430 M322I/A337P/K362Q/E367N/R373K 390 + + − L44R/Y92Q/K206A/F217R/N247D/Q302K/L316D/ 431 M322I/A337P/K362Q/E367N/R373K 391 + + − L44R/Y92W/K206A/F217R/N247D/Q302K/L316D/ 432 M322I/A337P/K362Q/E367N/R373K/L397S 392 + + − L44R/Y92T/K206A/F217R/N247D/Q302K/L316D/ 433 M322I/A337P/K362Q/E367N/R373K 393 + − − L44R/Y92G/K206A/F217R/N247D/Q302K/L316D/ 434 M322I/A337P/K362Q/E367N/R373K 394 + + − L44R/Y92R/K206A/F217R/N247D/Q302K/L316D/ 435 M322I/A337P/K362Q/E367N/R373K 395 + + + L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/ 40 M322I/A337P/K362Q/E367N/R373K 396 + + + L44R/L158M/K206A/F217R/N247D/Q302K/L316D/ 437 M322I/A337P/K362Q/E367N/R373K 397 + + + L44R/L158R/K206A/F217R/N247D/Q302K/L316D/ 438 M322I/A337P/K362Q/E367N/R373K 398 + ++ − L44R/A159S/K206A/F217R/N247D/Q302K/L316D/ 439 M322I/A337P/K362Q/E367N/R373K 399 + + + L44R/R165K/K206A/F217R/N247D/Q302K/L316D/ 440 M322I/A337P/K362Q/E367N/R373K 400 + + − L44R/L158C/K206A/F217R/N247D/Q302K/L316D/ 441 M322I/A337P/K362Q/E367N/R373K 401 + + − L44R/T163S/K206A/F217R/N247D/Q302K/L316D/ 442 M322I/A337P/K362Q/E367N/R373K 402 + ++ + L44R/S166P/K206A/F217R/N247D/Q302K/L316D/ 42 M322I/A337P/K362Q/E367N/R373K 403 + + + L44R/S166G/K206A/F217R/N247D/Q302K/L316D/ 444 M322I/A337P/K362Q/E367N/R373K 404 + + − L44R/S166F/K206A/F217R/N247D/Q302K/L316D/ 445 M322I/A337P/K362Q/E367N/R373K 405 + ++ + L44R/L158E/K206A/F217R/N247D/Q302K/L316D/ 446 M322I/A337P/K362Q/E367N/R373K 406 + + + L44R/R162K/K206A/F217R/N247D/Q302K/L316D/ 447 M322I/A337P/K362Q/E367N/R373K 407 + + − L44R/L158H/K206A/F217R/N247D/Q302K/L316D/ 448 M322I/A337P/K362Q/E367N/R373K 408 + + + L44R/S166R/K206A/F217R/N247D/Q302K/L316D/ 449 M322I/A337P/K362Q/E367N/R373K 409 + + − L44R/R165H/K206A/F217R/N247D/Q302K/L316D/ 450 M322I/A337P/K362Q/E367N/R373K 410 + + − L44R/R162H/K206A/F217R/N247D/Q302K/L316D/ 451 M322I/A337P/K362Q/E367N/R373K 411 + + + L44R/S166A/K206A/F217R/N247D/Q302K/L316D/ 452 M322I/A337P/K362Q/E367N/R373K 412 + ++ + L44R/S166H/K206A/F217R/N247D/Q302K/L316D/ 453 M322I/A337P/K362Q/E367N/R373K 413 − − − L44R/T163*/K206A/F217R/N247D/Q302K/L316D/ 454 M322I/A337P/K362Q/E367N/R373K 414 + + + L44R/L158Q/K206A/F217R/N247D/Q302K/L316D/ 455 M322I/A337P/K362Q/E367N/R373K 415 + + + L44R/S166D/K206A/F217R/N247D/Q302K/L316D/ 456 M322I/A337P/K362Q/E367N/R373K 416 + + − L44R/R162G/K206A/F217R/N247D/Q302K/L316D/ 457 M322I/A337P/K362Q/E367N/R373K 417 + + − L44R/R162S/K206A/F217R/N247D/Q302K/L316D/ 458 M322I/A337P/K362Q/E367N/R373K 418 + + − L44R/N161E/K206A/F217R/N247D/Q302K/L316D/ 459 M322I/A337P/K362Q/E367N/R373K 419 + + + L44R/S166E/K206A/F217R/N247D/Q302K/L316D/ 460 M322I/A337P/K362Q/E367N/R373K 420 + ++ − L44R/S166T/K206A/F217R/N247D/Q302K/L316D/ 461 M322I/A337P/K362Q/E367N/R373K 421 + + − L44R/R162Q/K206A/F217R/N247D/Q302K/L316D/ 462 M322I/A337P/K362Q/E367N/R373K 422 + + − L44R/L158G/K206A/F217R/N247D/Q302K/L316D/ 463 M322I/A337P/K362Q/E367N/R373K 423 + + + L44R/R162A/K206A/F217R/N247D/Q302K/L316D/ 464 M322I/A337P/K362Q/E367N/R373K 424 + + − L44R/K206A/F217R/N247D/L255E/Q302K/L316D/ 465 M322I/A337P/K362Q/E367N/R373K 425 + − + L44R/K206A/F217R/N247D/H271E/Q302K/L316D/ 466 M322I/A337P/K362Q/E367N/R373K 426 + − − L44R/K206A/F217R/N247D/M259E/Q302K/L316D/ 467 M322I/A337P/K362Q/E367N/R373K 427 + − − L44R/K206A/F217R/N247D/L263G/Q302K/L316D/ 468 M322I/A337P/K362Q/E367N/R373K 428 + + − L44R/K206A/F217R/N247D/M259S/Q302K/L316D/ 469 M322I/A337P/K362Q/E367N/R373K 429 + + − L44R/K206A/F217R/N247D/L255C/Q302K/L316D/ 470 M322I/A337P/K362Q/E367N/R373K 430 + − + L44R/K206A/F217R/N247D/H271T/Q302K/L316D/ 471 M322I/A337P/K362Q/E367N/R373K 431 + − − L44R/K206A/F217R/N247D/R270G/Q302K/L316D/ 472 M322I/A337P/K362Q/E367N/R373K 432 + − + L44R/K206A/F217R/N247D/L255V/Q302K/L316D/ 473 M322I/A337P/K362Q/E367N/R373K 433 + + + L44R/K206A/F217R/N247D/H271Q/Q302K/L316D/ 474 M322I/A337P/K362Q/E367N/R373K 434 + − − L44R/K206A/F217R/N247D/R270D/Q302K/L316D/ 475 M322I/A337P/K362Q/E367N/R373K 435 + ++ − L44R/K206A/F217R/N247D/I258L/Q302K/L316D/ 476 M322I/A337P/K362Q/E367N/R373K 436 + − − L44R/K206A/F217R/N247D/H271G/Q302K/L316D/ 477 M322I/A337P/K362Q/E367N/R373K 437 + + − L44R/K206A/F217R/N247D/L263E/Q302K/L316D/ 478 M322I/A337P/K362Q/E367N/R373K 438 − − − L44R/K206A/F217R/N247D/L255*/Q302K/L316D/ 479 M322I/A337P/K362Q/E367N/R373K 439 + + + L44R/K206A/F217R/N247D/H271A/Q302K/L316D/ 480 M322I/A337P/K362Q/E367N/R373K 440 + + − L44R/K206A/F217R/N247D/L263C/Q302K/L316D/ 481 M322I/A337P/K362Q/E367N/R373K 441 + − + L44R/K206A/F217R/N247D/H271V/Q302K/L316D/ 482 M322I/A337P/K362Q/E367N/R373K 442 + + − L44R/K206A/F217R/N247D/L255A/Q302K/L316D/ 483 M322I/A337P/K362Q/E367N/R373K 443 + +++ − L44R/K206A/F217R/N247D/L255S/Q302K/L316D/ 484 M322I/A337P/K362Q/E367N/R373K 444 + − + L44R/K206A/F217R/N247D/M259W/Q302K/L316D/ 485 M322I/A337P/K362Q/E367N/R373K 445 + + − L44R/K206A/F217R/N247D/L263F/Q302K/L316D/ 486 M322I/A337P/K362Q/E367N/R373K 446 + − − L44R/K206A/F217R/N247D/M259A/Q302K/L316D/ 487 M322I/A337P/K362Q/E367N/R373K 447 + − − L44R/K206A/F217R/N247D/L263W/Q302K/L316D/ 488 M322I/A337P/K362Q/E367N/R373K 448 + − − L44R/K206A/F217R/N247D/R270Q/Q302K/L316D/ 489 M322I/A337P/K362Q/E367N/R373K 449 + ++ − L44R/K206A/F217R/N247D/L255I7Q302K/L316D/ 490 M322I/A337P/K362Q/E367N/R373K 450 + ++ − L44R/K206A/F217R/N247D/I258M/Q302K/L316D/ 491 M322I/A337P/K362Q/E367N/R373K 451 + ++ − L44R/K206A/F217R/N247D/M259V/Q302K/L316D/ 492 M322I/A337P/K362Q/E367N/R373K 452 + ++ + L44R/K206A/F217R/N247D/H271R/Q302K/L316D/ 493 M322I/A337P/K362Q/E367N/R373K 453 + − − L44R/K206A/F217R/N247D/R270L/Q302K/L316D/ 494 M322I/A337P/K362Q/E367N/R373K 454 + ++ + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 495 A337P/K362Q/E367N/R373K/M390P 455 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 496 A337P/K362Q/E367N/R373K/M392D 456 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 497 A337P/K362Q/E367N/R373K/T389M 457 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 498 A337P/K362Q/E367N/R373K/M392A 458 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 499 A337P/K362Q/E367N/R373K/M390* 459 + ++ + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 500 A337P/K362Q/E367N/R373K/M390H 460 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 501 A337P/K362Q/E367N/R373K/L386T 461 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 502 A337P/K362Q/E367N/R373K/M392Q 462 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 503 A337P/K362Q/E367N/R373K/Q385L 463 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 504 A337P/K362Q/E367N/R373K/M390T 464 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 505 A337P/K362Q/E367N/R373K/M392* 465 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 506 A337P/K362Q/E367N/R373K/M390Q 466 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 507 A337P/K362Q/E367N/R373K/M392E 467 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 508 A337P/K362Q/E367N/R373K/T389S 468 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 509 A337P/K362Q/E367N/R373K/T389Q 469 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 510 A337P/K362Q/E367N/R373K/Q385I 470 + ++ + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 511 A337P/K362Q/E367N/R373K/M392R 471 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 512 A337P/K362Q/E367N/R373K/T389W 472 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 513 A337P/K362Q/E367N/R373K/M392K 473 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 514 A337P/K362Q/E367N/R373K/M392L 474 + ++ + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 515 A337P/K362Q/E367N/R373K/L386F 475 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 516 A337P/K362Q/E367N/R373K/T389D 476 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 517 A337P/K362Q/E367N/R373K/M390E 477 + − + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 518 A337P/K362Q/E367N/R373K/L384W 478 + ++ + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 519 A337P/K362Q/E367N/R373K/M392S 479 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 520 A337P/K362Q/E367N/R373K/M392F 480 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 521 A337P/K362Q/E367N/R373K/M390R 481 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 522 A337P/K362Q/E367N/R373K/M390G 482 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 523 A337P/K362Q/E367N/R373K/Q385G 483 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 524 A337P/K362Q/E367N/R373K/M392C 484 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 525 A337P/K362Q/E367N/R373K/M392V 485 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 526 A337P/K362Q/E367N/R373K/M392W 486 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 527 A337P/K362Q/E367N/R373K/M390C 487 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 528 A337P/K362Q/E367N/R373K/T389G 488 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 529 A337P/K362Q/E367N/R373K/T389N 489 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 530 A337P/K362Q/E367N/R373K/T389I 490 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 531 A337P/K362Q/E367N/R373K/M390D 491 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 532 A337P/K362Q/E367N/R373K/M390W 492 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 533 A337P/K362Q/E367N/R373K/T389C 493 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 534 A337P/K362Q/E367N/R373K/M392P 494 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 535 A337P/K362Q/E367N/R373K/M390F 495 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 536 A337P/K362Q/E367N/R373K/T389P 496 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 537 A337P/K362Q/E367N/R373K/M390V 497 + ++ + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 538 A337P/K362Q/E367N/R373K/M390K 498 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 539 A337P/K362Q/E367N/R373K/M392I 499 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 540 A337P/K362Q/E367N/R373K/T389L 500 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 541 A337P/K362Q/E367N/R373K/M390A 501 + ++ + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 542 A337P/K362Q/E367N/R373K/M392G 502 − + − L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 543 A337P/K362Q/E367N/R373K/L386S 503 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 544 A337P/K362Q/E367N/R373K/Q385C 504 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 545 A337P/K362Q/E367N/R373K/M390S 505 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 546 A337P/K362Q/E367N/R373K/M392N 506 + + − L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 547 A337P/K362Q/E367N/R373K/Q385W 507 + ++ + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 548 A337P/K362Q/E367N/R373K/M392T 508 − − − L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 549 A337P/K362Q/E367N/R373K/L384A 509 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 550 A337P/K362Q/E367N/R373K/Q385T 510 + − + L44R/A199G/K206A/F217R/N247D/Q302K/L316D/ 551 M322I/A337P/K362Q/E367N/R373K/M392R 511 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 552 A337P/K362Q/E367N/R373K/L397* 512 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 553 A337P/K362Q/E367N/R373K/K395* 513 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 554 A337P/K362Q/E367N/R373K/D396* 514 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 555 A337P/K362Q/E367N/R373K/S393* 515 + + + L44R/K206A/F217R/N247D/Q302K/L316D/M322I/ 556 A337P/K362Q/E367N/R373K/L394* .sup.1 Relative activity was calculated as activity of the variant/activity of Rd4BB (SEQ ID NO: 15 (encoded by SEQ ID NO: 14). .sup.2 Variant # 395 (Rd5BB) has the polynucleotide sequence of SEQ ID NO: 39 and polypeptide sequence of SEQ ID NO: 40. .sup.3 Variant # 402 (Rd6BB) has the polynucleotide sequence of SEQ ID NO: 41 and polypeptide sequence of SEQ ID NO: 42 .sup.4 − = <0.5 relative activity to Rd4BB (SEQ ID NO: 15); + = 0.5 to 1.5 relative activity over Rd4BB (SEQ ID NO: 15); ++ = >1.5 to 2.5 relative activity over Rd4BB (SEQ ID NO: 15); and +++ = >2.5 relative activity over Rd4BB (SEQ ID NO: 15).

(152) TABLE-US-00008 TABLE 2.7 Relative Activity of GLA Variants After No Challenge (NC) or Challenge at the Indicated pH or Condition Variant pH pH Amino acid differences relative to SEQ ID NO: 5 SEQ # NC 3.7 9.7 (WT GLA) ID NO: 516 + +++ + D2E/L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/ 557 M322I/Q326G/A337P/K362Q/E367N/R373K 517 + + + D2Q/L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/ 558 M322I/A337P/K362Q/E367N/R373K 518 + + ++ E40D/L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/ 559 M322I/A337P/K362Q/E367N/R373K 519 + + ++ E40S/L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/ 560 M322I/A337P/K362Q/E367N/R373K 520 + + + L44R/A77S/Y92H/K206A/F217R/N247D/Q302K/L316D/ 561 M322I/A337P/K362Q/E367N/R373K 521 + + ++ L44R/D52N/Y92H/K206A/F217R/N247D/Q302K/L316D/ 562 M322I/A337P/K362Q/E367N/R373K 522 + +++ ++ L44R/E56K/Y92H/K206A/F217R/N247D/Q302K/L316D/ 563 M322I/A337P/K362Q/E367N/R373K 523 + + + L44R/N91M/Y92H/K206A/F217R/N247D/Q302K/L316D/ 564 M322I/A337P/K362Q/E367N/R373K 524 − + + L44R/N91V/Y92H/K206A/F217R/N247D/Q302K/L316D/ 565 M322I/A337P/K362Q/E367N/R373K 525 + ++ ++ L44R/Q76H/Y92H/K206A/F217R/N247D/Q302K/L316D/ 566 M322I/A337P/K362Q/E367N/W368A/R373K 526 + + ++ L44R/R74H/Y92H/K206A/F217R/N247D/Q302K/L316D/ 567 M322I/A337P/K362Q/E367N/R373K 527 + + ++ L44R/Y92E/K206A/F217R/N247D/Q302K/L316D/M322I/ 568 A337P/K362Q/E367N/R373K 528 + + ++ L44R/Y92H/D130Q/K206A/F217R/N247D/Q302K/L316D/ 569 M322I/A337P/K362Q/E367N/R373K 529 + + ++ L44R/Y92H/K182A/K206A/F217R/N247D/Q302K/L316D/ 570 M322I/A337P/K362Q/E367N/R373K 530 + + ++ L44R/Y92H/K182E/K206A/F217R/N247D/Q302K/L316D/ 571 M322I/A337P/K362Q/E367N/R373K 531 + + ++ L44R/Y92H/K182H/K206A/F217R/N247D/Q302K/L316D/ 572 M322I/A337P/K362Q/E367N/R373K 532 + + ++ L44R/Y92H/K182M/K206A/F217R/N247D/Q302K/L316D/ 573 M322I/A337P/K362Q/E367N/R373K 533 + + ++ L44R/Y92H/K182Q/K206A/F217R/N247D/Q302K/L316D/ 574 M322I/A337P/K362Q/E367N/R373K 534 + + ++ L44R/Y92H/K182R/K206A/F217R/N247D/Q302K/L316D/ 575 M322I/A337P/K362Q/E367N/R373K 535 + + ++ L44R/Y92H/K182T/K206A/F217R/N247D/Q302K/L316D/ 576 M322I/A337P/K362Q/E367N/R373K 536 + + ++ L44R/Y92H/K182V/K206A/F217R/N247D/Q302K/L316D/ 577 M322I/A337P/K362Q/E367N/R373K 537 + + ++ L44R/Y92H/K182Y/K206A/F217R/N247D/Q302K/L316D/ 578 M322I/A337P/K362Q/E367N/R373K 538 + + + L44R/Y92H/K206A/F217R/N247D/A287C/Q302K/L316D/ 579 M322I/A337P/K362Q/E367N/R373K 539 + + ++ L44R/Y92H/K206A/F217R/N247D/A287H/Q302K/L316D/ 580 M322I/A337P/K362Q/E367N/R373K 540 + + ++ L44R/Y92H/K206A/F217R/N247D/A287M/Q302K/L316D/ 581 M322I/A337P/K362Q/E367N/R373K 541 + + ++ L44R/Y92H/K206A/F217R/N247D/K283A/Q302K/L316D/ 582 M322I/A337P/K362Q/E367N/R373K 542 + + ++ L44R/Y92H/K206A/F217R/N247D/K283G/Q302K/L316D/ 583 M322I/A337P/K362Q/E367N/R373K 543 + + + L44R/Y92H/K206A/F217R/N247D/K283M/Q302K/L316D/ 584 M322I/A337P/K362Q/E367N/R373K 544 + + + L44R/Y92H/K206A/F217R/N247D/K283V/Q302K/L316D/ 585 M322I/A337P/K362Q/E367N/R373K 545 + + ++ L44R/Y92H/K206A/F217R/N247D/K295A/Q302K/L316D/ 586 M322I/A337P/K362Q/E367N/R373K 546 + +++ ++ L44R/Y92H/K206A/F217R/N247D/K295E/Q302K/L316D/ 587 M322I/A337P/K362Q/E367N/R373K 547 + + ++ L44R/Y92H/K206A/F217R/N247D/K295L/Q302K/L316D/ 588 M322I/A337P/K362Q/E367N/R373K 548 + +++ ++ L44R/Y92H/K206A/F217R/N247D/K295N/Q302K/L316D/ 589 M322I/A337P/K362Q/E367N/R373K 549 + ++ ++ L44R/Y92H/K206A/F217R/N247D/K295Q/Q302K/L316D/ 590 M322I/A337P/K362Q/E367N/R373K 550 + + ++ L44R/Y92H/K206A/F217R/N247D/K295S/Q302K/L316D/ 591 M322I/A337P/K362Q/E367N/R373K 551 + + ++ L44R/Y92H/K206A/F217R/N247D/K295T/Q302K/L316D/ 592 M322I/A337P/K362Q/E367N/R373K 552 + + ++ L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/A317D/ 593 M322I/A337P/K362Q/E367N/R373K 553 + + ++ L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/A317Q/ 594 M322I/A337P/K362Q/E367N/R373K 554 + + ++ L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/ 595 A337P/A346G/K362Q/E367N/R373K 555 + + + L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/ 596 A337P/G344A/K362Q/E367N/R373K 556 − − + L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/ 597 A337P/G344D/K362Q/E367N/R373K 557 + + ++ L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/ 598 A337P/G344S/K362Q/E367N/R373K 558 − − + L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/ 599 A337P/I353L/K362Q/E367N/R373K 559 + + ++ L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/ 600 A337P/K362Q/E367N/L372W/R373K 560 + ++ ++ L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/ 601 A337P/K362Q/E367N/W368A/R373K 561 + + ++ L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/ 602 A337P/K362Q/E367N/W368L/R373K 562 + + ++ L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/ 603 A337P/K362Q/E367N/W368N/R373K 563 + + ++ L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/ 604 A337P/K362Q/E367N/W368R/R373K 564 + + ++ L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/ 605 A337P/K362Q/E367N/W368V/R373K 565 + + ++ L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/ 606 A337P/N348E/K362Q/E367N/R373K 566 + + ++ L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/ 607 A337P/N348M/K362Q/E367N/R373K 567 + + ++ L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/ 608 A337P/N348Q/K362Q/E367N/R373K 568 + + ++ L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/ 609 A337P/N348R/K362Q/E367N/R373K 569 + + ++ L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/ 610 A337P/N348W/K362Q/E367N/R373K 570 + + ++ L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/ 611 A337P/T354S/K362Q/E367N/R373K 571 + + ++ L44R/Y92H/K206A/F217R/N247D/Q302K/N305K/L316D/ 612 M322I/A337P/K362Q/E367N/R373K 572 + +++ ++ L44R/Y92H/K206A/F217R/N247D/Q302K/N305L/L316D/ 613 M322I/A337P/K362Q/E367N/R373K 573 + + ++ L44R/Y92H/K206A/F217R/N247D/Q302K/S314A/L316D/ 614 M322I/A337P/K362Q/E367N/R373K 574 + + ++ L44R/Y92H/K206A/F217R/N247D/Q302K/S314H/L316D/ 615 M322I/A337P/K362Q/E367N/R373K 575 + + ++ L44R/Y92H/K206A/F217R/N247D/Q302K/S314N/L316D/ 616 M322I/A337P/K362Q/E367N/R373K 576 + + ++ L44R/Y92H/K206A/F217R/N247D/Q302K/S314Y/L316D/ 617 M322I/A337P/K362Q/E367N/R373K 577 + +++ ++ L44R/Y92H/K206A/F217R/W246A/N247D/Q302K/L316D/ 618 M322I/A337P/K362Q/E367N/R373K 578 + +++ ++ L44R/Y92H/K206A/F217R/W246I/N247D/Q302K/L316D/ 619 M322I/A337P/K362Q/E367N/R373K 579 + +++ ++ L44R/Y92H/K206A/F217R/W246P/N247D/Q302K/L316D/ 620 M322I/A337P/K362Q/E367N/R373K 580 + +++ ++ L44R/Y92H/K206A/F217R/W246R/N247D/Q302K/L316D/ 621 M322I/A337P/K362Q/E367N/R373K 581 + ++ ++ L44R/Y92H/K206A/F217R/W246S/N247D/Q302K/L316D/ 622 M322I/A337P/K362Q/E367N/R373K 582 + + ++ L44R/Y92H/K206A/S210A/F217R/N247D/Q302K/L316D/ 623 M322I/A337P/A350T/K362Q/E367N/R373K 583 + + ++ L44R/Y92H/K206A/S210A/F217R/N247D/Q302K/L316D/ 624 M322I/A337P/K362Q/E367N/R373K 584 + + ++ L44R/Y92H/K206A/S210E/F217R/N247D/Q302K/L316D/ 625 M322I/A337P/K362Q/E367N/R373K 585 + + ++ L44R/Y92H/K206A/S210K/F217R/N247D/Q302K/L316D/ 626 M322I/A337P/K362Q/E367N/R373K 586 + ++ ++ L44R/Y92H/K206A/S210N/F217R/N247D/Q302K/L316D/ 627 M322I/A337P/K362Q/E367N/R373K 587 + + ++ L44R/Y92H/K206A/S210R/F217R/N247D/Q302K/L316D/ 628 M322I/A337P/K362Q/E367N/R373K 588 + + + L44R/Y92H/K96A/K206A/F217R/N247D/Q302K/L316D/ 629 M322I/A337P/K362Q/E367N/R373K 589 + + + L44R/Y92H/K96W/K206A/F217R/N247D/Q302K/L316D/ 630 M322I/A337P/K362Q/E367N/R373K 590 + + + L44R/Y92H/P179M/K206A/F217R/N247D/Q302K/L316D/ 631 M322I/A337P/K362Q/E367N/R373K 591 + + ++ L44R/Y92H/R189K/K206A/F217R/N247D/Q302K/L316D/ 632 M322I/A337P/K362Q/E367N/R373K 592 + + ++ L44R/Y92H/R189V/K206A/F217R/N247D/Q302K/L316D/ 633 M322I/A337P/K362Q/E367N/R373K 593 + + ++ L44R/Y92H/S95A/K206A/F217R/N247D/Q302K/L316D/ 634 M322I/A337P/K362Q/E367N/R373K 594 + + ++ L44R/Y92H/S95E/K206A/F217R/N247D/Q302K/L316D/ 635 M322I/A337P/K362Q/E367N/R373K 595 + + + L44R/Y92H/T186A/K206A/F217R/N247D/Q302K/L316D/ 636 M322I/A337P/K362Q/E367N/R373K 596 + ++ ++ L44R/Y92H/T186G/K206A/F217R/N247D/Q302K/L316D/ 637 M322I/A337P/K362Q/E367N/R373K 597 + − + L44R/Y92H/T186V/K206A/F217R/N247D/Q302K/L316D/ 638 M322I/A337P/K362Q/E367N/R373K 598 + + ++ L44R/Y92H/Y120H/K206A/F217R/N247D/Q302K/L316D/ 639 M322I/A337P/K362Q/E367N/R373K 599 + + ++ L44R/Y92H/Y120S/K206A/F217R/N247D/Q302K/L316D/ 640 M322I/A337P/K362Q/E367N/R373K 600 + +++ + L44R/Y92H/Y120S/K206A/F217R/N247D/Q302K/L316D/ 641 M322I/A337P/L341F/K362Q/E367N/R373K 601 − + + M39C/L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/ 642 M322I/A337P/K362Q/E367N/R373K 602 + + ++ M39E/L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/ 643 M322I/A337P/K362Q/E367N/R373K 603 + + + M39R/L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/ 644 M322I/A337P/K362Q/E367N/R373K 604 + + ++ M39V/L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/ 645 M322I/A337P/K362Q/E367N/R373K 605 + +++ ++ T10P/L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/ 646 M322I/A337P/K362Q/E367N/R373K 606 + +++ ++ T10P; L44R; Y92H; R189L; K206A; F217R; N247D; 647 Q302K; L316D; M322I; A337P; K362Q; E367N; R373K 607 + + ++ T8L; L44R; Y92H; K206A; F217R; N247D; Q302K; 648 L316D; M322I; A337P; K362Q; E367N; R373K 608 + + + T8Q; L44R; Y92H; K206A; F217R; N247D; Q302K; 649 L316D; M322I; A337P; K362Q; E367N; R373K 1. Relative activity was calculated as activity of the variant/activity of Rd3BB (SEQ ID NO: 13) (encoded by SEQ ID NO: 11). 2. − = <1.5 relative activity to Rd3BB (SEQ ID NO: 13); + = 1.5 to 5 relative activity over Rd3BB (SEQ ID NO: 13); ++ = >5 to 10 relative activity over Rd3BB (SEQ ID NO: 13); and +++ = >10 relative activity over Rd3BB (SEQ ID NO: 13).

(153) TABLE-US-00009 TABLE 2.8 Relative Activity of GLA Variants After No Challenge (NC) or Challenge at the Indicated pH or Condition Variant pH pH Amino acid differences relative to SEQ ID NO: 5 SEQ # NC 3.3 9.7 (WT GLA) ID NO: 609 + ++ ++ L44R/S166P/K206A/F217R/N247D/Q302K/L316D/M322I/ 650 A337P/K362Q/E367N/R373K 610 + + − L44R/S47T/Y92H/S166P/K206A/F217R/N247D/M259E/ 651 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M390Q 611 + +++ ++ L44R/Y92H/S166P/K206A/F217R/N247D/Q302K/L316D/ 652 M322I/A337P/K362Q/E367N/R373K/M390Q 612 + ++ ++ L44R/Y92H/S166P/K206A/F217R/N247D/Q302K/L316D/ 653 M322I/A337P/K362Q/E367N/R373K/M392T 613 + ++ ++ L44R/S47N/Y92H/S166P/K206A/F217R/N247D/H271A/ 654 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M390Q 614 + ++ ++ L44R/S47T/Y92H/S166P/K206A/F217R/N247D/Q302K/ 655 L316D/M322I/A337P/K362Q/E367N/R373K 615 + ++ ++ L44R/S47N/Y92H/S166P/K206A/F217R/N247D/Q302K/ 656 L316D/M3221/A337P/K362Q/E367N/R373K/M390H 616 + + ++ L44R/S47T/Y92H/S166P/K206A/F217R/N247D/M259W/ 657 H271A/Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/ M390Q 617 + ++ ++ L44R/Y92H/L136V/S166P/K206A/F217R/N247D/M259A/ 658 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M390Q 618 + ++ ++ L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/ 659 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K 619 + ++ ++ L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/ 660 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M390H 620 − + ++ L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/ 661 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M390Q 621 + ++ − L44R/S47T/Y92H/S166P/K206A/F217R/N247D/M259E/ 662 H271A/Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/ M390Q 622 + − ++ L44R/S47N/Y92H/S166P/K206A/F217R/N247D/M259W/ 663 H271A/Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/ M390Q/M392T 623 + +++ ++ L44R/S47N/S166P/K206A/F217R/N247D/H271A/A276S/ 664 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 624 + ++ ++ L44R/S47N/S166P/K206A/F217R/N247D/H271A/Q302K/ 665 L316D/M322I/A337P/K362Q/E367N/R373K/M390Q 625 + ++ ++ L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/ 44 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 626 + ++ ++ L44R/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 666 L316D/M322I/A337P/K362Q/E367N/R373K/M390Q 627 + − ++ L44R/S47N/Y92H/S166P/K206A/F217R/N247D/M259W/ 667 H271A/Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/ M390H/M392T 628 + + ++ L44R/S47N/Y92H/S166P/K206A/F217R/N247D/H271A/ 668 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M390H 629 + ++ ++ L44R/S47T/S166P/K206A/F217R/N247D/H271A/Q302K/ 669 L316D/M322I/A337P/K362Q/E367N/R373K/M390Q 630 + − ++ L44R/S47T/Y92H/S166P/K206A/F217R/N247D/M259W/ 670 H271A/Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/ M390H 631 + + ++ L44R/S47T/A53S/Y92H/S166P/K206A/F217R/N247D/ 671 H271A/Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/ M390Q 632 + ++ ++ L44R/S47N/Y92H/S166P/K206A/F217R/N247D/H271A/ 672 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 633 + ++ ++ E43D/L44R/Y92S/S166P/K206A/F217R/N247D/Q302K/ 673 L316D/M322I/A337P/K362Q/E367N/R373K 634 + ++ ++ E43D/L44R/Y92E/S166P/K206A/F217R/N247D/Q302K/ 674 L316D/M322I/A337P/K362Q/E367N/R373K 635 + ++ ++ E43D/L44R/Y92H/S166P/K206A/F217R/N247D/Q302K/ 675 L316D/M322I/A337P/K362Q/E367N/R373K 636 + + ++ E43D/L44R/Y92N/S166P/K206A/F217R/N247D/Q302K/ 676 L316D/M322I/A337P/K362Q/E367N/R373K 637 + + ++ E43Q/L44R/Y92E/S166P/K206A/F217R/N247D/Q302K/ 677 L316D/M322I/A337P/K362Q/E367N/R373K 1. Relative activity was calculated as activity of the variant/activity of Rd3BB (SEQ ID NO: 13) (encoded by SEQ ID NO: 11). 2. Variant # 625 (Rd7BB) has the polynucleotide sequence of SEQ ID NO: 43 and polypeptide sequence of SEQ ID NO: 44. 3. − = <1.5 relative activity to Rd3BB (SEQ ID NO: 13); + = 1.5 to 5 relative activity over Rd3BB (SEQ ID NO: 13); ++ = >5 to 10 relative activity over Rd3BB (SEQ ID NO: 13); and +++ = >10 relative activity over Rd3BB (SEQ ID NO: 13).

(154) TABLE-US-00010 TABLE 2.9 Relative Activity of GLA Variants After No Challenge (NC) or Challenge at the Indicated pH or Condition Variant pH pH Amino acid differences relative to SEQ ID NO: 5 SEQ # NC 3.5 7.5 (WT GLA) ID NO: 638 − − − T10P/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/A261G/H271A/ 678 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 639 − − − M39E/L44R/S47T/Y92H/S166P/K206A/F217R/N247Y/H271A/Q302K/ 679 L316D/M322I/A337P/K362Q/E367N/R373K/M392T 640 + + + T10P/M39E/E43D/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/ 680 H271A/Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 641 − − − T10P/M39E/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/S266P/ 681 H271A/Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 642 + + + T10P/E43D/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/A261G/ 682 H271A/Q302K/N305L/L316D/M322I/A337P/K362Q/E367N/W368A/ R373K/M392T 643 + − + T10P/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 683 L316D/M322I/R325S/A337P/K362Q/E367N/R373K/M392T 644 − − − L44R/S47T/Y92H/S166P/K206A/F217R/L237P/N247D/H271A/Q302K/ 684 L316D/M322I/A337P/K362Q/E367N/R373K/M392T 645 + + − L44R/S47T/Y92H/S166P/P174S/K206A/F217R/N247D/H271A/Q302K/ 685 L316D/M322I/A337P/K362Q/E367N/R373K/M392T 646 − − − L44R/S47T/Y92H/G113C/S166P/K206A/F217R/N247D/H271A/Q302K/ 686 L316D/M322I/A337P/K362Q/E367N/R373K/M392T 647 − − − L14F/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 687 L316D/M322I/A337P/K362Q/E367N/R373K/M392T 648 + + + T10P/M39E/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/A261G/ 46 H271A/Q302K/L316D/M322I/A337P/K362Q/E367N/W368A/R373K/M392T 649 + + + T10P/M39E/L44R/S47T/Y92H/S166P/K206A/F217R/W246P/N247D/ 689 H271A/Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 650 + + + R7H/T10P/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/ 690 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 651 + + + T10P/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 691 L316D/M322I/A337P/K362Q/E367N/R373K/M392T 652 + + − L44R/S47T/Y92H/S166P/K206A/F217R/W246P/N247D/A261G/H271A/ 692 Q302K/N305L/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 653 + + + T10P/L44R/S47T/Y92H/S166P/K206A/F217R/W246P/N247D/H271A/ 693 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 654 + + + R7S/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 694 L316D/M322I/A337P/K362Q/E367N/R373K/M392T 655 + − − L44R/S47T/Y92H/S166P/K206A/F217R/W246P/N247D/A261G/H271A/ 695 Q302K/N305L/L316D/M322I/A337P/K362Q/E367N/W368A/R373K/M392T 656 + + + T10P/L44R/S47T/Y92H/S166P/K206A/F217R/W246P/N247D/A261G/ 696 H271A/Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 657 + + + L44R/S47T/P67T/Y92H/S166P/K182N/K206A/F217R/N247D/H271A/ 697 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 658 + + + M39E/L44R/S47T/Y92H/S166P/K206A/F217R/W246P/N247D/H271A/ 698 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 659 − − − L44R/S47T/W64L/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 699 L316D/M322I/A337P/K362Q/E367N/R373K/M392T 660 + + − M39E/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/A261G/H271A/ 700 Q302K/N305L/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 661 − − − L44R/S47T/Y92H/S166P/W195C/K206A/F217R/N247D/H271A/Q302K/ 701 L316D/M322I/A337P/K362Q/E367N/R373K/M392T 662 + + + L44R/S47T/Y92H/S166P/K206A/F217R/V2381/N247D/H271A/Q302K/ 702 L316D/M322I/A337P/K362Q/E367N/R373K/M392T 663 + + − E43D/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/A261G/H271A/ 703 Q302K/L316D/M322I/A337P/K362Q/E367N/W368A/R373K/M392T 664 − − − T10P/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/Q252H/M253R/ 704 A254E/A261G/H271A/Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/ M392T 665 + + + R7C/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 705 L316D/M322I/A337P/K362Q/E367N/W368A/R373K/M392T 666 + + − L44R/S47T/Y92H/S166P/K206A/F217R/P228L/N247D/H271A/Q302K/ 706 L316D/M322I/A337P/K362Q/E367N/R373K/M392T 667 + + + D30G/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 707 L316D/M322I/A337P/K362Q/E367N/R373K/M392T 668 + + + M39E/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 708 L316D/M322I/A337P/K362Q/E367N/R373K/M392T 669 + − − L44R/S47T/Y92H/S166P/K206A/F217R/N247D/P262S/H271A/Q302K/ 709 L316D/M322I/A337P/K362Q/E367N/R373K/M392T 670 + + + L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/N305L/ 710 L316D/M322I/A337P/K362Q/E367N/R373K/M392T 671 ++ ++ + T10P/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 711 L316D/M322I/A337P/K362Q/E367N/W368A/R373K/M392T 672 + + − L44R/S47T/Y92H/D144Y/S166P/K206A/F217R/N247D/H271A/Q302K/ 712 L316D/M322I/A337P/K362Q/E367N/R373K/M392T 673 + + − L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/L316D/ 713 M322I/A337P/K362Q/E367N/R373K/N377Y/M392T 674 − − − L44R/S47T/Y92H/S166P/K206A/F217R/P234H/N247D/H271A/Q302K/ 714 L316D/M322I/A337P/K362Q/E367N/R373K/M392T 675 + + − L44R/S47T/M65V/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 715 L316D/M322I/A337P/K362Q/E367N/R373K/M392T 676 + + + M39E/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 716 L316D/M322I/A337P/K362Q/E367N/W368A/R373K/M392T 677 + + − L44R/S47T/Y92H/S166P/K206A/F217R/N247D/M253W/H271A/S273D/ 717 P274S/K277R/Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 678 − − − L44R/S47T/Y92H/S166P/K206A/F217R/N247D/M253W/A257G/H271A/ 718 K277R/Q281L/Q302K/L316D/A319D/M322I/A337P/K362Q/E367N/R373K/ M392T 679 + + + T10P/M39E/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/ 719 Q302K/N305L/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 680 + + + T10P/M39E/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/ 720 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 681 − − − R7P/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 721 L316D/M322I/A337P/K362Q/E367N/R373K/M392T 682 + + + L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/L316Y/ 722 M322I/A337P/K362Q/E367N/R373K/M392T 683 + + − M39E/E43D/L44R/S47T/Y92H/S166P/K206A/F217R/W246P/N247D/ 723 M253W/H271A/S273D/Q302K/L316D/M322I/A337P/K362Q/E367N/W368A/ R373K/M392T 684 + + + L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/N305L/ 724 L316D/M322I/A337P/K362Q/E367N/W368A/R373K/M392T 685 + − − E43D/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/M253W/A257G/ 725 H271A/Q302K/N305L/L316D/M322I/A337P/K362Q/E367N/W368A/ R373K/M392T 686 − − + T10P/E17G/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/ 726 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 687 + − − L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q290R/Q302K/ 727 L316D/M322I/A337P/K362Q/E367N/W368A/R373K/M392T 688 + + − L44R/S47T/Y92H/S166P/K206A/F217R/P228Q/N247D/H271A/Q302K/ 728 L316D/M322I/A337P/K362Q/E367N/R373K/M392T 689 + + + L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/N305L/ 729 L316D/M322I/A337P/K362Q/E367N/R373K/M392T 690 + − − T10P/L44R/S47T/Y92H/M156V/S166P/K206A/F217R/N247D/H271A/ 730 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 691 + + + T10P/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 731 L316D/M322I/A337P/K362Q/E367N/R373K/M392T 692 − − − L44R/S47T/Y92H/S166P/K206A/F217R/N247D/W256L/H271A/Q302K/ 732 L316D/M322I/A337P/K362Q/E367N/R373K/M392T 693 + + + L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/L316D/ 733 M322I/A337P/K362Q/E367N/W368A/R373K/M392T 1. Relative activity was calculated as activity of the variant/activity of Rd7BB (SEQ ID NO: 44) (encoded by SEQ ID NO: 43). 2. − = <0.5 relative activity to Rd7BB (SEQ ID NO: 44); + = >0.5 to 1.5 relative activity over Rd7BB (SEQ ID NO: 44); and ++ = >1.5 relative activity over Rd7BB (SEQ ID NO: 44);

Example 3

In Vitro Characterization of GLA Variants

(155) Production of GLA in Yeast

(156) In order to produce GLA-containing supernatant, replica HTP-cultures of GLA were grown as described in Example 2. Supernatants from replica cultures (n=12-36) were combined prior to further analysis.

(157) Production of GLA in HEK293T Cells

(158) Secreted expression of GLA variants in mammalian cells was performed by transient transfection of HEK293 cells. Cells were transfected with GLA variants (SEQ ID NOS:3, 4, 9, 12, 17, 20, 23, and 41) fused to an N-terminal synthetic mammalian signal peptide and subcloned into the mammalian expression vector pLEV113 as described in Example 1. HEK293 cells were transfected with plasmid DNA and grown in suspension for 4 days using techniques known to those skilled in the art. Supernatants were collected and stored at 4° C.

Example 4

Purification of GLA Variants

(159) Purification of GLA Variants from Mammalian Cell Supernatants

(160) GLA variants were purified from mammalian culture supernatant essentially as known in the art (See, Yasuda et al., Prot. Exp. Pur. 37, 499-506 [2004]). Concanavalin A resin (Sigma Aldrich) was equilibrated with 0.1 M sodium acetate, 0.1 M NaCl, 1 mM MgCl.sub.2, CaCl.sub.2, and MnCl.sub.2 pH 6.0 (Con A binding buffer). Supernatant was diluted 1:1 with binding buffer and loaded onto the column. The column was washed with 15 volumes of Concanavalin A binding buffer, and samples were eluted by the addition of Concanavalin A binding buffer including 0.9 M methyl-α-D-mannopyranoside and 0.9 M methyl-α-D-glucopyranoside. Eluted protein was concentrated and buffer exchanged three times using a Centricon® Plus-20 filtration unit with a 10 kDa molecular weight cut off (Millipore) into ThioGal binding buffer (25 mM citrate-phosphate, 0.1 M NaCl, pH 4.8). Buffer exchanged samples were loaded onto a Immobilized-D-galactose resin (Pierce) equilibrated with ThioGal binding buffer. The resin was washed with six volumes of ThioGal binding buffer and eluted with 25 mM citrate phosphate, 0.1 M NaCl, 0.1 M D-galactose, pH 5.5. Eluted samples were concentrated using a Centricon® Plus-20 filtration unit with a 10 kDa molecular weight cut off. Purification resulted in between 2.4-10 g of purified protein/ml of culture supernatant based on Bradford quantitation.

(161) SDS-PAGE Analysis of GLA Variants

(162) Samples of yeast culture supernatant and mammalian cell culture supernatant and purified GLA were analyzed by SDS-PAGE. In the yeast supernatants, GLA levels were too low to be detected via this method. Bands corresponding to the ˜49 kDa predicted GLA molecular weight were found in both mammalian cell culture supernatants and purified GLA samples.

(163) Immunoblot Analysis of GLA Variants

(164) Samples of yeast supernatant and mammalian cell culture supernatant were analyzed by immunoblot. Briefly, samples were separated via SDS-PAGE. Protein was transferred to a PVDF membrane using an iBlot dry blot system (Life Technologies). The membrane was blocked with Odyssey blocking buffer (TBS) (LI-COR) for 1 h at RT and probed with a 1:250 dilution of rabbit α-GLA IgG (Thermo-Fischer) in Odyssey blocking buffer with 0.2% Tween® 20 for 14 h at 4° C. The membrane was washed 4×5 min with Tris-buffered saline+0.1% Tween® 20 and probed with a 1:5000 dilution of IRDye800CW donkey α-rabbit IgG (LI-COR) in Odyssey blocking buffer with 0.2% Tween® 20 and 0.01% SDS for 1 hr at RT. The membrane was washed 4×5 min with Tris-buffered saline+0.1% Tween® 20, and analyzed using an Odyssey Imager (LI-COR). Bands corresponding to the ˜49 kDa predicted GLA molecular weight were found in both the mammalian cell culture and yeast supernatants. In S. cerevisiae expressed samples, mutants containing the mutation E367N ran at a slightly higher MW. This mutation introduces a canonical NXT N-linked glycosylation site (where X is any amino acid except P) and the possible introduction of an additional N-linked glycan may account for the higher MW.

Example 5

In Vitro Characterization of GLA Variants

(165) Optimization of Signal Peptide for Secreted Expression of GLA by S. cerevisiae

(166) S. cerevisiae transformed with Mfleader-GLA (SEQ ID NO:7), SP-GLA (SEQ ID NO:36) or a vector control were grown in HTP as described in Example 2. Cultures were grown for 48-120 h prior to harvest of the supernatant and analysis (n=6) as described in Example 2. FIG. 1 provides a graph showing the relative activity of different GLA constructs in S. cerevisiae after 2-5 days of culturing. As indicated in this Figure, SP-GLA (SEQ ID NO:36) produced a high level of active enzyme that saturated after three days of growth.

(167) pH Stability of GLA Variants Expressed in S. cerevisiae

(168) GLA variants were challenged with different buffers to assess the overall stability of the enzyme. First, 50 μL of supernatant from a GLA variant yeast culture and 50 uL of McIlvaine buffer (pH 2.86-9.27) or 200 mM sodium carbonate (pH 9.69) were added to the wells of a 96-well round bottom plate (Costar #3798, Corning). The plates were sealed and incubated at 37° C. for 1 h. For the assay, 50 μL of challenged supernatant was mixed with 25 μL of 1 M citrate buffer pH 4.3 and 25 μL of 4 mM MUGal in McIlvaine buffer pH 4.8. The reactions were mixed briefly and incubated at 37° C. for 60-180 minutes, prior to quenching with 100 μL of 1 M sodium carbonate. Hydrolysis was analyzed using a SpectraMax® M2 microplate reader monitoring fluorescence (Ex. 355 nm, Em. 448 nm). FIG. 2 provides graphs showing the absolute (Panel A) and relative (Panel B) activity of GLA variants after incubation at various pHs.

(169) Thermostability of GLA Variants Expressed in S. cerevisiae

(170) GLA variants were challenged at various temperatures in the presence and absence of 1 M 1-deoxygalactonojirimycin (Migalastat; Toronto Research Chemicals) to assess the overall stability of the enzyme. First, 50 μL of supernatant from a GLA variant yeast culture and 50 uL of McIlvaine buffer (pH 7.65)+/−2 mM 1-deoxygalactonojirimycin were added to the wells of a 96-well PCR plate (Biorad, HSP-9601). The plates were sealed and incubated at 30-54° C. for 1 h using the gradient program of a thermocycler. For the assay, 50 μL of challenged supernatant was mixed with 25 μL of 1 M citrate buffer pH 4.3 and 25 μL of 4 mM MUGal in McIlvaine buffer pH 4.8. The reactions were mixed briefly and incubated at 37° C. for 90 minutes, prior to quenching with 100 μL of 1 M sodium carbonate. Hydrolysis was analyzed using a SpectraMax® M2 microplate reader monitoring fluorescence (Ex. 355 nm, Em. 448 nm). FIG. 3 provides graphs showing the absolute (Panel A) and relative (Panel B) activity of GLA variants after incubation at various temperatures.

(171) Serum Stability of GLA Variants Expressed in S. cerevisiae

(172) To assess the relative stability of variants in the presence of blood, samples were exposed to serum. First, 20 μL of supernatant from a GLA variant yeast culture and 0-80 μL of water and 0-80 L of bovine serum were added to the wells of a 96-well round bottom plate (Costar #3798, Corning). The plates were sealed and incubated at 37° C. for 1 h. For the assay, 50 μL of challenged supernatant was mixed with 25 μL of 1 M citrate buffer pH 4.3 and 25 μL of 4 mM MUGal in McIlvaine buffer pH 4.8. The reactions were mixed briefly and incubated at 37° C. for 90 minutes, prior to quenching with 100 μL of 1 M sodium carbonate. Hydrolysis was analyzed using a SpectraMax® M2 microplate reader monitoring fluorescence (Ex. 355 nm, Em. 448 nm). FIG. 4 provides graphs showing the absolute (Panels A and B) and relative (Panels C and D) activity of GLA variants after challenge with various percentages of serum.

(173) Relative Activities of GLA Variants Expressed in HEK293T Cells

(174) Supernatants from GLA variants expressed in HEKT293T cells were serially diluted 2× with supernatant from a non GLA expressing yeast culture. Dilutions (50 μL) were mixed with 25 μL of 4 mM MUGal in McIlvaine Buffer pH 4.8 and 25 μL of 1 M citrate buffer pH 4.3 in a Corning® 96-well, black, opaque bottom plate. The reactions were mixed briefly and incubated at 37° C. for 60 minutes, prior to quenching with 100 μL of 1 M sodium carbonate. Hydrolysis was analyzed using a SpectraMax® M2 microplate reader monitoring fluorescence (Ex. 355 nm, Em. 448 nm). FIG. 5 provides a graph showing the relative activity of GLA variants expressed in HEK293T cells. Supernatants from cells transfected with variant GLA enzymes showed markedly higher hydrolase activities compared to the WT enzymes, and much more activity per volume than was seen in S. cerevisiae expression.

(175) pH Stability of GLA Variants Expressed in HEK293T Cells

(176) GLA variants were challenged with different buffers to assess their overall stability. Supernatants from mammalian cell cultures were normalized to equal activities by dilution with supernatant from a non GLA expressing culture. Normalized supernatants (50 μL) and 50 uL of McIlvaine buffer (pH 4.06-8.14) were added to the wells of a 96-well round bottom plate (Costar #3798, Corning). The plates were sealed and incubated at 37° C. for 3 h. For the assay, 50 μL of challenged supernatant was mixed with 25 μL of 1 M citrate buffer pH 4.3 and 25 μL of 4 mM MUGal in McIlvaine buffer pH 4.8. The reactions were mixed briefly and incubated at 37° C. for 3 h, prior to quenching with 100 μL of 1 M sodium carbonate. Hydrolysis was analyzed using a SpectraMax® M2 microplate reader monitoring fluorescence (Ex. 355 nm, Em. 448 nm). FIG. 6 provides graphs showing the absolute (Panel A) and relative (Panel B) activity of GLA variants expressed in HEK293T cells, normalized for activity, and incubated at various pHs.

(177) All enzymes were found to be more stable versus pH challenges when compared to WT GLA expressed in S. cerevisiae (compare with FIG. 2). This difference is possibly due to differential glycosylation between expression hosts. However, it is not intended that the present invention be limited to any particular mechanism or theory. Mutant enzymes had broader pH stability profiles compared to the WT enzyme expressed in HEK293T.

(178) Thermostability of GLA Variants Expressed in HEK293T Cells

(179) GLA variants were challenged at various temperatures in the presence and absence of 1 M 1-deoxygalactonojirimycin (Migalastat) to assess their overall stability. Supernatants from mammalian cell cultures were normalized to approximately equal activities by dilution with supernatant from a non GLA expressing culture. Diluted supernatants were added to the wells of a 96-well PCR plate (Biorad, HSP-9601). The plates were sealed and incubated at 30-54° C. for 1 h using the gradient program of a thermocycler. For the assay, 20 μL of challenged supernatant was mixed with 30 μL of 1 M citrate buffer pH 4.3 and 50 μL of 4 mM MUGal in McIlvaine buffer pH 4.8. The reactions were mixed briefly and incubated at 37° C. for 90 minutes, prior to quenching with 100 μL of 1 M sodium carbonate. Hydrolysis was analyzed using a SpectraMax® M2 microplate reader monitoring fluorescence (Ex. 355 nm, Em. 448 nm). FIG. 7 provides graphs showing the absolute (Panel A) and relative (Panel B) activity of GLA variants expressed in HEK293T cells, normalized for activity, and incubated at various temperatures. As shown in this Figure, all of the enzymes were more stable after temperature challenges when compared to WT GLA expressed in S. cerevisiae (compare with FIG. 2), likely due to differential glycosylation between expression hosts. In the GLA variants (SEQ ID NOS:10 and 13) the T.sub.m of the enzyme was increased by 2 and 4° C. respectively. Addition of Migalastat increased the T.sub.m by 5.5° C., however at a 0.2 M final concentration in the assay, activity in the Migalastat treated sample was reduced by ˜60%.

(180) Activity of WT GLA and GLA Variants on an Alternative Substrate

(181) To confirm that improved activity in MUGal hydrolysis corresponded to more native substrates, mammalian cell-expressed GLA variants were assayed using N-Dodecanoyl-NBD-ceramide trihexoside (NBD-GB3) as substrate. HEK293T culture supernatant (10 μL), 100 mM sodium citrate pH 4.8 (80 μL), and NBD-GB3 (0.1 mg/ml) in 10% ethanol (10 μL) were added to microcentrifuge tubes. Samples were inverted to mix, and incubated at 37° C. for 1 h. The reaction was quenched via addition of 50 μL methanol, diluted with 100 μL chloroform, vortexed and the organic layer was isolated for analysis. The organic phase (10 μL) was spotted onto a silica plate and analyzed by thin layer chromatography (chloroform:methanol:water, 100:42:6), detecting the starting material and product using a 365 nm UV lamp. Significant conversion was observed only with SEQ ID NO:13, confirming that the variant exhibits improved activity, as compared to the WT GLA.

(182) Specific Activity of GLA Variants

(183) GLA variants purified as described in Example 4, were evaluated for their specific activity. Between 0-0.25 ng of purified enzyme was added to 4 mM MUGal in McIlvaine buffer pH 4.8 (final pH of 4.8). Samples were incubated for 60 min at 37° C. and quenched via addition of 100 μL of 1 M sodium carbonate. Hydrolysis was analyzed using a SpectraMax® M2 microplate reader monitoring fluorescence (Ex. 355 nm, Em. 448 nm), and correlated to absolute amounts of 4-methylumbelliferone through the use of a standard curve.

(184) pH Stability of Purified GLA Variants Over Time

(185) To confirm that purified GLA variants show the desired pH stability observed after expression in yeast, WT GLA (SEQ ID NO:5) and SEQ ID NO:42 were incubated in acidic or basic buffers and analyzed for residual activity. GLA variants (200 ng) were added to McIlvaine buffer pH 4.1 or 7.5 and incubated for 0-24 h at 37° C. Samples (50 μL) were added to a mixture of 25 uL 1M citric acid pH 4.3 and 25 μL of 4 mM MUGal in McIlvaine buffer pH 4.8, and incubated at 37° C. for 1 h. Samples were quenched with 100 μL of 1 M sodium carbonate, diluted 1:4 in 1 M sodium carbonate and analyzed by fluorescence spectroscopy (Ex. 355, Em. 448). SEQ ID NO:42 was considerably more stable under both acidic and basic challenge conditions confirming that stability advances developed in yeast translated to the protein expressed in mammalian cells (See FIG. 8 for graphs of the results).

(186) Thermostability of Purified GLA Variants Expressed in HEK293T Cells

(187) The thermostability of WT GLA (SEQ ID NO:5) and SEQ ID NO:42 were determined to assess their overall stability. Purified enzyme as described in Example 4 was diluted to 20 μg/ml in 1×PBS with 1× Sypro Orange (Thermo Fischer Scientific), and added to a 96-well PCR plate (Biorad, HSP-9601). The plates were heated from 30 to 75° C. at 0.5° C./min on a RT-PCR machine and Sypro Orange fluorescence was monitored. Under these conditions WT GLA melted at 37° C., while SEQ ID NO:42 melted at 55° C.

Example 6

In Vivo Characterization of GLA Variants

(188) Serum Pharmacokinetics of Purified GLA Variants

(189) Purified GLA variants produced as described in Example 4 were assessed for stability in the serum of live rats. WT GLA (SEQ ID NO:5) or SEQ ID NO:42 at 1 mg/ml were administered intravenously at 1 ml/kg to three naïve jugular vein cannulated Sprague-Dawley rats (7-8 weeks old) each. Prior to administration and at 5, 15, 30, 60, 120, and 240 minutes post-administration, 200 μL of blood was collected from each rat in an EDTA tube and centrifuged at 4° C. and 6000 rpm to generate >80 μL of serum per sample. Samples were frozen and stored on dry ice prior to analysis. For analysis, serum (10 μL) was added to 40 μL of 5 mM MUGal in McIlvaine buffer pH 4.4, and incubated at 37° C. for 1 h. Samples were quenched with 50 μL of 1 M sodium carbonate, diluted 1:100 in 1 M sodium carbonate and analyzed by fluorescence spectroscopy (Ex. 355, Em. 448). Four hours post-administration SEQ ID NO:42 retained 15.3% of maximal activity, while WT GLA retained only 0.66% (See, FIG. 9).

Example 7

Deimmunization of GLA

(190) In this Example, experiments conducted to identify diversity that would remove predicted T-cell epitopes from GLA are described.

(191) Identification of Deimmunizing Diversity:

(192) To identify mutational diversity that would remove T-cell epitopes, computational methods were used to identify GLA subsequences that were predicted to bind efficiently to representative HLA receptors. In addition, experimental searches for amino acid mutations were conducted, particularly for mutations that do not affect GLA activity (e.g., in the assays described in Example 2). The amino acid sequences of active variants were then analyzed for predicted immunogenicity using computational methods.

(193) Computational Identification of Putative T-Cell Epitopes in a WT GLA:

(194) Putative T-cell epitopes in a WT GLA (SEQ ID NO:5) were identified using the Immune Epitope Database (IEDB; Immune Epitope Database and Analysis Resource website) tools, as known in the art and proprietary statistical analysis tools (See e.g., iedb.org and Vita et al., Nucl. Acids Res., 38(Database issue):D854-62 [2010]. Epub 2009 Nov. 11]). The WT GLA was parsed into all possible 15-mer analysis frames, with each frame overlapping the last by 14 amino acids. The 15-mer analysis frames were evaluated for immunogenic potential by scoring their 9-mer core regions for predicted binding to eight common class II HLA-DR alleles (DRB1*0101, DRB1*0301, DRB1*0401, DRB1*0701, DRB1*0801, DRB1*1101, DRB1*1301, and DRB1*1501) that collectively cover nearly 95% of the human population (See e.g., Southwood et al., J. Immunol., 160:3363-3373 [1998]), using methods recommended on the IEDB website. Potential T-cell epitope clusters contained within the enzyme (i.e., sub-regions contained within GLA which have an unusually high potential for immunogenicity) were identified using statistical analysis tools, as known in the art. The identified T-cell epitope clusters were screened against the IEDB database of known epitopes. These screens identified five putative T-cell epitopes in the WT enzyme. These epitopes are referred to as TCE-I, II, III, IV, and V below.

(195) Design of Deimmunizing Libraries:

(196) First, the sequences of active GLA mutants identified in Example 2 are assessed for the presence of T-cell epitopes. Mutations identified to potentially reduce binding to the HLA-DR alleles are incorporated into a recombination library. Additional libraries are prepared using saturation mutagenesis of every single amino acid within the five T-cell epitopes. Hits from these libraries are subjected to further rounds of saturation mutagenesis, HTP screening, and recombination to remove all possible T-cell epitopes.

(197) Construction and Screening of Deimmunizing Libraries:

(198) Combinatorial and saturation mutagenesis libraries designed as described above were constructed by methods known in the art, and tested for activity in an unchallenged assay as described in Example 2. Active variants were identified and sequenced. Their activities and mutations with respect to WT GLA are provided in the table below.

(199) Identification of Deimmunizing Diversity:

(200) Active variants were analyzed for their levels of predicted immunogenicity by evaluating their binding to the eight common Class II HLA-DR alleles as described above. The total immunogenicity score and immunogenic hit count are shown in Table 7.1. The total immunogenicity score (TIS) reflects the overall predicted immunogenicity of the variant (i.e., a higher score indicates a higher level of predicted immunogenicity). The immunogenic “hit count” (IHC) indicates the number of 15-mer analysis frames with an unusually high potential for immunogenicity (i.e., a higher score indicates a higher potential for immunogenicity). Mutations resulting in a lower total immunogenicity score and/or an immunogenic hit count less than that of the reference sequence were considered to be potential “deimmunizing mutations”. A collection of the most deimmunizing mutations were recombined to generate a number of variants that were active and predicted to be significantly less immunogenic than WT GLA. In the following Table, total immunogenicity score (TIS) and immunogenic hit count (IHC) are provided.

(201) TABLE-US-00011 TABLE 7.1 Total Immunogenicity Score (TIS), and Immunogenic Hit Count (IHC) for GLA Variants Variant SEQ ID # NO: Active Mutations TIS IHC 5 WT GLA 450 38 33 79 A199H/E367S 468 47 34 80 A337P 444 38 1 47 A337S 449 38 35 81 A339S 450 38 36 82 A350G 450 38 296 337 A66T/K206A/F217R/L316D/M322I/A337P/K343G/A350G/E367N/R373K 429 38 200 244 C143A/K206A 429 38 201 245 C143T/K206A 429 38 202 246 C59A/K206A 427 38 37 83 D105A 458 38 38 84 D105S 462 38 39 85 D124N/E147G/N161K/R162Q/T163V/R165A/I167S/V168I/Y169V/ 425 35 S170-/M177S/F217E 516 557 D2E/L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/ 386 24 Q326G/A337P/K362Q/E367N/R373K 517 558 D2Q/L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/ 393 24 A337P/K362Q/E367N/R373K 667 707 D30G/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/ 345 8 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 40 86 D396R 451 38 41 87 D396T 452 38 42 88 E367N 462 43 43 89 E367T 462 45 44 90 E387K 460 38 45 91 E387Q 457 38 46 92 E387R 457 38 47 93 E387T 459 38 48 94 E40D 445 33 518 560 E40D/L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/ 390 24 A337P/K362Q/E367N/R373K 519 561 E40S/L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/ 407 25 A337P/K362Q/E367N/R373K 2 48 E43D 450 37 3 49 E43D/E48D 449 37 4 50 E43D/E48D/I208V/N247D/Q299R/Q302K/R373K/I376V 434 36 5 51 E43D/E48D/I208V/R373K 429 36 6 52 E43D/E48D/I208V/R373K/I376V 428 36 7 53 E43D/E48D/N247D/Q299R/Q302K/R373K/I376V 448 36 8 54 E43D/E48D/N247D/Q302K/R373K 442 36 9 55 E43D/E48D/Q302K/R373K/I376V 442 36 10 56 E43D/I208V/N247D 435 37 11 57 E43D/I208V/N247D/Q299R/R373K/I376V 435 36 12 58 E43D/I208V/Q299R/R373K/I376V 436 36 663 703 E43D/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/A261G/ 315 1 H271A/Q302K/L316D/M322I/A337P/K362Q/E367N/W368A/ R373K/M392T 685 725 E43D/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/M253W/ 334 7 A257G/H271A/Q302K/N305L/L316D/M322I/A337P/K362Q/ E367N/W368A/R373K/M392T 634 674 E43D/L44R/Y92E/S166P/K206A/F217R/N247D/Q302K/L316D/ 362 21 M322I/A337P/K362Q/E367N/R373K 635 375 E43D/L44R/Y92H/S166P/K206A/F217R/N247D/Q302K/L316D/ 378 21 M322I/A337P/K362Q/E367N/R373K 636 376 E43D/L44R/Y92N/S166P/K206A/F217R/N247D/Q302K/L316D/ 366 21 M322I/A337P/K362Q/E367N/R373K 633 673 E43D/L44R/Y92S/S166P/K206A/F217R/N247D/Q302K/L316D/ 365 21 M322I/A337P/K362Q/E367N/R373K 13 59 E43D/N247D/R373K/I376V 442 36 14 60 E43D/R373K/I376V 443 36 637 377 E43Q/L44R/Y92E/S166P/K206A/F217R/N247D/Q302K/L316D/ 370 21 M322I/A337P/K362Q/E367N/R373K 15 61 E48D/I208V/Q299R/Q302K/R373K 437 37 16 62 E48D/R373K/I376V 443 37 17 63 E48G/R373K 444 37 49 95 F180R 454 38 50 96 F180S 449 38 51 97 F198S 450 38 52 98 F217D 450 38 53 99 F217R 450 38 18 64 F217S 452 38 54 100 F352I 450 38 55 101 F352V/F365I 447 38 56 102 F365I 447 38 57 103 F365K 446 38 58 104 F365E 448 38 59 105 F365R 447 38 60 106 F365T 436 38 61 107 F365V 447 38 62 108 G303Q/R373V 465 38 63 109 H155A 451 38 64 110 H155E 455 41 65 111 H155R 452 39 66 112 H155T 449 38 213 255 H15Q/K206A 429 38 67 113 H375E 437 36 68 114 H84S 450 38 69 115 I102L 450 38 70 116 I102L/L394V 449 37 71 117 I123T/T369N 449 38 72 118 I167V 438 37 19 65 I208V/N247D/Q299R/Q302K/R373K/I376V 435 37 20 66 I208V/N247D/Q299R/R373K/I376V 435 37 21 67 I208V/N247D/R373K/I376V 428 37 22 68 I208V/Q299R/I376V 436 37 23 69 I208V/Q302K/R373K/I376V 429 37 24 70 I376V 443 37 73 10 K206A 429 38 196 240 K206A/A350G 429 38 197 241 K206A/A350G/K362Q/T369A 413 38 198 242 K206A/A350G/T369D 426 38 199 243 K206A/A350G/T369S 429 38 203 247 K206A/E367A/T369D 439 42 204 248 K206A/E367D 427 38 205 21 K206A/E367D/T369D 419 37 206 18 K206A/E367N 441 43 207 249 K206A/E367N/R373K 430 38 208 250 K206A/E367N/R373K/I376V 429 38 209 251 K206A/E367P/T369D 430 38 297 338 K206A/F217R/G230V/N247D/Q302K/M322I/E367N/T369S/R373K 453 42 233 274 K206A/F217R/N247D/L316D/A350G/E367D/T369D 416 37 298 339 K206A/F217R/N247D/L316D/M322I/A337P/A350G/K362Q/E367N/ 420 37 R373K 299 340 K206A/F217R/N247D/Q249H/Q302K/M322I/K343G/A350G/E367T/ 434 40 R373K/L397F 234 275 K206A/F217R/N247D/Q302K/A350G/E367D/T369D 418 37 235 276 K206A/F217R/N247D/Q302K/L316D/A337P/A350G/E367D/T369D 410 37 236 277 K206A/F217R/Q302K/E367D/T369D 419 37 237 278 K206A/F217R/Q302K/L316D/A337P/A350G/E367D/T369D 411 37 210 252 K206A/F365L/E367N 439 41 211 253 K206A/F365L/E367N/I376V 435 40 212 254 K206A/F365L/E367N/R373K/I376V 435 40 238 279 K206A/I208V/M322V/K343G/F365L/R373K/I376V 415 37 239 280 K206A/I208V/R221K/N247D/M322I/K343D/F365L/R373K/I376V 425 37 300 341 K206A/I208V/R221T/N247D/M322V/K343G/E367N/R373K 424 38 214 256 K206A/K343D/F365L/E367N 433 41 215 257 K206A/K343G 424 38 216 258 K206A/K343G/F365L/E367N/R373K 431 40 240 281 K206A/L269I/P349L/R373K 428 42 217 289 K206A/L316D 427 38 218 13 K206A/M322I/E367N/R373K 442 38 301 342 K206A/M322I/E367N/R373K 442 38 219 260 K206A/M322I/R373K 435 37 302 343 K206A/M322V/K343G/E367N/R373K 425 38 220 261 K206A/M322V/R373K/I376V 422 37 221 262 K206A/M390I 414 33 303 344 K206A/N247D/M322I/A337E/K343D/F365L/E367N/R373K/I376V 440 40 241 282 K206A/N247D/M322V/K343D/R373K/I376V 415 37 242 283 K206A/N247D/M322V/K343G/F365L/R373K 415 37 243 284 K206A/N247D/Q302K/A337P/K343G/A350G 417 38 244 285 K206A/N247D/Q302K/L316D/A350G 426 38 245 286 K206A/N247D/Q302K/M322V/F365L/R373K/I376V 419 37 222 263 K206A/P228Q/T369D 426 38 223 264 K206A/Q302K/A337P/A350G/K362Q 408 38 246 287 K206A/Q302K/L316D/A337P 421 38 304 345 K206A/Q302K/L316D/M322I/A337P/A350G/K362Q/E367N/T369S/ 431 42 R373K 305 346 K206A/Q302K/L316D/M322I/A337P/K343D/E367N/T369S/R373K 438 42 224 265 K206A/Q302K/M322V/E367N 441 43 247 288 K206A/R221K/N247D/M322V/K343D/R373K 416 37 306 347 K206A/R221K/N247D/Q302K/M322I/E367N/R373K 441 38 307 348 K206A/R221K/Q302K/M322I/K343G/E367N/R373K/I376V 436 38 226 267 K206A/R221T/F365L 427 38 248 289 K206A/R221T/M322V/K343G/R373K 418 37 249 290 K206A/R221T/M322V/R373K 423 37 227 268 K206A/R325H 429 38 228 269 K206A/R373K 423 37 229 270 K206A/R373K/I376V 422 37 230 271 K206A/S374R 433 40 231 272 K206A/T369D 426 38 232 273 K206A/T369S 429 38 192 236 K206E 429 38 193 237 K206G 429 38 74 119 K206M 458 44 75 120 K206Q 450 38 76 24 K206R 450 38 194 238 K206R 450 38 195 239 K206S 429 38 77 121 K206T/V359S 437 44 78 122 K343D 444 38 79 123 K343G 445 38 80 124 K362Q 435 38 81 125 K362R 449 38 82 126 K36D 452 38 83 127 K36E 450 38 25 71 K36Q 450 38 84 128 K395* 432 34 85 129 K395G 448 37 86 130 K395P 448 37 87 131 K395R 451 38 88 132 K395S 450 38 89 133 K395T 448 37 90 134 K96I 433 36 250 291 K96I/K206A/F217R 412 36 308 349 K96I/K206A/F217R/M322I/E367N/T369S/R373K 434 40 251 292 K96I/K206A/F217R/N247D 411 36 252 293 K96I/K206A/F217R/N247D/A350G/E367D/T369D 401 35 253 294 K96I/K206A/F217R/N247D/Q302K/E316D/A337P/E367D/T369D 393 35 309 350 K96I/K206A/F217R/N247D/Q302K/M322I/A337P/K343G/A350G/ 413 36 E367N/R373K 310 351 K96I/K206A/N247D/M322I/A350G/E367N/T369S/R373K 433 40 311 352 K96I/K206A/N247D/Q302K/E316D/M322I/A337P/A350G/E367N/ 425 40 T369S/R373K 312 353 K96I/K206A/N247D/Q302K/E316D/M322I/A337P/A350G/K362Q/ 413 40 E367N/T369S/R373K 91 135 K96E 434 36 92 136 K96R 443 37 93 137 K96R/E397V 442 36 94 138 E100F 442 38 313 354 L100F/A125S/K206A/I208V/R221K/Q302K/M322I/K343G/E367N/ 429 38 R373K 254 295 L100F/K206A 421 38 314 355 L100F/K206A/I208V/N247D/Q302K/M322V/K343D/E367N/R373K/ 414 38 I376V 315 356 L100F/K206A/I208V/Q302K/M322V/F365L/E367N/R373K/I376V 427 40 316 357 L100F/K206A/I208V/R221K/M322V/K343D/E367N/R373K 416 38 317 358 L100F/K206A/I208V/R221K/M322V/K343D/F365L/E367N/R373K 422 40 255 296 L100F/K206A/I208V/R221K/N247D/Q302K/M322I/K343D/F365L/ 417 37 I376V 256 297 L100F/K206A/I208V/R221K/N247D/Q302K/M322V/K343D/F365L/ 405 37 I376V 318 359 L100F/K206A/I208V/R221T/M322V/E367N/R373K/I376V 421 38 257 298 L100F/K206A/I208V/R221T/N247D/K343D/F365L/I376V 405 37 258 299 L100F/K206A/I208V/R221T/Q302K/M322I/K343D/I376V 420 37 319 360 L100F/K206A/M322I/E367N/R373K/I376V 433 38 259 300 L100F/K206A/M322V/F365L/R373K/I376V 412 37 260 301 L100F/K206A/N247D/F365L/R373K/I376V 411 37 261 302 L100F/K206A/N247D/M322V/K343D/I376V 407 37 320 361 L100F/K206A/N247D/Q302K/M322I/E367N/R373K 433 38 321 362 L100F/K206A/R221K/N247D/M322I/K343G/E367N/R373K 428 38 262 303 L100F/K206A/R221K/N247D/Q302K/M322V/F365L/R373K/I376V 411 37 263 304 L100F/K206A/R221K/N247D/Q302K/M322V/I376V 413 37 264 305 L100F/K206A/R221K/N247D/Q302K/M322V/K343D/R373K/I376V 407 37 265 306 L100F/K206A/R221K/R373K/I376V 414 37 266 307 L100F/K206A/R221T/M322I/K343E/F365L/R373K 419 37 267 308 L100F/K206A/R221T/N247D/Q302K/K343D/F365L/R373K 406 37 322 363 L100F/K206A/R221T/Q302K/M322I/K343D/E367N/R373K 428 38 268 309 L100F/K206A/R373K/I376V 414 37 323 364 L100F/L160I/K206A/R221K/M322V/E367N/R373K 424 42 647 387 L14F/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 345 8 L316D/M322I/A337P/K362Q/E367N/R373K/M392T 95 139 L158A 437 35 96 140 L158I 458 42 97 141 L158M 450 40 98 142 L158R 431 35 99 143 L23M 450 38 324 365 L23S/K206A/M322I/E367N/R373K 442 38 100 144 L23T 450 38 101 145 L316D 448 38 102 146 L316E 448 38 269 310 L37I/K206A/R221K/N247D/M322I/R373K 434 37 103 147 L384F 448 35 104 148 L386V 436 31 105 149 L394A 449 37 106 150 L394R 450 38 107 151 L394S 450 38 108 152 L394T 449 37 109 153 L397* 442 36 110 154 L397D 449 37 111 155 L397H 450 38 112 156 L397I 449 37 113 157 L397Q 449 37 114 158 L397R 449 37 115 159 L397T 449 37 116 160 L398E 449 37 117 161 L398G 450 38 118 162 L398N 449 37 119 163 L398Q 450 38 120 164 L398R 449 37 368 409 L44A/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 36 E367N/R373K 362 403 L44C/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 32 E367N/R373K 360 401 L44E/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 32 E367N/R373K 374 415 L44M/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 33 E367N/R373K 370 411 L44Q/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 36 E367N/R373K 398 439 L44R/A159S/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 34 K362Q/E367N/R373K 520 561 L44R/A77S/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/ 393 24 A337P/K362Q/E367N/R373K 270 311 L44R/C143Y/K206A/A337P/A350G 430 38 521 562 L44R/D52N/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/ 393 24 A337P/K362Q/E367N/R373K 271 312 L44R/E187G/K206A/A337P/A350G 430 38 522 563 L44R/E56K/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/ 393 24 A337P/K362Q/E367N/R373K 382 423 L44R/H94N/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 30 K362Q/E367N/R373K 386 427 L44R/H94R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 34 K362Q/E367N/R373K 272 313 L44R/K206A 436 38 273 314 L44R/K206A/E367D/T369D 426 37 274 315 L44R/K206A/F217R/A350G 436 38 275 316 L44R/K206A/F217R/N247D/A337P 429 38 439 480 L44R/K206A/F217R/N247D/H271A/Q302K/L316D/M322I/A337P/ N.D. 36 K362Q/E367N/R373K 425 466 L44R/K206A/F217R/N247D/H271E/Q302K/L316D/M322I/A337P/ N.D. 36 K362Q/E367N/R373K 436 477 L44R/K206A/F217R/N247D/H271G/Q302K/L316D/M322I/A337P/ N.D. 36 K362Q/E367N/R373K 433 474 L44R/K206A/F217R/N247D/H271Q/Q302K/L316D/M322I/A337P/ N.D. 36 K362Q/E367N/R373K 452 493 L44R/K206A/F217R/N247D/H271R/Q302K/L316D/M322I/A337P/ N.D. 36 K362Q/E367N/R373K 430 471 L44R/K206A/F217R/N247D/H271T/Q302K/L316D/M322I/A337P/ N.D. 36 K362Q/E367N/R373K 441 482 L44R/K206A/F217R/N247D/H271V/Q302K/L316D/M322I/A337P/ N.D. 36 K362Q/E367N/R373K 435 476 L44R/K206A/F217R/N247D/I258L/Q302K/L316D/M322I/A337P/ N.D. 34 K362Q/E367N/R373K 450 491 L44R/K206A/F217R/N247D/I258M/Q302K/L316D/M322I/A337P/ N.D. 36 K362Q/E367N/R373K 442 483 L44R/K206A/F217R/N247D/L255A/Q302K/L316D/M322I/A337P/ N.D. 34 K362Q/E367N/R373K 429 470 L44R/K206A/F217R/N247D/L255C/Q302K/L316D/M322I/A337P/ N.D. 34 K362Q/E367N/R373K 424 465 L44R/K206A/F217R/N247D/L255E/Q302K/L316D/M322I/A337P/ N.D. 34 K362Q/E367N/R373K 443 484 L44R/K206A/F217R/N247D/L255S/Q302K/L316D/M322I/A337P/ N.D. 35 K362Q/E367N/R373K 449 490 L44R/K206A/F217R/N247D/L255T/Q302K/L316D/M322I/A337P/ N.D. 35 K362Q/E367N/R373K 432 473 L44R/K206A/F217R/N247D/L255V/Q302K/L316D/M322I/A337P/ N.D. 36 K362Q/E367N/R373K 440 481 L44R/K206A/F217R/N247D/L263C/Q302K/L316D/M322I/A337P/ N.D. 33 K362Q/E367N/R373K 437 478 L44R/K206A/F217R/N247D/L263E/Q302K/L316D/M322I/A337P/ N.D. 29 K362Q/E367N/R373K 445 486 L44R/K206A/F217R/N247D/L263F/Q302K/L316D/M322I/A337P/ N.D. 34 K362Q/E367N/R373K 427 468 L44R/K206A/F217R/N247D/L263G/Q302K/L316D/M322I/A337P/ N.D. 34 K362Q/E367N/R373K 447 488 L44R/K206A/F217R/N247D/L263W/Q302K/L316D/M322I/A337P/ N.D. 33 K362Q/E367N/R373K 276 317 L44R/K206A/F217R/N247D/L316D/A350G/E367D/T369D 417 37 277 318 L44R/K206A/F217R/N247D/L316D/A337P/E367D/T369D 417 37 278 319 L44R/K206A/F217R/N247D/L316D/A350G/E367D/T369D 423 37 325 366 L44R/K206A/F217R/N247D/L316D/M322I/A337P/K343G/K362Q/ 422 37 E367N/R373K 446 487 L44R/K206A/F217R/N247D/M259A/Q302K/L316D/M322I/A337P/ N.D. 31 K362Q/E367N/R373K 426 467 L44R/K206A/F217R/N247D/M259E/Q302K/L316D/M322I/A337P/ N.D. 30 K362Q/E367N/R373K 428 469 L44R/K206A/F217R/N247D/M259S/Q302K/L316D/M322I/A337P/ N.D. 34 K362Q/E367N/R373K 451 492 L44R/K206A/F217R/N247D/M259V/Q302K/L316D/M322I/A337P/ N.D. 35 K362Q/E367N/R373K 444 485 L44R/K206A/F217R/N247D/M259W/Q302K/L316D/M322I/A337P/ N.D. 30 K362Q/E367N/R373K 279 320 L44R/K206A/F217R/N247D/Q302K/A350G 435 38 326 367 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/K362Q/E367N/ 427 37 R373K 513 554 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 32 E367N/R373K/D396* 512 553 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 32 E367N/R373K/K395* 508 549 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 30 E367N/R373K/L384A 477 518 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 34 E367N/R373K/L384W 474 515 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 35 E367N/R373K/L386F 502 543 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 30 E367N/R373K/L386S 460 501 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 30 E367N/R373K/L386T 515 556 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 32 E367N/R373K/L394* 511 552 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 32 E367N/R373K/L397* 500 541 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 36 E367N/R373K/M390A 486 527 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 35 E367N/R373K/M390C 490 531 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 30 E367N/R373K/M390D 476 517 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 30 E367N/R373K/M390E 494 535 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 30 E367N/R373K/M390F 481 522 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 30 E367N/R373K/M390G 459 500 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 30 E367N/R373K/M390H 497 538 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 30 E367N/R373K/M390K 454 495 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 30 E367N/R373K/M390P 465 506 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 30 E367N/R373K/M390Q 480 521 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 30 E367N/R373K/M390R 504 545 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 32 E367N/R373K/M390S 463 504 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 34 E367N/R373K/M390T 496 537 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 32 E367N/R373K/M390V 491 532 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 30 E367N/R373K/M390W 457 498 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 34 E367N/R373K/M392A 483 524 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 34 E367N/R373K/M392C 455 496 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 35 E367N/R373K/M392D 466 507 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 35 E367N/R373K/M392E 479 520 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 30 E367N/R373K/M392F 501 542 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 30 E367N/R373K/M392G 498 539 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 34 E367N/R373K/M392I 472 513 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 35 E367N/R373K/M392K 473 514 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 33 E367N/R373K/M392L 505 546 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 30 E367N/R373K/M392N 493 534 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 30 E367N/R373K/M392P 461 502 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 35 E367N/R373K/M392Q 478 519 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 36 E367N/R373K/M392S 507 548 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 30 E367N/R373K/M392T 484 525 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 34 E367N/R373K/M392V 485 526 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 30 E367N/R373K/M392W 503 544 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 30 E367N/R373K/Q385C 482 523 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 30 E367N/R373K/Q385G 469 510 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 36 E367N/R373K/Q385I 462 503 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 36 E367N/R373K/Q385L 509 550 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 30 E367N/R373K/Q385T 506 547 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 30 E367N/R373K/Q385W 514 555 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 31 E367N/R373K/S393* 492 533 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 32 E367N/R373K/T389C 475 516 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 30 E367N/R373K/T389D 487 528 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 30 E367N/R373K/T389G 489 530 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 36 E367N/R373K/T389I 499 540 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 35 E367N/R373K/T389L 456 497 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 35 E367N/R373K/T389M 488 529 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 30 E367N/R373K/T389N 495 536 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 34 E367N/R373K/T389P 468 509 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 30 E367N/R373K/T389Q 467 508 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 30 E367N/R373K/T389S 471 512 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 30 E367N/R373K/T389W 327 368 L44R/K206A/F217R/N247D/Q302K/L316D/M322I/K343D/A350G/ 427 37 K362Q/E367N/R373K 434 475 L44R/K206A/F217R/N247D/R270D/Q302K/L316D/M322I/A337P/ N.D. 36 K362Q/E367N/R373K 431 472 L44R/K206A/F217R/N247D/R270G/Q302K/L316D/M322I/A337P/ N.D. 36 K362Q/E367N/R373K 453 494 L44R/K206A/F217R/N247D/R270L/Q302K/L316D/M322I/A337P/ N.D. 36 K362Q/E367N/R373K 448 489 L44R/K206A/F217R/N247D/R270Q/Q302K/L316D/M322I/A337P/ N.D. 36 K362Q/E367N/R373K 280 321 L44R/K206A/F217R/Q302K/E367D/T369D 426 37 328 369 L44R/K206A/F217R/Q302K/M322I/A337P/A350G/E367N/T369S/ 452 42 R373K 329 370 L44R/K206A/I208V/N247D/Q302K/M322I/K343D/E367N/R373K 442 38 330 371 L44R/K206A/I208V/R221K/M322I/K343D/E367N/R373K 443 38 281 322 L44R/K206A/I208V/R221K/M322V/K343D/F365L/R373K 422 37 331 372 L44R/K206A/I208V/R221K/N247D/Q302K/M322I/K343D/E367N/ 441 38 R373K/I376V 332 373 L44R/K206A/I208V/R221T/Q302K/M322I/K343G/F365L/E367N/ 449 40 R373K/I376V 333 374 L44R/K206A/L316D/M322I/A337P/A350G/E367N/T369S/R373K 450 42 282 323 L44R/K206A/N247D/A337P 429 38 334 375 L44R/K206A/N247D/L316D/M322I/A350G/K362Q/E367N/T369S/ 443 42 R373K 283 324 L44R/K206A/N247D/Q302K/A337P/A350G/E367D/T369D 419 37 335 376 L44R/K206A/N247D/Q302K/L316D/M322I/A337P/K343G/A350G/ 432 42 K362Q/E367N/T369S/R373K 336 377 L44R/K206A/N247D/Q302K/M322I/A350G/E367N/T369S/R373K 457 42 337 378 L44R/K206A/N247D/Q302K/M322I/K343D/E367N/R373K 442 38 284 325 L44R/K206A/R221T/N247D/M322I/K343D/F365L/I376V 432 37 285 326 L44R/K96I/K206A 419 36 286 327 L44R/K96I/K206A/F217R/N247D 418 36 338 379 L44R/K96I/K206A/F217R/N247D/L316D/M322I/A337P/A350G/ 410 35 K362Q/E367N/R373K 339 380 L44R/K96I/K206A/F217R/N247D/M322I/A350G/K362Q/E367N/ 418 35 R373K 340 381 L44R/K96I/K206A/F217R/N247D/M322I/A350G/K362Q/E367N/ 428 40 T369S/R373K 341 382 L44R/K96I/K206A/F217R/N247D/M322I/E367N/T369S/R373K 440 40 287 328 L44R/K96I/K206A/F217R/N247D/Q302K/A337P/A350G 412 36 288 329 L44R/K96I/K206A/F217R/N247D/Q302K/A337P/K343D/A350G/ 397 35 E367D/T369D 342 383 L44R/K96I/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ 423 36 E367N/R373K 343 384 L44R/K96I/K206A/F217R/N247D/Q302K/M322I/E367N/T369S/ 440 40 R373K 344 385 L44R/K96I/K206A/F217R/N247D/Q302K/M322I/K362Q/E367N/ 418 35 R373K 345 386 L44R/K96I/K206A/F217R/Q219P/N247D/M253K/S266F/D284E/ 429 41 Q290P/L293F/Q302K/V308G/S314F/M322I/A337P/K343E/E367N/ R373K 289 330 L44R/K96I/K206A/F217R/Q302K/A350G 419 36 346 387 L44R/K96I/K206A/F217R/Q302K/M322I/A350G/K362Q/E367N/ 429 40 T369S/R373K 347 388 L44R/K96I/K206A/M322I/A337P/E367N/T369S/R373K 435 40 290 331 L44R/K96I/K206A/N247D/L316D/A337P/A350G/E367D/T369D 400 35 291 332 L44R/L100F/K206A/F365L 426 38 292 333 L44R/L100F/K206A/I208V/Q219H/N247D/Q302K/M322V/K343D/ 416 37 R373K/I376V 348 389 L44R/L100F/K206A/I208V/R221K/M322I/K343G/F365L/E367N/ 442 40 R373K 293 334 L44R/L100F/K206A/I208V/R221K/N247D/Q302K/M322V/F365L/ 418 37 I376V 349 390 L44R/L100F/K206A/I208V/R221T/N247D/M322I/F365L/E367N/ 446 40 R373K 350 391 L44R/L100F/K206A/I208V/R221T/N247D/M322V/E367N/R373K/ 427 38 I376V 294 335 L44R/L100F/K206A/I208V/R221T/N247D/M322V/I376V 420 37 295 336 L44R/L100F/K206A/I208V/R221T/N247D/Q302K/M322I/K343D/ 424 37 F365L/R373K/I376V 351 392 L44R/L100F/K206A/I208V/R221T/Q302K/M322I/E367N/R373K/ 440 38 I376V 352 393 L44R/L100F/K206A/Q302K/M322I/E367N/R373K/I376V 440 38 353 394 L44R/L100F/K206A/R221K/M322I/F365L/E367N/R373K/I376V 446 40 354 395 L44R/L100F/K206A/R221T/M322I/F365L/E367N/R373K 447 40 355 396 L44R/L100F/K206A/R221T/N247D/M322I/K343D/E367N/R373K/ 433 38 I376V 356 397 L44R/L100F/K206A/R221T/N247D/Q302K/M322I/E367N/R373K 440 38 357 398 L44R/L100F/K206A/R221T/N247D/Q302K/M322V/E367N/R373K/ 427 38 I376V 358 399 L44R/L100F/K206A/R221T/Q302K/M322I/E367N/R373K 441 38 359 400 L44R/L100F/Q181L/K206A/R221T/N247D/Q302K/M322V/E367N/ 429 38 R373K/I376V 400 441 L44R/L158C/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 34 K362Q/E367N/R373K 405 446 L44R/L158E/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 34 K362Q/E367N/R373K 422 463 L44R/L158G/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 34 K362Q/E367N/R373K 407 448 L44R/L158H/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 34 K362Q/E367N/R373K 396 437 L44R/L158M/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 39 K362Q/E367N/R373K 414 455 L44R/L158Q/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 34 K362Q/E367N/R373K 397 438 L44R/L158R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 34 K362Q/E367N/R373K 121 165 L44R/L384F 455 35 418 459 L44R/N161E/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 34 K362Q/E367N/R373K 523 564 L44R/N91M/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/ 396 28 A337P/K362Q/E367N/R373K 524 565 L44R/N91V/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/ 398 27 A337P/K362Q/E367N/R373K 525 566 L44R/Q76H/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/ 388 23 A337P/K362Q/E367N/W368A/R373K 423 464 L44R/R162A/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 35 K362Q/E367N/R373K 416 457 L44R/R162G/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 34 K362Q/E367N/R373K 410 451 L44R/R162H/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 34 K362Q/E367N/R373K 406 447 L44R/R162K/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 34 K362Q/E367N/R373K 421 462 L44R/R162Q/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 36 K362Q/E367N/R373K 417 458 L44R/R162S/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 36 K362Q/E367N/R373K 409 450 L44R/R165H/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 36 K362Q/E367N/R373K 399 440 L44R/R165K/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 36 K362Q/E367N/R373K 526 567 L44R/R74H/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/ 393 24 A337P/K362Q/E367N/R373K 411 452 L44R/S166A/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 34 K362Q/E367N/R373K 415 456 L44R/S166D/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 34 K362Q/E367N/R373K 419 460 L44R/S166E/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 34 K362Q/E367N/R373K 404 445 L44R/S166F/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 36 K362Q/E367N/R373K 403 444 L44R/S166G/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 35 K362Q/E367N/R373K 412 453 L44R/S166H/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 34 K362Q/E367N/R373K 402 42 L44R/S166P/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 34 K362Q/E367N/R373K 408 449 L44R/S166R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 36 K362Q/E367N/R373K 420 461 L44R/S166T/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 34 K362Q/E367N/R373K 363 404 L44R/S47D/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 36 K362Q/E367N/R373K 375 416 L44R/S47I/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 36 K362Q/E367N/R373K 365 406 L44R/S47N/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 36 K362Q/E367N/R373K 623 664 L44R/S47N/S166P/K206A/F217R/N247D/H271A/A276S/Q302K/ 386 25 L316D/M322I/A337P/K362Q/E367N/R373K/M392T 624 665 L44R/S47N/S166P/K206A/F217R/N247D/H271A/Q302K/L316D/ 385 25 M322I/A337P/K362Q/E367N/R373K/M390Q 628 668 L44R/S47N/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 350 12 L316D/M322I/A337P/K362Q/E367N/R373K/M390H 613 654 L44R/S47N/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 351 12 L316D/M322I/A337P/K362Q/E367N/R373K/M390Q 632 672 L44R/S47N/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 352 12 L316D/M322I/A337P/K362Q/E367N/R373K/M392T 627 667 L44R/S47N/Y92H/S166P/K206A/F217R/N247D/M259W/H271A/ 311 5 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M390H/M392T 622 663 L44R/S47N/Y92H/S166P/K206A/F217R/N247D/M259W/H271A/ 305 5 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M390Q/M392T 615 656 L44R/S47N/Y92H/S166P/K206A/F217R/N247D/Q302K/L316D/ 352 13 M322I/A337P/K362Q/E367N/R373K/M390H 361 402 L44R/S47R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 36 K362Q/E367N/R373K 631 671 L44R/S47T/A53S/Y92H/S166P/K206A/F217R/N247D/H271A/ 344 8 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M390Q 379 420 L44R/S47T/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 32 K362Q/E367N/R373K 675 715 L44R/S47T/M65V/Y92H/S166P/K206A/F217R/N247D/H271A/ 344 8 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 657 697 L44R/S47T/P67T/Y92H/S166P/K182N/K206A/F217R/N247D/ 338 8 H271A/Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 629 669 L44R/S47T/S166P/K206A/F217R/N247D/H271A/Q302K/L316D/ 378 21 M322I/A337P/K362Q/E367N/R373K/M390Q 659 699 L44R/S47T/W64L/Y92H/S166P/K206A/F217R/N247D/H271A/ 345 8 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 672 712 L44R/S47T/Y92H/D144Y/S166P/K206A/F217R/N247D/H271A/ 351 8 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 646 686 L44R/S47T/Y92H/G113C/S166P/K206A/F217R/N247D/H271A/ 345 8 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 644 684 L44R/S47T/Y92H/S166P/K206A/F217R/L237P/N247D/H271A/ 338 8 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 687 727 L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q290R/ 340 7 Q302K/L316D/M322I/A337P/K362Q/E367N/W368A/R373K/M392T 618 659 L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 361 15 L316D/M322I/A337P/K362Q/E367N/R373K 619 660 L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 343 8 L316D/M322I/A337P/K362Q/E367N/R373K/M390H 620 661 L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 344 8 L316D/M322I/A337P/K362Q/E367N/R373K/M390Q 625 44 L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 345 8 L316D/M322I/A337P/K362Q/E367N/R373K/M392T 673 713 L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 331 7 L316D/M322I/A337P/K362Q/E367N/R373K/N377Y/M392T 693 733 L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 340 7 L316D/M322I/A337P/K362Q/E367N/W368A/R373K/M392T 682 722 L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 348 8 L316Y/M322I/A337P/K362Q/E367N/R373K/M392T 670 710 L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 345 8 N305L/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 689 729 L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 345 8 N305L/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 684 724 L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 340 7 N305L/L316D/M322I/A337P/K362Q/E367N/W368A/R373K/M392T 678 718 L44R/S47T/Y92H/S166P/K206A/F217R/N247D/M253W/A257G/ 339 7 H271A/K277R/Q281L/Q302K/L316D/A319D/M322I/A337P/K362Q/ E367N/R373K/M392T 677 717 L44R/S47T/Y92H/S166P/K206A/F217R/N247D/M253W/H271A/ 338 7 S273D/P274S/K277R/Q302K/L316D/M322I/A337P/K362Q/E367N/ R373K/M392T 621 662 L44R/S47T/Y92H/S166P/K206A/F217R/N247D/M259E/H271A/ 307 1 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M390Q 610 651 L44R/S47T/Y92H/S166P/K206A/F217R/N247D/M259E/Q302K/ 310 2 L316D/M322I/A337P/K362Q/E367N/R373K/M390Q 630 670 L44R/S47T/Y92H/S166P/K206A/F217R/N247D/M259W/H271A/ 311 1 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M390H 616 657 L44R/S47T/Y92H/S166P/K206A/F217R/N247D/M259W/H271A/ 312 1 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M390Q 669 709 L44R/S47T/Y92H/S166P/K206A/F217R/N247D/P262S/H271A/ 353 8 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 614 655 L44R/S47T/Y92H/S166P/K206A/F217R/N247D/Q302K/L316D/ 363 16 M322I/A337P/K362Q/E367N/R373K 692 732 L44R/S47T/Y92H/S166P/K206A/F217R/N247D/W256L/H271/ 347 8 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 666 706 L44R/S47T/Y92H/S166P/K206A/F217R/P228L/N247D/H271A/ 345 8 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 688 728 L44R/S47T/Y92H/S166P/K206A/F217R/P228Q/N247D/H271A/ 345 8 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 674 714 L44R/S47T/Y92H/S166P/K206A/F217R/P234H/N247D/H271A/ 345 8 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 662 702 L44R/S47T/Y92H/S166P/K206A/F217R/V238I/N247D/H271A/ 347 8 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 652 692 L44R/S47T/Y92H/S166P/K206A/F217R/W246P/N247D/A261G/ 312 1 H271A/Q302K/N305L/L316D/M322I/A337P/K362Q/E367N/R373K/ M392T 655 695 L44R/S47T/Y92H/S166P/K206A/F217R/W246P/N247D/A261G/ 307 0 H271A/Q302K/N305L/L316D/M322I/A337P/K362Q/E367N/W368A/ R373K/M392T 645 685 L44R/S47T/Y92H/S166P/P174S/K206A/F217R/N247D/H271A/ 340 8 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 661 701 L44R/S47T/Y92H/S166P/W195C/K206A/F217R/N247D/H271A/ 345 8 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 366 407 L44R/S47V/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 36 K362Q/E367N/R373K 401 442 L44R/T163S/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 34 K362Q/E367N/R373K 388 429 L44R/V93L/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 36 K362Q/E367N/R373K 389 430 L44R/V93S/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 29 K362Q/E367N/R373K 387 428 L44R/V93T/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 31 K362Q/E367N/R373K 385 426 L44R/Y92A/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 25 K362Q/E367N/R373K 383 424 L44R/Y92C/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 24 K362Q/E367N/R373K 527 568 L44R/Y92E/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ 377 24 K362Q/E367N/R373K 393 434 L44R/Y92G/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 24 K362Q/E367N/R373K 528 569 L44R/Y92H/D130Q/K206A/F217R/N247D/Q302K/L316D/M322I/ 393 24 A337P/K362Q/E367N/R373K 529 570 L44R/Y92H/K182A/K206A/F217R/N247D/Q302K/L316D/M322I/ 386 24 A337P/K362Q/E367N/R373K 530 571 L44R/Y92H/K182E/K206A/F217R/N247D/Q302K/L316D/M322I/ 386 24 A337P/K362Q/E367N/R373K 531 572 L44R/Y92H/K182H/K206A/F217R/N247D/Q302K/L316D/M322I/ 386 24 A337P/K362Q/E367N/R373K 532 573 L44R/Y92H/K182M/K206A/F217R/N247D/Q302K/L316D/M322I/ 386 24 A337P/K362Q/E367N/R373K 533 574 L44R/Y92H/K182Q/K206A/F217R/N247D/Q302K/L316D/M322I/ 386 24 A337P/K362Q/E367N/R373K 534 575 L44R/Y92H/K182R/K206A/F217R/N247D/Q302K/L316D/M322I/ 386 24 A337P/K362Q/E367N/R373K 535 576 L44R/Y92H/K182T/K206A/F217R/N247D/Q302K/L316D/M322I/ 386 24 A337P/K362Q/E367N/R373K 536 577 L44R/Y92H/K182V/K206A/F217R/N247D/Q302K/L316D/M322I/ 386 24 A337P/K362Q/E367N/R373K 537 578 L44R/Y92H/K182Y/K206A/F217R/N247D/Q302K/L316D/M322I/ 386 24 A337P/K362Q/E367N/R373K 538 579 L44R/Y92H/K206A/F217R/N247D/A287C/Q302K/L316D/M322I/ 392 24 A337P/K362Q/E367N/R373K 539 580 L44R/Y92H/K206A/F217R/N247D/A287H/Q302K/L316D/M322I/ 394 24 A337P/K362Q/E367N/R373K 540 581 L44R/Y92H/K206A/F217R/N247D/A287M/Q302K/L316D/M322I/ 404 24 A337P/K362Q/E367N/R373K 541 582 L44R/Y92H/K206A/F217R/N247D/K283A/Q302K/L316D/M322I/ 384 24 A337P/K362Q/E367N/R373K 542 583 L44R/Y92H/K206A/F217R/N247D/K283G/Q302K/L316D/M322I/ 387 24 A337P/K362Q/E367N/R373K 543 584 L44R/Y92H/K206A/F217R/N247D/K283M/Q302K/L316D/M322I/ 385 24 A337P/K362Q/E367N/R373K 544 585 L44R/Y92H/K206A/F217R/N247D/K283V/Q302K/L316D/M322I/ 385 24 A337P/K362Q/E367N/R373K 545 586 L44R/Y92H/K206A/F217R/N247D/K295A/Q302K/L316D/M322I/ 393 24 A337P/K362Q/E367N/R373K 546 587 L44R/Y92H/K206A/F217R/N247D/K295E/Q302K/L316D/M322I/ 392 24 A337P/K362Q/E367N/R373K 547 588 L44R/Y92H/K206A/F217R/N247D/K295L/Q302K/L316D/M322I/ 409 24 A337P/K362Q/E367N/R373K 548 589 L44R/Y92H/K206A/F217R/N247D/K295N/Q302K/L316D/M322I/ 391 24 A337P/K362Q/E367N/R373K 549 590 L44R/Y92H/K206A/F217R/N247D/K295Q/Q302K/L316D/M322I/ 393 24 A337P/K362Q/E367N/R373K 550 591 L44R/Y92H/K206A/F217R/N247D/K295S/Q302K/L316D/M322I/ 393 24 A337P/K362Q/E367N/R373K 551 592 L44R/Y92H/K206A/F217R/N247D/K295T/Q302K/L316D/M322I/ 392 24 A337P/K362Q/E367N/R373K 552 593 L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/A317D/M322I/ 393 24 A337P/K362Q/E367N/R373K 553 594 L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/A317Q/M322I/ 393 24 A337P/K362Q/E367N/R373K 554 595 L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ 388 24 A346G/K362Q/E367N/R373K 555 596 L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ 395 24 G344A/K362Q/E367N/R373K 556 597 L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ 388 24 G344D/K362Q/E367N/R373K 557 598 L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ 388 24 G344S/K362Q/E367N/R373K 558 599 L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ 391 24 I353L/K362Q/E367N/R373K 559 600 L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ 386 23 K362Q/E367N/L372W/R373K 395 40 L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 24 K362Q/E367N/R373K 560 601 L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ 388 23 K362Q/E367N/W368A/R373K 561 602 L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ 412 31 K362Q/E367N/W368L/R373K 562 603 L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ 393 24 K362Q/E367N/W368N/R373K 563 604 L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ 400 28 K362Q/E367N/W368R/R373K 564 605 L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ 407 29 K362Q/E367N/W368V/R373K 565 606 L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ 393 24 N348E/K362Q/E367N/R373K 566 607 L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ 393 24 N348M/K362Q/E367N/R373K 567 608 L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ 393 24 N348Q/K362Q/E367N/R373K 568 609 L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ 393 24 N348R/K362Q/E367N/R373K 569 610 L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ 393 24 N348W/K362Q/E367N/R373K 570 611 L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ 391 24 T354S/K362Q/E367N/R373K 571 612 L44R/Y92H/K206A/F217R/N247D/Q302K/N305K/L316D/M322I/ 400 24 A337P/K362Q/E367N/R373K 572 613 L44R/Y92H/K206A/F217R/N247D/Q302K/N305L/L316D/M322I/ 393 24 A337P/K362Q/E367N/R373K 573 614 L44R/Y92H/K206A/F217R/N247D/Q302K/S314A/L316D/M322I/ 393 24 A337P/K362Q/E367N/R373K 574 615 L44R/Y92H/K206A/F217R/N247D/Q302K/S314H/L316D/M322I/ 395 24 A337P/K362Q/E367N/R373K 575 616 L44R/Y92H/K206A/F217R/N247D/Q302K/S314N/L316D/M322I/ 388 24 A337P/K362Q/E367N/R373K 576 617 L44R/Y92H/K206A/F217R/N247D/Q302K/S314Y/L316D/M322I/ 388 24 A337P/K362Q/E367N/R373K 577 618 L44R/Y92H/K206A/F217R/W246A/N247D/Q302K/L316D/M322I/ 395 24 A337P/K362Q/E367N/R373K 578 619 L44R/Y92H/K206A/F217R/W246I/N247D/Q302K/L316D/M322I/ 399 24 A337P/K362Q/E367N/R373K 579 620 L44R/Y92H/K206A/F217R/W246P/N247D/Q302K/L316D/M322I/ 387 24 A337P/K362Q/E367N/R373K 580 621 L44R/Y92H/K206A/F217R/W246R/N247D/Q302K/L316D/M322I/ 396 24 A337P/K362Q/E367N/R373K 581 622 L44R/Y92H/K206A/F217R/W246S/N247D/Q302K/L316D/M322I/ 402 24 A337P/K362Q/E367N/R373K 582 623 L44R/Y92H/K206A/S210A/F217R/N247D/Q302K/L316D/M322I/ 393 24 A337P/A350T/K362Q/E367N/R373K 583 624 L44R/Y92H/K206A/S210A/F217R/N247D/Q302K/L316D/M322I/ 393 24 A337P/K362Q/E367N/R373K 584 625 L44R/Y92H/K206A/S210E/F217R/N247D/Q302K/L316D/M322I/ 393 24 A337P/K362Q/E367N/R373K 585 626 L44R/Y92H/K206A/S210K/F217R/N247D/Q302K/L316D/M322I/ 407 24 A337P/K362Q/E367N/R373K 586 627 L44R/Y92H/K206A/S210N/F217R/N247D/Q302K/L316D/M322I/ 393 24 A337P/K362Q/E367N/R373K 587 628 L44R/Y92H/K206A/S210R/F217R/N247D/Q302K/L316D/M322I/ 408 24 A337P/K362Q/E367N/R373K 588 629 L44R/Y92H/K96A/K206A/F217R/N247D/Q302K/L316D/M322I/ 380 24 A337P/K362Q/E367N/R373K 589 630 L44R/Y92H/K96W/K206A/F217R/N247D/Q302K/L316D/M322I/ 399 26 A337P/K362Q/E367N/R373K 617 658 L44R/Y92H/L136V/S166P/K206A/F217R/N247D/M259A/Q302K/ 347 8 L316D/M322I/A337P/K362Q/E367N/R373K/M390Q 590 631 L44R/Y92H/P179M/K206A/F217R/N247D/Q302K/L316D/M322I/ 414 29 A337P/K362Q/E367N/R373K 591 632 L44R/Y92H/R189K/K206A/F217R/N247D/Q302K/L316D/M322I/ 390 24 A337P/K362Q/E367N/R373K 592 633 L44R/Y92H/R189V/K206A/F217R/N247D/Q302K/L316D/M322I/ 398 24 A337P/K362Q/E367N/R373K 626 666 L44R/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/L316D/ 358 13 M322I/A337P/K362Q/E367N/R373K/M390Q 611 652 L44R/Y92H/S166P/K206A/F217R/N247D/Q302K/L316D/M322I/ 360 14 A337P/K362Q/E367N/R373K/M390Q 612 953 L44R/Y92H/S166P/K206A/F217R/N247D/Q302K/L316D/M322I/ 361 14 A337P/K362Q/E367N/R373K/M392T 593 634 L44R/Y92H/S95A/K206A/F217R/N247D/Q302K/L316D/M322I/ 396 27 A337P/K362Q/E367N/R373K 594 635 L44R/Y92H/S95E/K206A/F217R/N247D/Q302K/L316D/M322I/ 375 24 A337P/K362Q/E367N/R373K 595 636 L44R/Y92H/T186A/K206A/F217R/N247D/Q302K/L316D/M322I/ 393 24 A337P/K362Q/E367N/R373K 596 637 L44R/Y92H/T186G/K206A/F217R/N247D/Q302K/L316D/M322I/ 393 24 A337P/K362Q/E367N/R373K 597 638 L44R/Y92H/T186V/K206A/F217R/N247D/Q302K/L316D/M322I/ 401 24 A337P/K362Q/E367N/R373K 598 639 L44R/Y92H/Y120H/K206A/F217R/N247D/Q302K/L316D/M322I/ 393 24 A337P/K362Q/E367N/R373K 599 640 L44R/Y92H/Y120S/K206A/F217R/N247D/Q302K/L316D/M322I/ 393 24 A337P/K362Q/E367N/R373K 600 641 L44R/Y92H/Y120S/K206A/F217R/N247D/Q302K/L316D/M322I/ 388 24 A337P/L341F/K362Q/E367N/R373K 380 421 L44R/Y92K/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 24 K362Q/E367N/R373K 390 431 L44R/Y92Q/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 24 K362Q/E367N/R373K 394 435 L44R/Y92R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 30 K362Q/E367N/R373K 381 422 L44R/Y92S/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 24 K362Q/E367N/R373K 392 433 L44R/Y92T/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 24 K362Q/E367N/R373K 384 425 L44R/Y92V/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 35 K362Q/E367N/R373K 369 410 L44S/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 36 E367N/R373K 122 166 L44T 456 37 378 419 L44T/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 36 E367N/R373K 372 413 L44V/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 36 E367N/R373K 371 412 L44W/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/K362Q/ N.D. 32 E367N/R373K 123 167 M20D/Q302K 450 38 124 168 M253F 444 38 125 169 M322I 462 38 126 170 M390D 425 31 127 171 M390R 430 31 128 172 M390T 438 35 129 173 M392G 435 31 130 174 M392P 433 31 131 175 M392S 448 37 601 642 M39C/L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/ 367 19 A337P/K362Q/E367N/R373K 683 723 M39E/E43D/L44R/S47T/Y92H/S166P/K206A/F217R/W246P/N247D/ 309 6 M253W/H271A/S273D/Q302K/L316D/M322I/A337P/K362Q/E367N/ W368A/R373K/M392T 660 700 M39E/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/A261G/H271A/ 302 1 Q302K/N305L/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 668 708 M39E/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 329 8 L316D/M322I/A337P/K362Q/E367N/R373K/M392T 676 716 M39E/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 324 7 L316D/M322I/A337P/K362Q/E367N/W368A/R373K/M392T 639 679 M39E/L44R/S47T/Y92H/S166P/K206A/F217R/N247Y/H271A/Q302K/ 343 8 L316D/M322I/A337P/K362Q/E367N/R373K/M392T 658 698 M39E/L44R/S47T/Y92H/S166P/K206A/F217R/W246P/N247D/H271A/ 323 8 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 602 643 M39E/L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ 363 19 K362Q/E367N/R373K 364 405 M39H/L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 32 K362Q/E367N/R373K 367 408 M39R/L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 32 K362Q/E367N/R373K 603 644 M39R/L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/ 368 19 A337P/K362Q/E367N/R373K 377 418 M39T/L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 32 K362Q/E367N/R373K 604 645 M39V/L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/ 393 24 A337P/K362Q/E367N/R373K 132 176 M39Y 451 37 376 417 M41P/L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 35 K362Q/E367N/R373K 373 414 M41R/L44R/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ N.D. 36 K362Q/E367N/R373K 133 177 N388R 454 38 134 178 N91Q 438 32 26 72 P179S/R373K 430 37 135 179 Q190S/T369D 448 38 136 180 Q249A 449 38 27 73 Q299R/M322V/R373K 451 37 28 74 Q299R/Q302K/R373K 451 37 29 75 Q299R/Q302K/R373K/I376V 450 37 137 181 Q302A 450 38 30 76 Q302K/I376V 443 37 138 182 Q385H 435 32 139 183 Q385I 447 38 140 184 Q385L 445 38 141 185 Q391G 449 36 142 186 Q80A 450 38 143 187 Q80H 450 38 144 188 Q80V 459 38 145 189 Q88A 448 38 146 190 Q88F 456 38 147 191 Q88H 448 38 148 192 Q88R 448 38 149 193 Q88S 448 38 150 194 R162H 446 35 151 195 R162S 450 37 225 226 R165S/K206A 427 39 152 196 R221K/A350G 450 38 153 197 R221T 450 38 154 198 R301I/K362T 449 41 155 199 R301L 450 38 156 200 R371S 456 39 157 201 R371V 452 40 31 77 R373K 444 37 32 78 R373K/I376V 443 37 665 705 R7C/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 340 7 L316D/M322I/A337P/K362Q/E367N/W368A/R373K/M392T 650 690 R7H/T10P/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/ 345 8 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 681 721 R7P/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 345 8 L316D/M322I/A337P/K362Q/E367N/R373K/M392T 654 694 R7S/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 345 8 L316D/M322I/A337P/K362Q/E367N/R373K/M392T 158 202 R87K 435 32 159 203 R87P/L398R 423 31 160 204 S166A 440 35 161 205 S166H 447 35 162 206 S166K 441 35 163 207 S31D 450 38 164 208 S34D/M392P 439 31 165 209 S34G 450 38 166 210 S34H/M390R 430 31 167 211 S34R 450 38 168 212 S374M 454 40 169 213 S374T 439 37 170 214 S393E 447 37 171 215 S393G 447 37 172 216 S393H 454 38 173 217 S393P 452 37 174 218 S47I 450 38 175 219 S47R 459 38 176 220 S47T 433 33 177 221 S95D 422 31 178 222 S95E 414 31 179 223 S95Q 446 36 686 728 T10P/E17G/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/ 352 8 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 642 682 T10P/E43D/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/A261G/ 315 1 H271A/Q302K/N305L/L316D/M322I/A337P/K362Q/E367N/W368A/ R373K/M392T 690 730 T10P/L44R/S47T/Y92H/M156V/S166P/K206A/F217R/N247D/H271A/ 333 8 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 638 678 T10P/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/A261G/H271A/ 318 1 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 651 691 T10P/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 345 8 L316D/M322I/A337P/K362Q/E367N/R373K/M392T 691 731 T10P/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 345 8 L316D/M322I/A337P/K362Q/E367N/R373K/M392T 671 711 T10P/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 340 7 L316D/M322I/A337P/K362Q/E367N/W368A/R373K/M392T 643 683 T10P/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/Q302K/ 335 8 L316D/M322I/R325S/A337P/K362Q/E367N/R373K/M392T 664 704 T10P/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/Q252H/M253R/ 312 2 A254E/A261G/H271A/Q302K/L316D/M322I/A337P/K362Q/E367N/ R373K/M392T 656 696 T10P/L44R/S47T/Y92H/S166P/K206A/F217R/W246P/N247D/A261G/ 312 1 H271A/Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 653 693 T10P/L44R/S47T/Y92H/S166P/K206A/F217R/W246P/N247D/H271A/ 339 8 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 605 646 T10P/L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ 393 24 K362Q/E367N/R373K 606 647 T10P/L44R/Y92H/R189L/K206A/F217R/N247D/Q302K/L316D/M322I/ 395 24 A337P/K362Q/E367N/R373K 640 680 T10P/M39E/E43D/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/ 329 8 H271A/Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 648 46 T10P/M39E/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/A261G/ 297 0 H271A/Q302K/L316D/M322I/A337P/K362Q/E367N/W368A/R373K/M392T 680 720 T10P/M39E/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/ 329 8 Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 679 719 T10P/M39E/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/H271A/ 329 8 Q302K/N305L/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 641 681 T10P/M39E/L44R/S47T/Y92H/S166P/K206A/F217R/N247D/S266P/ 313 8 H271A/Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 649 689 T10P/M39E/L44R/S47T/Y92H/S166P/K206A/F217R/W246P/N247D/ 323 8 H271A/Q302K/L316D/M322I/A337P/K362Q/E367N/R373K/M392T 180 224 T369D 447 38 181 225 T369S 450 38 182 226 T389S 436 31 607 648 T8L/L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ 398 24 K362Q/E367N/R373K 608 649 T8Q/L44R/Y92H/K206A/F217R/N247D/Q302K/L316D/M322I/A337P/ 393 24 K362Q/E367N/R373K 183 227 V133I 457 38 184 228 V168A 434 37 185 229 V168L 445 38 186 230 V345N 447 38 187 231 V345Y 449 38 188 232 V359E 429 38 189 233 V93I 443 37 190 234 W178H 448 38 191 235 W178S 442 38 N.D.—Not determined.

(202) While the invention has been described with reference to the specific embodiments, various changes can be made and equivalents can be substituted to adapt to a particular situation, material, composition of matter, process, process step or steps, thereby achieving benefits of the invention without departing from the scope of what is claimed.

(203) For all purposes in the United States of America, each and every publication and patent document cited in this application is incorporated herein by reference as if each such publication or document was specifically and individually indicated to be incorporated herein by reference. Citation of publications and patent documents is not intended as an indication that any such document is pertinent prior art, nor does it constitute an admission as to its contents or date.