Monoclonal antibody FnAb8 and application thereof
10995142 · 2021-05-04
Assignee
Inventors
Cpc classification
A61K47/00
HUMAN NECESSITIES
A61K47/6425
HUMAN NECESSITIES
C12N15/113
CHEMISTRY; METALLURGY
C12N15/625
CHEMISTRY; METALLURGY
C07K2317/94
CHEMISTRY; METALLURGY
A61K47/65
HUMAN NECESSITIES
C07K16/283
CHEMISTRY; METALLURGY
C07K16/28
CHEMISTRY; METALLURGY
International classification
C07K16/28
CHEMISTRY; METALLURGY
A61K47/64
HUMAN NECESSITIES
A61K39/00
HUMAN NECESSITIES
C12N15/113
CHEMISTRY; METALLURGY
A61K47/65
HUMAN NECESSITIES
Abstract
Provided in the present invention are a monoclonal antibody FnAb8 and application thereof.
Claims
1. An anti-human FcRn antibody, or a fusion protein thereof or an immunoconjugate thereof, wherein the antibody has a heavy chain and a light chain, wherein the heavy chain has a heavy chain variable region having the following three complementary determining regions (CDRs): CDR1 as shown in SEQ ID NO: 4, CDR2 as shown in SEQ ID NO: 6 and CDR3 as shown in SEQ ID NO: 8; and the light chain has a light chain variable region having the following three complementary determining regions (CDRs): CDR1′ as shown in SEQ ID NO: 14, CDR2′ as shown in SEQ ID NO: 16, and CDR3′ as shown in SEQ ID NO: 18; or wherein the heavy chain has a heavy chain variable region having the following three complementary determining regions (CDRs): CDR1 as shown in SEQ ID NO: 22, CDR2 as shown in SEQ ID NO: 24 and CDR3 as shown in SEQ ID NO: 26; and the light chain has a light chain variable region having the following three complementary determining regions (CDRs): CDR1′ as shown in SEQ ID NO: 30, CDR2′ as shown in SEQ ID NO: 32, and CDR3′ as shown in SEQ ID NO: 34.
2. The antibody of claim 1, wherein the heavy chain further has a heavy chain constant region and the light chain further has a light chain constant region.
3. The antibody of claim 2, wherein the heavy chain constant region is of human or mouse; and the light chain constant region is of human or mouse.
4. The antibody of claim 1, wherein the antibody comprises a single chain antibody (scFv), a double chain antibody, a monoclonal antibody, a chimeric antibody, a murine antibody or a humanized antibody.
5. The antibody of claim 1, wherein the heavy chain variable region has the amino acid sequence as shown in SEQ ID NO: 10; and the light chain variable region has the amino acid sequence as shown in SEQ ID NO: 20.
6. The antibody of claim 1, wherein the heavy chain variable region has the amino acid sequence as shown in SEQ ID NO: 28; and the light chain variable region has the amino acid sequence as shown in SEQ ID NO: 36.
7. The antibody of claim 1, or a fusion protein thereof or an immunoconjugate thereof wherein the immunoconjugate comprises: (a) the antibody; and (b) a coupling moiety selected from the group consisting of a detectable label, a drug, a toxin, a cytokine, a radionuclide, and an enzyme.
8. The antibody of claim 7, or a fusion protein thereof or an immunoconjugate thereof, wherein the coupling moiety is GLP1 peptide or a fragment thereof.
9. The antibody of claim 7, or a fusion protein thereof or an immunoconjugate thereof, wherein the coupling moiety is a peptide as shown in SEQ ID No. 2.
10. A pharmaceutical composition which comprises: (i) an antibody of claim 1, or a fusion protein thereof, or an immunoconjugate thereof; and (ii) a pharmaceutically acceptable carrier.
11. The pharmaceutical composition of claim 10, which is in the form of an injection.
12. The pharmaceutical composition of claim 10, wherein the fusion protein has the amino acid sequence as shown in SEQ ID No. 11.
13. The pharmaceutical composition of claim 10, wherein the fusion protein has the amino acid sequence as shown in SEQ ID No. 12.
14. The antibody of claim 1 wherein the antibody is a single chain antibody (scFv).
15. The antibody of claim 1 wherein the antibody binds specifically to the human FcRn in a pH-dependent manner.
Description
DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
DETAILED DESCRIPTION OF THE INVENTION
(7) Through extensive and intensive researches, the inventors have discovered a monoclonal antibody which binds to hFcRn. The experimental results show that the sequence obtained by the present invention is coupled with a protein or polypeptide, and the half-life and efficacy of the protein or polypeptide can be greatly prolonged through FcRn cycle protection mechanism.
(8) Before describing the present invention, it should be understood that the invention is not limited to the described particular methodology and experimental conditions, as such methods and conditions may be varied. It is also to be understood that the terminology used herein is only for the purpose of describing particular embodiments, and is not intended to be limiting, and the scope of the invention will be limited only by the appended claims.
(9) Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by the ordinary skilled in the art to which this invention belongs. As used herein, the term “about” when used in reference to a particular listed value means that the value can vary from the listed value by no more than 1%. For example, as used herein, the expression of “about 100” includes all values between 99 and 101 (for example, 99.1, 99.2, 99.3, 99.4, etc.).
(10) Although any methods and materials similar or equivalent to those described in this disclosure may be used in the practice or testing of the present invention, the preferred methods and materials are exemplified herein.
(11) FcRn
(12) The monoclonal antibodies of the present invention are against FcRn (neonatal Fc receptor) and have a significant pH-dependent binding to FcRn.
(13) In one aspect of the present invention, a monoclonal antibody is provided, and the monoclonal antibody specifically binds to FcRn, and the binding of the monoclonal antibody to FcRn is pH dependent.
(14) In a preferred embodiment of the invention, if the binding activity of the monoclonal antibody to FcRn is A1 at about pH≥7.0 (preferably ≥7.2, more preferably ≥7.4; most preferably ≥7.6; and pH≤8.5); the binding activity of the monoclonal antibody to FcRn is A2 at about pH≤6.8 (preferably ≤6.6, more preferably ≤6.4; most preferably ≤6.2; and pH≥3.0); then A1/A2≥100 (preferably ≥200, more preferably ≥400; most preferably ≥600; and pH≤10). The binding activity of the monoclonal antibody to FcRn can be detected by conventional methods in the art, as reported in Reference 1.
(15) In a preferred embodiment of the invention, the amino acid sequence of FcRn is:
(16) TABLE-US-00001 (SEQ ID NO.: 1) 10 20 30 40 50 MGVPRPQPWA LGLLLFLLPG SLGAESHLSL LYHLTAVSSP APGTPAFWVS 60 70 80 90 100 GWLGPQQYLS YNSLRGEAEP CGAWVWENQV SWYWEKETTD LRIKEKLFLE 110 120 130 140 150 AFKALGGKGP YTLQGLLGCE LGPDNTSVPT AKFALNGEEF MNFDLKQGTW 160 170 180 190 200 GGDWPEALAI SQRWQQQDKA ANKELTFLLF SCPHRLREHL ERGRGNLEWK 210 220 230 240 250 EPPSMRLKAR PSSPGFSVLT CSAFSFYPPE LQLRFLRNGL AAGTGQGDFG 260 270 280 290 300 PNSDGSFHAS SSLTVKSGDE HHYCCIVQHA GLAQPLRVEL ESPAKSSVLV 310 320 330 340 350 VGIVIGVLLL TAAAVGGALL WRRMRSGLPA PWISLRGDDT GVLLPTPGEA 360 QDADLKDVNV IPATA
(17) Antibody
(18) The term “antibody” or “immunoglobulin” as used herein refers to a heterotetrameric glycoprotein with the same structural feature of about 150,000 daltons, which consists of two identical light chains (L) and two identical heavy chains (H). Each light chain is linked to a heavy chain by a covalent disulfide bond, and the numbers of disulfide bonds between the heavy chains of different immunoglobulin isoforms are different. Each heavy and light chain also has regularly spaced intrachain disulfide bonds. Each heavy chain has a variable region (VH) at one end, followed by a plurality of constant regions. Each light chain has a variable region (VL) at one end and a constant region at the other end; the constant region of the light chain corresponds to the first constant region of the heavy chain; and the variable region of the light chain corresponds to the variable region of the heavy chain. There is an interface formed between the variable regions of the light and heavy chains by particular amino acid residues.
(19) As used herein, the term “variable” means that some certain portions of the variable region of an antibody differ in sequence and contribute to the binding and specificity of each particular antibody to its particular antigen. However, the variability is not evenly distributed throughout the antibody variable region. It is concentrated in three regions in the light and heavy chain variable regions called complementary determining regions (CDRs) or hypervariable regions. The relatively conserved portions of the variable regions are referred as framework regions (FRs). The variable regions of the natural heavy and light chains each comprises four FR regions, which are in a substantially β-folded configuration, and are linked by three CDRs that form the linker ring and, in some cases, form a partial β-folded structure. The CDRs in each chain stand close together through FR regions and form the antigen-binding site of the antibody together with the CDRs of the other chain (see Kabat et al., NIH Publ. No. 91-3242, Vol. I, 647-669 (1991)). Constant regions are not directly involved in the binding of the antibodies to the antigens, but they exhibit different effector functions, such as antibody-dependent cytotoxicity involved in antibodies.
(20) The ‘light chain’ of vertebrate antibody (immunoglobulin) could be divided into two distinct types (κ or λ) according to the amino acid sequences of constant region. Based on the amino acid sequences of heavy chain constant region, immune globulins could be divided into different species. There are five classes of immunoglobulins: IgA, IgD, IgE, IgG and IgM, some of them could be further divided into subclass: IgG1, IgG2, IgG3, IgG4, IgA and IgA2. The heavy chain constant regions corresponding to different classes of immunoglobulins could be named as α, δ, ε, γ and μ. The subunit structures and 3D configurations of different immunoglobulins are well known to those skilled in the art.
(21) As used herein, the term ‘monoclonal antibody’ refers to an antibody obtained from a class of substantially homogeneous population, that is, each antibody of this population is the same except for a few naturally occurring mutations. Monoclonal antibodies are highly specific to a single antigenic site. Additionally, differ from normal polyclonal antibody reagents (which normally possess different antibodies against different determinants), monoclonal antibody is specific to a single determinant. In addition to their specificity, another advantage of monoclonal antibody is that they are synthesized by hybridoma culture technique and are not be polluted by other immunoglobulins. The modifier ‘monoclonal’ refers to the properties of an antibody that is obtained from a substantially homogeneous population of antibodies and it should not be explained as some special methods are needed to produce the antibody.
(22) The invention also includes a monoclonal antibody having corresponding amino acid sequences of the anti-FcRn protein monoclonal antibody, a monoclonal antibody having the variable region chains of the anti-FcRn protein monoclonal antibody, and other proteins or protein conjugates and fusion expression products having such chains. In particular, the present invention includes any protein or protein conjugate and a fusion expression product (i.e., an immunoconjugate and a fusion expression product) comprising a light chain and a heavy chain containing a variable region as long as the variable region is identical, or at least 90% homologous, preferably at least 95% homologous, with the light chain and heavy chain variable region of the present invention.
(23) As known to those skilled in the art, the immunoconjugates and fusion expression products include conjugates formed by drugs, toxins, cytokines, radionuclides, enzymes and other diagnostic or therapeutic molecules binding to the anti-FcRn protein monoclonal antibody or the fragments thereof of the invention. The present invention also includes cell surface markers or antigens that bind to the anti-FcRn protein monoclonal antibodies or fragments thereof.
(24) The invention not only contains intact monoclonal antibody, but also includes antibody fragments with immunological activity, for instance, Fab or (Fab′).sub.2 fragments; antibody heavy chains; antibody light chains.
(25) As used herein, the terms “heavy chain variable region” and “V.sub.H” are used interchangeably.
(26) As used herein, the terms “variable region” and “complementary determining region (CDR)” are used interchangeably.
(27) In a preferred embodiment of the invention, the heavy chain variable region of the antibody (FnAb8) comprises three complementary determining regions (CDRs):
(28) CDR1: the amino acid sequence is GYTFTGYY (SEQ ID NO.: 4) and the nucleotide sequence encoding CDR1 is ggatacaccttcaccggctactat (SEQ ID NO.: 3);
(29) CDR2: the amino acid sequence is ISPHSGGT (SEQ ID NO.: 6) and the nucleotide sequence encoding CDR2 is atcagccctcacagtggtggcaca (SEQ ID NO.: 5);
(30) CDR3: the amino acid sequence is ARGVYGMDR (SEQ ID NO.: 8) and the nucleotide sequence encoding CDR3 is gcgcgcggtgtttacggtatggatcgt (SEQ ID NO.: 7);
(31) In a preferred embodiment of the invention, the amino acid sequence of heavy chain variable region is:
(32) TABLE-US-00002 (SEQ ID NO.: 10) QVQLVQSGAEVKKPGASVKVSCKTSGYTFTGYYIHWVRQAPGQGLEWMGH ISPHSGGTDYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARGV YGMDRWGQGTLVTVSS;
(33) The nucleotide sequence encoding V.sub.H is:
(34) TABLE-US-00003 (SEQ ID NO.: 9) CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTC AGTGAAGGTCTCCTGCAAGACTTCTGGATACACCTTCACCGGCTACTATA TACACTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGACAT ATCAGCCCTCACAGTGGTGGCACAGACTATGCACAGAAGTTTCAGGGCAG GGTCACCATGACCAGGGACACGTCCATCAGCACAGCCTACATGGAGCTGA GCAGGCTGAGATCTGACGACACTGCCGTGTATTACTGTGCGCGCGGTGTT TACGGTATGGATCGTTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCA.
(35) In a preferred embodiment of the invention, the heavy chain of the antibody includes the heavy chain variable region and a heavy chain constant region. The heavy chain constant region could be of human or mouse.
(36) As used herein, the terms “light chain variable region” and “V.sub.L” can be used interchangeably.
(37) In a preferred embodiment of the invention, the light chain variable region of the antibody (FnAb8) comprises the complementary determining regions (CDRs) selected from the group of:
(38) CDR1′, the amino acid sequence is SSNIGSNS (SEQ ID NO:14), and the nucleotide sequence encoding CDR1′ is agctccaacatcggaagtaatagt (SEQ ID NO.:13);
(39) CDR2′, the amino acid sequence is SNN (SEQ ID NO:16), and the nucleotide sequence encoding CDR2′ is agtaataat (SEQ ID NO.:15)
(40) CDR3′, the amino acid sequence is AAWDDSLNGRVL (SEQ ID NO:18), and the nucleotide sequence encoding CDR3′ is gcagcgtgggatgacagcctgaatggccgtgtacta (SEQ ID NO.:17).
(41) In a preferred embodiment of the invention, the amino acid sequence of the light chain variable region is:
(42) TABLE-US-00004 (SEQ ID NO.: 20) QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNSVNWYQQLPGTAPKLLIY SNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGRV LFGGGTKLTVL ,
(43) The nucleotide sequence encoding V.sub.L is:
(44) TABLE-US-00005 (SEQ ID NO.: 19) CAGGCTGTGCTGACTCAGCCACCCTCAGCGTCTGGGACCCCCGGGCAGAG GGTCACCATCTCTTGTTCTGGAAGCAGCTCCAACATCGGAAGTAATAGTG TAAACTGGTACCAGCAGCTCCCAGGAACGGCCCCCAAACTCCTCATCTAT AGTAATAATCAGCGGCCCTCAGGGGTCCCTGACCGATTCTCTGGCTCCAA GTCTGGCACCTCAGCCTCCCTGGCCATCAGTGGGCTCCAGTCTGAGGATG AGGCTGATTATTACTGTGCAGCGTGGGATGACAGCCTGAATGGCCGTGTA CTATTCGGCGGAGGGACCAAGCTGACCGTCCTA.
(45) In a preferred embodiment of the invention, the light chain of the antibody includes the above-said light chain variable region and a light chain constant region. The light chain constant region could be of humans or mouse.
(46) In a preferred embodiment of the invention, the heavy chain variable region of the antibody (FnAb12) comprises three complementary determining regions (CDRs):
(47) CDR1, the amino acid sequence is GYTFTSYD (SEQ ID NO:22), and the nucleotide sequence encoding CDR1 is ggatacaccttcaccagttatgat (SEQ ID NO.:21);
(48) CDR2, the amino acid sequence is MNPNSGNT (SEQ ID NO.:24), and the nucleotide sequence encoding CDR2 is atgaaccctaacagtggtaacaca (SEQ ID NO.:23);
(49) CDR3, the amino acid sequence is ARGVDLGDG (SEQ ID NO.:26), and the nucleotide sequence encoding CDR3 is gcgcgcggtgttgacctgggtgatggt (SEQ ID NO.:25).
(50) In a preferred embodiment of the invention, the amino acid sequence of heavy chain variable region is:
(51) TABLE-US-00006 (SEQ ID NO.: 28) EVQLVQSGAEVKKPGASVKVSCKASGYTFTSYDINWVRQATGQGLEWMGW MNPNSGNTGYAQKFQGRVTMTRNTSISTAYMELSSLRSEDTAVYYCARGV DLGDGWGQGTLVTVSS;
(52) The nucleotide sequence encoding V.sub.H is:
(53) TABLE-US-00007 (SEQ ID NO.: 27) GAGGTCCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTC AGTGAAGGTCTCCTGCAAGGCTTCTGGATACACCTTCACCAGTTATGATA TCAACTGGGTGCGACAGGCCACTGGACAAGGGCTTGAGTGGATGGGATGG ATGAACCCTAACAGTGGTAACACAGGCTATGCACAGAAGTTCCAGGGCAG AGTCACCATGACCAGGAACACCTCCATAAGCACAGCCTACATGGAGCTGA GCAGCCTGAGATCTGAGGACACGGCCGTGTATTACTGTGCGCGCGGTGTT GACCTGGGTGATGGTTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCA.
(54) In a preferred embodiment of the invention, the heavy chain of the antibody includes the heavy chain variable region and a heavy chain constant region. The heavy chain constant region could be of human or mouse.
(55) As used herein, the terms “light chain variable region” and “V.sub.L” are used interchangeably.
(56) In a preferred embodiment of the invention, the light chain variable region of the antibody (FnAb12) comprises the complementary determining regions (CDRs) selected from the group of:
(57) CDR1′, the amino acid sequence is QDIDNN (SEQ ID NO:30), and the nucleotide sequence encoding CDR1′ is caggacattgacaacaac (SEQ ID NO.:29);
(58) CDR2′, the amino acid sequence is DAS (SEQ ID NO:32), and the nucleotide sequence encoding CDR2′ is gatgcgtcc (SEQ ID NO.:31);
(59) CDR3′, the amino acid sequence is QQYYNLPLT (SEQ ID NO:34), and the nucleotide sequence encoding CDR3′ is caacagtattacaatctgcctctgact (SEQ ID NO.:33)
(60) In a preferred embodiment of the invention, the amino acid sequence of the light chain variable region is:
(61) TABLE-US-00008 (SEQ ID NO.: 36) DIQLTQSPSSLSASVGDRVTLTCQATQDIDNNLNWYQQKPGKAPKLLIYD ASNLETGVPSRFSGSGSGTDFTFTISDLQPEDVATYYCQQYYNLPLTFGG GTKVDIK
(62) The nucleotide sequence encoding V.sub.L is:
(63) TABLE-US-00009 (SEQ ID NO.: 35) GACATCCAGTTGACCCAGTCTCCATCCTCCCTGTCTGCATCCGTTGGCGA CAGAGTCACCCTCACTTGCCAGGCGACTCAGGACATTGACAACAACTTAA ATTGGTATCAACAAAAGCCGGGGAAAGCCCCTAAGCTCCTGATCTACGAT GCGTCCAATTTGGAAACAGGAGTCCCGTCACGGTTCAGCGGGAGTGGATC TGGGACAGATTTTACTTTCACCATTAGTGACCTACAGCCTGAAGATGTTG CAACATATTACTGTCAACAGTATTACAATCTGCCTCTGACTTTCGGCGGA GGGACCAAAGTGGATATCAAA
(64) In a preferred embodiment of the invention, the light chain of the antibody includes the above-said light chain variable region and a light chain constant region. The light chain constant region could be of human or mouse.
(65) In the present invention, the terms “antibody of the present invention”, “protein of the present invention” or “polypeptide of the present invention” are used interchangeably and all refer to polypeptides that specifically bind to FcRn protein, for example, a protein or polypeptide comprising a heavy chain variable region (e.g. SEQ ID NO.: 10 amino acid sequence) and/or a light chain variable region (e.g. SEQ ID NO.: 20 amino acid sequence). They may or may not contain a starting methionine.
(66) In a preferred embodiment of the invention, the antibody is a mouse or human-mouse chimeric monoclonal antibody against FcRn protein and their heavy chain constant region and/or light chain constant region could be humanized heavy chain constant region or light chain constant region. Preferably, the humanized heavy chain constant region or light chain constant region are the heavy chain constant region or light chain constant region of human IgG2, IgG2 and etc.
(67) The present invention also provides other proteins or fusion expression products having the antibodies of the present invention. In particular, the present invention includes any protein or protein conjugate and fusion expression products (i.e., an immunoconjugate and a fusion expression product) comprising a heavy chain and a light chain containing a variable region as long as the variable region is identical, or at least 90% homologous, preferably at least 95% homologous, with the heavy chain and light chain variable region of the antibody of the present invention.
(68) In general, the antigen-binding properties of an antibody can be described by three specific regions located in the heavy chain and light chain variable region, referring as variable regions (CDRs), and this segment is separated into four framework regions (FRs). The sequences of four FRs amino acids are relatively conservative and do not directly participate in the binding reaction. A cyclic structure are formed by these CDRs, β-folds formed by the FRs between them are close to each other in the spatial structure, and the CDRs on the heavy chains and the CDRs on the corresponding light chains constitute the antigen-binding sites of the antibody. The amino acid sequence of the same type of antibody can be used to determine which amino acids have constituted the FR or CDR region.
(69) The variable regions of the heavy chains and/or light chains of the antibodies of the invention are of particular interest, because at least parts of them are involved in binding to an antigen. Thus, the invention encompasses those molecules having an monoclonal antibody heavy chain and light chain variable region with CDRs as long as their CDRs have a homology of more than 90% (preferably more than 95%, optimally more than 98%) to the CDRs identified herein.
(70) The present invention includes not only intact antibodies but also fragments of antibodies or fusion proteins formed by antibodies with other sequences with immunological activity. Accordingly, the present invention also includes fragments, derivatives and analogs of said antibodies.
(71) As used herein, the terms “fragments”, “derivatives” and “analogs” refer to the polypeptides that substantially maintain the same biological function or activity of the antibodies of the present invention. The polypeptide fragments, derivatives or analogs of the present invention may be (i) a polypeptide with one or more conservative or non-conservative amino acid residues (preferably the conservative amino acid residues) being substituted, while such a substituted amino acid residue may or may not be encoded by a genetic code, or (ii) a polypeptide having substituted group(s) in one or more amino acid residues, or (iii) a polypeptide formed by fusion of the mature polypeptide with another compound (such as the compound that prolongs the half life of the polypeptide, such as polyethylene glycol), or (iv) a polypeptide with additional amino acid sequence fused to said polypeptide sequence (such as fusion proteins formed by fusion with leader sequence, secretion sequence or sequence used to purify the polypeptide or proprotein sequence, or a fusion protein formed with a 6His tag. According to the teachings of the present application, these fragments, derivatives and analogs are within the scope commonly known by the skilled person.
(72) An antibody of the present invention refers to a polypeptide comprising the CDRs regions and having FcRn protein binding activity. The term also includes a variant form of the polypeptide comprising the above CDRs regions and having the same function as the antibodies of the present invention. These variations include (but are not limited to) deletion, insert and/or substitution of one or more (typically 1-50, preferably 1-30, more preferably 1-20, most preferably 1-10) amino acids, and adding one or more (typically 20 or less, preferably 10 or less, more preferably 5 or less) amino acids at the C-terminus and/or N-terminus. For example, in the art, substitution with similar or similar amino acids does not usually alter the function of the protein. Also, for example, the addition of one or several amino acids at the C-terminus and/or the N-terminus will not usually alter the function of the protein. The term also includes the active fragments and active derivatives of the antibodies of the present invention.
(73) The mutated forms of the polypeptide include homologous sequences, conserved variants, allelic variants, natural mutants, induced mutants, proteins encoded by DNA that hybridizes to the encoded DNA of the antibodies of the present invention under high or low stringency conditions, and polypeptides or proteins obtained using antisera against antibodies of the present invention.
(74) The present invention also provides other polypeptides, such as fusion proteins comprising a human antibody or a fragment thereof. In addition to the substantially full length polypeptides, the present invention also encompasses fragments of antibodies of the present invention. Typically, the fragment has at least about 50 consecutive amino acids of the antibody of the present invention, preferably at least about 60 consecutive amino acids, more preferably at least about 80 consecutive amino acids, and most preferably at least about 100 consecutive amino acids.
(75) In the present invention, the “conserved variants of the antibodies of the present invention” refers to the polypeptides formed by substituting at most 10, preferably at most 8, more preferably at most 5, and most preferably 3 amino acid of the amino acid sequence of the polypeptide of the present invention with the amino acid having similar or analogous properties. These conservative variant polypeptides are preferably formed by carrying out the amino acid substitution according to Table 1.
(76) TABLE-US-00010 TABLE 1 Initial residue Representative substitution Preferred substitution Ala (A) Val; Leu; Ile Val Arg (R) Lys; Gln; Asn Lys Asn (N) Gln; His; Lys; Arg Gln Asp (D) Glu Glu Cys (C) Ser Ser Gln (Q) Asn Asn Glu (E) Asp Asp Gly (G) Pro; Ala Ala His (H) Asn; Gln; Lys; Arg Arg Ile (I) Leu; Val; Met; Ala; Phe Leu Leu (L) Ile; Val; Met; Ala; Phe Ile Lys (K) Arg; Gln; Asn Arg Met (M) Leu; Phe; Ile Leu Phe (F) Leu; Val; Ile; Ala; Tyr Leu Pro (P) Ala Ala Ser (S) Thr Thr Thr (T) Ser Ser Trp (W) Tyr; Phe Tyr Tyr (Y) Trp; Phe; Thr; Ser Phe Val (V) Ile; Leu; Met; Phe; Ala Leu
(77) The present invention also provides a polynucleotide molecule encoding the above antibody or a fragment thereof or a fusion protein thereof. The polynucleotides of the present invention can be in a form of DNA or RNA. DNA includes cDNA, genomic DNA, or synthetic DNA. DNA may be single-stranded or double-stranded. DNA may be the coding strand or non-coding strand. The sequences of coding regions for coding mature polypeptides could have same sequences or degenerate variants of SEQ ID NO.: 3, 5, 7, 9, 13, 15, 17 and 19. As used herein the term ‘degenerate variant’ in the present invention refers to nucleic acid sequences encoding the same amino acid sequence with the polypeptides of the present invention but different with the coding regions of SEQ ID NO.: 3, 5, 7, 9, 13, 15, 17 and 19.
(78) The polynucleotide encoding the mature polypeptide of the present invention includes coding sequences encoding only mature polypeptides; coding sequences of mature polypeptides and various additional coding sequences; coding sequences (and optional additional coding sequences) of mature polypeptides and non-coding sequences.
(79) The term “polynucleotide encoding the polypeptide” may be a polynucleotide that encodes the polypeptide, or a polynucleotide that also includes additional coding and/or non-coding sequences.
(80) The present invention also relates to a polynucleotide that hybridize to the sequence described above and that have at least 50%, preferably at least 70%, more preferably at least 80% identity between the two sequences. In particular, the present invention relates to a polynucleotide that is hybridizable to the polynucleotide of the present invention under stringent conditions. In the present invention, “stringent conditions” means: (1) hybridization and elution at lower ionic strength and higher temperature, such as 0.2×SSC, 0.1% SDS, 60° C.; or (2) hybridization in the presence of a denaturant such as 50% (v/v) formamide, 0.1% calf serum/0.1% Ficoll, 42° C. or the like; or (3) hybridization occurs only if the identity between the two sequences is at least 90%, more preferably 95% or more. And the polypeptide encoded by the hybridizable polynucleotide has the same biological function and activity as the mature polypeptide shown in one of SEQ ID NO: 10 and/or SEQ ID NO.: 20.
(81) The full-length nucleotide sequence of the present invention or a fragment thereof can usually be obtained by PCR amplification methods, recombination methods or synthetic methods. A viable approach is to synthesize the relevant sequence by synthetic methods, especially when the length of the fragment is short. In general, a very long fragment can be obtained by first synthesizing multiple small fragments and then ligating them. In addition, the coding sequence of the heavy chain and the expression tag (e.g., 6His) can be fused together to form a fusion protein.
(82) Once the relevant sequence is obtained, the relevant sequence can be obtained in bulk using the recombination method. It is usually cloned into a vector, transferred to a cell, and then isolated from the host cell after proliferation by conventional methods. The biomolecules (nucleic acids, proteins, etc.) involved in the present invention include biomolecules existing in separate forms.
(83) At present, DNA sequences encoding the protein of the present invention (or fragments thereof, or derivatives thereof) can be completely obtained by chemical synthesis. Then the DNA sequence can be introduced into a variety of current DNA molecules (or vectors) and cells known in the art. In addition, mutations can also be introduced into the protein sequences of the present invention by chemical synthesis.
(84) The present invention also relates to vectors comprising the suitable DNA sequence as described above and a suitable promoter or control sequence. These vectors can be used to transform suitable host cells to enable them to express proteins.
(85) Host cells can be prokaryotic cells, such as bacterial cells; or lower eukaryotic cells, such as yeast cells; or higher eukaryotic cells, such as mammalian cells. Representative examples include: bacterial cells such as Escherichia coli, Streptomyces; Salmonella typhimurium; fungal cells such as yeast; insect cells such as Drosophila S2 or Sf 9; animal cells such as CHO, COS7, 293 cells, etc.
(86) Transformation of host cells with recombinant DNA can be carried out using conventional techniques well known to those skilled in the art. When the host is a prokaryote such as E. coli, competent cells capable of absorbing DNA can be harvested after the exponential growth phase and treated with the CaCl.sub.2. The steps used are well known in the art. Another method is using MgCl.sub.2. If necessary, the transformation can also be carried out by electroporation. When the host is a eukaryote, the following DNA transfection methods are available: calcium phosphate coprecipitation, conventional mechanical methods such as microinjection, electroporation, liposome packaging, and the like.
(87) The obtained transformants can be cultured by conventional methods to express the polypeptides encoded by the genes of the present invention. Depending on the host cell used, the medium used in the culture may be selected from a variety of conventional media. And the host cells are cultured under conditions suitable for the growth. After the host cells grow to appropriate cell density, the selected promoter is induced with a suitable method, such as temperature conversion or chemical induction, and the cells are cultured for a further period of time.
(88) The recombinant polypeptide in the above method can be expressed intracellularly, or on the cell membrane, or secreted out of the cell. If desired, recombinant proteins can be isolated and purified by various separation methods using their physical, chemical and other properties. These methods are well known to those skilled in the art. Examples of such methods include, but are not limited to, conventional renaturation treatments, treatment with a protein precipitant (salting-out method), centrifugation, penetration-breaking bacteria, super-treatment, ultracentrifugation, molecular sieve chromatography (gel filtration), adsorption chromatography, ion-exchange chromatography, high performance liquid chromatography (HPLC) and various other liquid chromatography techniques and combinations of these methods.
(89) The antibodies of the present invention may be used alone or in combination with or coupling with a detectable label (for diagnostic purposes), a therapeutic agent, a PK (protein kinase) modified moiety, or any combination thereof.
(90) A detectable label for diagnostic purposes include, but are not limited to, fluorescent or luminescent labels, radiolabels, MRI (magnetic resonance imaging), or CT (computerized tomography) contrast agents, or enzymes capable of producing detectable products.
(91) Conjugable therapeutic agent include, but are not limited to, insulin, IL-2, interferon, calcitonin, GHRH peptide, gut peptide analog, albumin, antibody fragments, cytokines, and hormones, etc.
(92) Further therapeutic agents that can be combined with or coupled with the antibodies of the present invention include, but are not limited to: 1. Radioactive nuclide (Koppe, et al, 2005, Cancer metastasis reviews 24, 539); 2. Biological toxin (Chaudhary et al, 1989, Nature, 339, 394; Epel et al, 2002, Cancer immunology and immunotherapy 51,565); 3. Cytokine such as IL-2 and the like (Gillies, et al, 1992, PNAS, 89,1428; Card, et al, 2004, Cancer immunology and immunotherapy 53, 345; Halin, et al, 2003, Cancer research 63, 3202); 4. Gold nano-particle/nano-rod (Lapotko, et al, 2005, Cancer letters 239, 36; Huang, et al, 2006, Journal of the American chemical society 128, 2115); 5. Virus particles (Peng, et al, 2004, Gene therapy, 11, 1234); 6. Liposome (Mamot, et al, 2005, Cancer research 65,11631); 7. Magnetic nano-particles; 8. Prodrug activating enzymes (such as DT-diaphorase (DTD) or Biphenyl hydrolase-like protein (BPHL)); 10. Chemotherapeutic agent (e.g., cisplatin) or any form of nanoparticles and the like.
(93) The present invention also provides a composition. In a preferred embodiment, the composition is a pharmaceutical composition comprising the above-described antibody or active fragment thereof or a fusion protein thereof, and a pharmaceutically acceptable carrier. In general, these materials may be formulated in a non-toxic, inert and pharmaceutically acceptable aqueous carrier medium, wherein the pH is generally about 5 to 8, preferably about 6 to 8, although the pH may vary depending on the nature of the substance to be formulated, and the condition to be treated. The formulated pharmaceutical compositions may be administered by conventional routes, including, but not limited to, oral, respiratory, intratumoral, intraperitoneal, intravenous, or local drug delivery.
(94) The pharmaceutical compositions of the present invention can be used directly to bind with FcRn protein molecules and are therefore useful for prolonging the half-life of drugs. In addition, other therapeutic agents may be used at the same time.
(95) The pharmaceutical composition of the present invention contains a monoclonal antibody (or a conjugate thereof) of the present invention in a safe and effective amount (e.g., 0.001 to 99 wt %, preferably 0.01 to 90 wt %, more preferably 0.1 to 80 wt %) and a pharmaceutically acceptable carrier or excipient. Such carriers include, but are not limited to, saline, buffer, glucose, water, glycerol, ethanol, and combinations thereof. The pharmaceutical preparation should match the method of administration. The pharmaceutical compositions of the present invention may be prepared into the form of injections, for example, it is prepared by conventional methods using physiological saline or aqueous solutions containing glucose and other adjuvants. Pharmaceutical compositions such as injections, solutions should be prepared under aseptic conditions. The amount of the active ingredient is a therapeutically effective amount, such as about 1 microgram/kg body weight per day to about 10 mg/kg body weight per day. In addition, the polypeptides of the present invention may also be used with other therapeutic agents.
(96) When a pharmaceutical composition is used, a safe and effective amount of an immunoconjugate is administered to a mammal wherein the safe effective amount is generally at least about 10 micrograms per kilogram of body weight and, in most cases, no more than about 8 milligrams per kilogram of body weight, preferably, the dose is from about 10 micrograms per kilogram body weight to about 1 milligram per kilogram of body weight. Of course, the route of administration, the patient's health status and other factors, should be considered for the specific dose, which are within the scope of skills of skilled practitioners.
(97) The Main Advantages of the Present Invention Include:
(98) (1) The monoclonal antibodies provided by the present invention have a significantly higher affinity for binding to FcRn at weakly acidic pH, compared with IgG and SA; while maintaining a weak affinity at neutral pH, which is similar to IgG and SA; and they are more effective, compared with IgG and SA, in recycling in vivo using FcRn, thereby significantly prolonging their half-life;
(99) (2) The monoclonal antibody of the present invention has a significant pH-dependent binding to FcRn and can be used as a drug carrier. After being coupled or recombinantly expressed with a polypeptide, a protein or other drugs, patient compliance can be improved while administration dose and frequency of drugs and drug cost can be reduced by way of prolonging the half-life of drugs;
(100) (3) The monoclonal antibody of the present invention can be used for preparing a single chain antibody or a double chain antibody, and being conjugated or recombinantly expressed with a drug molecule. Since the single chain antibody and the double chain antibody have a small molecular weight, they can be expressed by a non-mammalian cell system, thereby simplifying the production process and reducing production costs;
(101) (4) The monoclonal antibody provided by the present invention can be a human antibody and needs no further humanization.
(102) The present invention will be further illustrated below with reference to the specific examples. It should be understood that these examples are only to illustrate the invention, not to limit the scope of the invention. The experimental methods with no specific conditions described in the following examples are generally performed under the conventional conditions (e.g., the conditions described by US Sambrook et al., Molecular Cloning Laboratory Guide (Huang Peitang et al., Beijing: Science Press, 2002), or according to the manufacture's instructions. Unless indicated otherwise, all percentage and parts are calculated by weight. Unless otherwise stated, the experimental materials and reagents used in the following examples are available from commercially available sources.
(103) Unless otherwise stated, the experimental materials used in the examples of the present invention are available from commercially available sources. Among them, hIgG, HLA-A2 protein was purchased from invitrogen; b2M, GLP-1R-Fc was purchased from Sino Biological Inc.; Luciferase assay kits and detecting instruments were purchased from Promega; Avidin-coated ELISA plate was purchased from invitrogen; Biotin labeling kit was purchased from Solulink; Instruments for the detection of plasma surface resonance technology, buffers, consumables, etc. are all purchased from GE Healthcare; The hFcRn&b2M protein for detection, the EGFP-FnRn cell line expressing hFcRn&b2M, and the EGFP-HLA-A2 cell line expressing HLA-A2&b2M were prepared according to references 2 and 3 by the inventors. The remaining universal cell culture and transfection reagents were purchased from invitrogen and chemical reagents were purchased from Sigma.
EXAMPLE 1
Generation and Screening of Monoclonal Antibody
(104) In the present Example, single chain antibody phage library was screened as shown in
(105) Through subtractive panning at different pH (pH6.0/pH7.4), two single chain antibodies, FnAb8 and FnAb12, have been identified, which can specifically recognize human FcRn protein with high affinity and binding constant is significantly pH-dependent. As shown in table 1, at pH 6.0, their binding affinities are 100-200 folds higher than that of wild type hIgG and SA, while they exhibited similar affinity to hFcRn at pH7.4 (>10 uM), as compared with wild type hIgG and SA. Similar to IgG, the binding of the single-chain antibodies to FcRn is pH-dependent at cellular level. The results showed that the specificity and pH dependence of FnAb8 and FnAb12 binding to FcRn were detected using HEK293 cell line expressing hFcRn&b2M and control cell line expressing HLA-A2&b2M. In particular, FnAb8 and FnAb12, like hIgG, did not bind to HEK293 cells expressing HLA-A2, did not bind to HEK293 cells expressing hFcRn at neutral pH, and FnAb8 and FnAb12 can specifically bind to cell-expressed hFcRn only at weakly acidic pH, while negative control antibody (NC) did not bind to HLA-A2 or hFcRn.
(106) TABLE-US-00011 TABLE 1 Binding affinity of FnAb8 and FnAb12 to hFcRn KD KD Ligand Sample (pH 6.0) (pH 7.4) hFcRn & b2M FnAb8 2.62E−09 >10 uM hFcRn & b2M FnAb12 1.50E−08 >10 uM
(107) FnAb8 and FnAb12 antibodies were sequenced and analyzed by routine methods in the art, and results are shown as below:
(108) TABLE-US-00012 FnAb8 SEQ ID NO.: FnAb12 SEQ ID NO.: HC CDR1 4 HC CDR1 22 HC CDR2 6 HC CDR2 24 HC CDR3 8 HC CDR3 26 HC variable region 10 HC variable region 28 LC CDR1 14 LC CDR1 30 LC CDR2 16 LC CDR2 32 LC CDR3 18 LC CDR3 34 LC variable region 20 LC variable region 36
EXAMPLE 2
Generation of Fusion Protein
(109) A nucleotide sequence expressing GLP1 (7-36 amino acids, containing three mutation sites, A8G, G22E, and R36G) was ligated to 5′ end of a nucleotide sequence of FnAb8 or FnAb12 with a (G4S)3 linker, and the gene was synthesized and inserted into expression vector pcDNA3.1 (Jinsley Biotechnology Co., Ltd.). And then the plasmid was transfected into mammalian cells to prepare a protein.
(110) Below is the amino acid sequence of GLP1 protein (AA7-36):
(111) TABLE-US-00013 (SEQ ID NO.: 2) HGEGTFTSDVSSYLEEQAAKEFIAWLVKGG
(112) In the present example, GLP1 (AA7-36) was successfully fusion-expressed with two single-chain antibodies respectively, thereby obtaining fusion proteins. The fusion protein obtained by fusion expression with FnAb8 was named as G8, and the fusion protein obtained by fusion expression with FnAb12 was named as G12.
(113) The amino acid sequence of fusion protein G8:
(114) TABLE-US-00014 (SEQ ID NO.: 11) HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGGGGGGSGGGGSGGGGSQAVL TQPPSASGTPGQRVTISCSGSSSNIGSNSVNWYQQLPGTAPKLLIYSNNQ RPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGRVLFGG GTKLTVLGSRGGGGSGGGGSGGGGSLEMAQVQLVQSGAEVKKPGASVKVS CKTSGYTFTGYYIHWVRQAPGQGLEWMGHISPHSGGTDYAQKFQGRVTMT RDTSISTAYMELSRLRSDDTAVYYCARGVYGMDRWGQGTLVTVSS, the underlined is the single chain antibody sequence.
(115) The amino acid sequence of fusion protein G12:
(116) TABLE-US-00015 (SEQ ID NO.: 12) HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGGGGGGSGGGGSGGGGSDIQL TQSPSSLSASVGDRVTLTCQATQDIDNNLNWYQQKPGKAPKLLIYDASNL ETGVPSRFSGSGSGTDFTFTISDLQPEDVATYYCQQYYNLPLTFGGGTKV DIKRSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGASVKVSCKAS GYTFTSYDINWVRQATGQGLEWMGWMNPNSGNTGYAQKFQGRVTMTRNTS ISTAYMELSSLRSEDTAVYYCARGVDLGDGWGQGTLVTVSS, the underlined is the single chain antibody sequence.
EXAMPLE 3
In-Vitro Activity Test of Fusion Proteins
(117) The binding between GLP1 fusion protein and its corresponding receptor protein, was identified using Surface Plasma Resonance (SPR) technology. GLP-1R-Fc protein and hIgG were immobilized on a CM5 chip by chemical coupling using Biacore T100, and 200 nM of FnAb8, G8, FnAb12 and G12 were flowed through the surface of the chip at high speed respectively to detect binding signals.
(118) Biacore was used to identify the binding of GLP-1 fusion protein to hFcRn. hFcRn was coupled to a CM5 chip, and 200 nM of FnAb8, G8, FnAb12 and G12 were flowed through the surface of the chip at high speed to detect the binding signals.
(119) The experimental results of the present example demonstrated that G8 and G12 can specifically bind to GLP-1R. Both of G8 and G12 can bind to FcRn protein and maintain the pH-dependence of binding.
EXAMPLE 4
Cellular Activity Test of Fusion Protein
(120) The CRE-Luc/GLP-1R HEK293 cell line was used to identify the cellular biological activity of GLP-1 fusion protein. Briefly, CRE-Luc/GLP-1R HEK293 cells were seeded into 96 well cell culture plate at 5×10.sup.4/well and cultured overnight. Next day, serially diluted G8 or G12 solution was added to the cell culture plate. After cultured for 5 hours, the cells were washed twice with PBS, and then lysed with cell lysis liquid, and luciferase activity was detected by using Luciferase assay kit (Promega). Binding of GLP-1 to GLP-1R expressed on the cell surface will stimulate the production of cAMP, thereby inducing the expression of Luciferase, the activity of which will be proportional to the binding strength of GLP-1 and its receptor. The binding activity of GLP-1 to GLP-1R can be determined by measuring the activity of Luciferase.
(121) The results showed that the binding activity of G8 and G12 to GLP-1R was dose-dependent, and its EC50 was almost comparable to that of the reported GLP-1 polypeptide, demonstrating that the fusion protein retained the biological activity of GLP-1 and had comparable efficacy.
EXAMPLE 5
Biological Activity Experiment In-Vivo
(122) Male C57BL/6 mice (7 weeks old) were purchased from JOINN Laboratory Inc (Suzhou, J S), all of which were fed either standard rodent chow (SRC) or a high-fat diet (HFD, 45% kcal from fat; Medicience Inc, Yangzhou, J S) for 18 days. Obese mice with 20% weight and 30% blood glucose increase as compared with those SRC fed were randomized into 3 groups with 3 mice in each group (n=3) and given subcutaneous (SC) injection of G8, G12, or Exenatide (0.1 mg/mouse), blood glucose changes in mice were determined at various time points by blood glucose meter. Experiment results showed that G8 and G12 had significant blood glucose lowering effects and the duration of the drug was significantly longer than that of Exenatide.
EXAMPLE 6
In-Vivo Half-Life Determination
(123) Two healthy female cynomolgus monkeys (purchased from Guangxi Changchun Biotechnology Co., Ltd., average age 6.5-7 years; body weight 3.3 kg) were selected, and given biotinylated FnAb8 antibody, 1 mg/kg body weight through tail vein injection. Plasma samples (˜2 ml) were taken at 0, 0.5, 6, 24, 48, 96, 240, 408, 576, 744, 1008 hours. The blood concentration of FnAb8 was detected by sandwich method with a plate pre-coated with avidin, and analyzed by WinNonlin software. The obtained results of pharmacokinetic study are shown in Table 2. The average residence time in vivo of the FnAb8 antibody was 240 hours or so (half-life of 204 and 98 hours, respectively), while almost all single-chain antibodies have a half-life of only a few minutes to several hours in vivo. The half-life of FnAb8 is tens to hundreds of times that of a typical single-chain antibody.
(124) TABLE-US-00016 TABLE 2 Pharmacokinetic data of FnAb in cynomolgus macaque ID β phase T.sub.1/2(h) AUC.sub.inf(ug*h/ml) Cl_F(ml/h/kg) MRT (h) Cyno-1 204 2084 0.48 273 Cyno-2 98 2200 0.45 204 B phase T.sub.1/2(h): elimination half life; AUC.sub.inf(ug*h/ml): area under the plasma concentration curve; Cl_F(ml/h/kg): clear rate; MRT(h): mean residence time
(125) Summing up, the two novel single-chain antibody sequences of the present invention have specificity, high affinity and pH-dependent binding to hFcRn, and upon fusion expression with functional proteins, their own binding trait can be maintained while the biological function of the fusion protein can also be maintained. And in vivo studies have shown that the single-chain antibodies have a longer half-life, so that the two new antibodies have great potential for the development of biopharmaceuticals with extended half-life.
(126) All the documents cited herein are incorporated into the invention as reference, as if each of them is individually incorporated. Further, it would be appreciated that, in light of the above described teaching of the invention, the skilled in the art could make various changes or modifications to the invention, and these equivalents would still be in the scope of the invention defined by the appended claims of the application.
REFERENCES
(127) [1] M. Raghavan, V. R. Bonagura, S. L. Morrison, P. J. Bjorkman, Analysis of the pH dependence of the neonatal Fc receptor/immunoglobulin G interaction using antibody and receptor variants, Biochemistry. 34 (1995) 14649-14657. doi:10.1021/bi00045a005. [2] R. L. Shields, A. K. Namenuk, K. Hong, Y. G. Meng, J. Rae, J. Briggs, et al., High Resolution Mapping of the Binding Site on Human IgG1 for Fc□RI, Fc□RII, Fc□RIII, and FcRn and Design of IgG1 Variants with Improved Binding to the Fc□R, J. Biol. Chem. 276 (2001) 6591-6604. doi:10.1074/jbc.M009483200. G. J. Christianson, V. Z. Sun, S. Akilesh, E. Pesavento, G. Proetzel, D. C. Roopenian, Monoclonal antibodies directed against human FcRn and their applications, MAbs. 4 (2012) 208-216. doi:10.4161/mabs.4.2.19397.