TRANSPOSON SYSTEM AND METHODS OF USE

20210115453 · 2021-04-22

    Inventors

    Cpc classification

    International classification

    Abstract

    Disclosed are methods for the ex-vivo genetic modification of an immune cell comprising delivering to the immune cell, (a) a nucleic acid or amino acid sequence comprising a sequence encoding a transposase enzyme and (b) a recombinant and non-naturally occurring DNA sequence comprising a DNA sequence encoding a transposon.

    Claims

    1-147. (canceled)

    148. A method for the ex-vivo genetic modification of a stem cell comprising delivering to the stem cell: (a) a nucleic acid or amino acid sequence comprising a sequence encoding a transposase enzyme; (b) a recombinant and non-naturally occurring DNA sequence comprising a DNA sequence encoding a transposon; and (c) differentiating the stem cell into an immune cell.

    149. The method of claim 148, wherein the stem cell is a hematopoietic stem cell (HSC).

    150. The method of claim 148, wherein the stem cell comprises the cell-surface marker phenotype CD34+ and CD38−.

    151. The method of claim 148, wherein the stem cell comprises the cell-surface marker phenotype CD34+, CD38−, and CD90+.

    152. The method of claim 148, wherein the stem cell comprises the cell-surface marker phenotype CD34+, CD38−, CD90+, and CD45RA−.

    153. The method of claim 148, wherein the stem cell comprises the cell-surface marker phenotype CD34+, CD38−, CD90+, CD45RA−, and CD49f+.

    154. The method of claim 148, wherein the immune cell is a T-lymphocyte, a Natural Killer (NK) cell, a Cytokine-induced Killer (CIK) cell, a Natural Killer T (NKT) cell, or a B lymphocyte (B Cell).

    155. The method of claim 148, wherein the differentiating comprises priming the stem cell with any combination of IL-3, Flt3L, TPO, SCF, or G-CSF.

    156. The method of claim 155, wherein the stem cell is primed for at least 3 days.

    157. The method of claim 156, wherein the primed stem cell is transferred to a layer of feeder cells and fed bi-weekly.

    158. The method of claim 157, wherein the primed stem cell is cultured with the feeder cells for at least 7 days.

    159. The method of claim 148, wherein the method further comprises the step of stimulating the stem cell with at least one cytokine.

    160. The method of claim 159, wherein the at least one cytokine is IL-2, IL-21, IL-7 or IL-15, or a combination thereof.

    161. The method of claim 148, wherein the sequence encoding a transposase enzyme is an mRNA sequence.

    162. The method of claim 148, wherein the sequence encoding a transposase enzyme is a DNA sequence.

    163. The method of claim 148, wherein the sequence encoding a transposase enzyme is an amino acid sequence.

    164. The method of claim 148, wherein the transposon is a piggyBac transposon, piggyBac-like transposon, Sleeping Beauty transposon, Tol2 transposon or Helraiser transposon.

    165. The method of claim 148, wherein the transposase is a piggyBac transposase, piggyBac-like transposase, hyperactive piggyBac transposase, Super piggyBac (SPB) transposase, Sleeping Beauty transposase, hyperactive Sleeping Beauty (SB100X) transposase, Tol2 transposase or helitron transposase.

    166. The method of claim 148, further comprising administering the immune cells to a subject in need thereof.

    167. The method of claim 166, wherein the subject has cancer.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0078] FIG. 1 is a series of graphs depicting transfection efficiency and cell viability following plasmid DNA nucleofection in primary human T lymphocytes.

    [0079] FIG. 2 is a series of graphs depicting DNA cytotoxicity to T cells.

    [0080] FIG. 3 is a series of graphs showing that DNA-mediated cytotoxicity in T cells is dose dependent.

    [0081] FIG. 4 is a series of graphs showing that extracellular plasmid DNA is not cytotoxic.

    [0082] FIG. 5 is a series of graphs depicting efficient transposition using SPB mRNA in Jurkat cells.

    [0083] FIG. 6 is a series of graphs depicting efficient transposition in T lymphocytes using SPB mRNA.

    [0084] FIG. 7 is a series of graphs depicting efficient delivery of linearized DNA transposon products.

    [0085] FIG. 8 is a series of graphs showing that addition of that IL-7 and IL-15 and immediate stimulation of T cells post-nucleofection enhances cell viability.

    [0086] FIG. 9 is a series of graphs showing that IL-7 and IL-15 rescue T cells from DNA mediated toxicity

    [0087] FIG. 10 is a series of graphs showing that immediate stimulation of T cells post-nucleofection enhances cell viability.

    [0088] FIG. 11A-C is a series of graphs depicting T cell transposition with varying amounts of DNA. Primary human pan T cells were nucleofected with varying amounts of DNA using piggyBac™. T cells were nucleofected with the indicated amounts of transposon and 5 μg SPB mRNA. Cells were then stimulated on day 2 post-nucleofection through CD3 and CD28. As expected, T cells nucleofected with high amounts of DNA exhibited high episomal expression at day 1 post nucleofection whereas almost no episomal expression was observed at low DNA doses. In contrast, following expansion at day 21 post nucleofection the greatest percentage of transgene positive cells were observed in lower DNA amounts peaking at 1.67 μg for this transposon. (A) Flow analysis for transgene positive cells at day 1 and 21. (B) Percentage of transgene positive T cells. (C) Percentage of viable T cells at day 1 and 21. For all graphs shown in this figure, the Y-axis ranges from 0 to 100% in increments of 20% and the X-axis ranges from 0 to 10.sup.5 by powers of 10.

    [0089] FIG. 12A-B is a series of graphs depicting T cell transposition with low DNA amounts using the Sleeping Beauty™ 100X (SB100X) transposase. Primary human pan T cells were nucleofected with GFP plasmids encoding either the piggyBac™ (PB) or Sleeping Beauty™ (SB) ITRs. (A) Cells were nucleofected with the indicated amounts of SB transposon and 1 μg SB transposase mRNA. (B) Cells were nucleofected with the indicated amounts of SB transposase and 0.75 μg SB transposon. Flow analysis was performed on day 14 post nucleofection for all samples. For all graphs shown in this figure, the Y-axis ranges from 0 to 250K in increments of 50K and the X-axis ranges from 0 to 10.sup.5 by powers of 10.

    [0090] FIG. 13A is a series of plots depicting T cells transposed with a plasmid containing a sequence encoding a transposon comprising a sequence encoding an inducible caspase polypeptide (a safety switch, “iC9”), a CARTyrin (anti-BCMA), and a selectable marker. Left-hand plots depict live T cells exposed to transposase in the absence of the plasmid. Right-hand plots depict live T cells exposed to transposase in the presence of the plasmid. Cells were exposed to either a hyperactive transposase (the “Super piggyBac”) or a wild type piggyBac transposase.

    [0091] FIG. 13B is a series of plots depicting T cells transposed with a plasmid containing a sequence encoding a green fluorescent protein (GFP). Left-hand plots depict live T cells exposed to transposase in the absence of the plasmid. Right-hand plots depict live T cells exposed to transposase in the presence of the plasmid. Cells were exposed to either a hyperactive transposase (the “Super piggyBac”) or a wild type piggyBac transposase.

    [0092] FIG. 13C is a table depicting the percent of transformed T cells resulting from transposition with WT versus hyperactive piggyBac transposase. T cells contacted with the hyperactive piggyBac transposase (the Super piggyBac transposase) were transformed at a rate 4-fold greater than WT transposase.

    [0093] FIG. 13D is a graph depicting the percent of transformed T cells resulting from transposition with WT versus hyperactive piggyBac transposase 5 days after nucleofection. T cells contacted with the hyperactive piggyBac transposase (the Super piggyBac transposase) were transformed at a rate far greater than WT transposase.

    [0094] FIG. 14 is a graph depicting transposition in natural killer (NK) cells. Transposition of non-activated NK cells derived from CD3-depleted leukopheresis (containing CD14/CD19/CD56+ cells) is shown. Cells were electroporated (EP) with plasmid piggyBac transposon DNA encoding GFP and mRNA encoding super piggyBac. The program from Lonza 4D nucleofector or BTX ECM 830 (500V, 700 usec pulse length, 0.2 mm electrode gap, one pulse) is indicated on the X-axis. Transposed cells were co-cultured (stimulated) at day 2 with artificial antigen presenting cells (aAPCs). Fluorescent activated cell sorting (FACS) analysis of percent GFP positive cells at day 7 post-EP (day 5 post-stim) is indicated on the Y-axis with gray bars. Percent viability as shown by percent 7-Aminoactinomycin D (7AAD)-negative cells at day 2 post-EP is indicated on the Y-axis with gray bars.

    [0095] FIG. 15A-B are a series of 10 FACs plots (FIG. 15A) and a graph (FIG. 15B) showing transposon titration for transposition in natural killer (NK) cells. Transposition of non-activated NK cells from CD3-depleted leukopheresis (containing CD14/CD19/CD56+ cells) is shown. Cells were electroporated with a plasmid piggyBac transposon encoding GFP at amounts ranging from 0 to 10 ug of DNA and 5 ug mRNA encoding Super piggyBac using the indicated Maxcyte electroporator program. Transposed cells were stimulated at day 2 with artificial antigen presenting cells (aAPCs). FIG. 15A FACs plots top row shows CD56+(y-axis) versus GFP+(x-axis) expression, while the bottom row shows 7AAD (y-axis) versus forward scatter (FSC, x-axis). FIG. 15B is a bar graph analysis of the percentage of GFP+ cells of CD56+ cells at day 6 post-electroporation (EP) and day 4 post-stimulation (black bars), and the percent viability as shown by 7AAD-negative cells at day 2 post EP (gray bars).

    [0096] FIG. 16A-B are a series of 7 FACs plots (FIG. 16A) and a graph (FIG. 16B) showing dose-dependent DNA-mediated cytotoxicity in NK cells. FACS analysis of live cells (7AAD-negative/FSC) at day 2 post-EP using the Lonza 4D Nucleofector program DN-100 are shown (FIG. 16A). FACS plots (FIG. 16A) are quantified in a graph (FIG. 16B). 5E6 cells per EP were electroporated in 100 uL P3 buffer in cuvettes. Cells were electroporated with no DNA (Mock) or varying amounts of piggyBac GFP transposon co-delivered with 5 ug Super piggyBac mRNA.

    [0097] FIG. 17 is a series of 5 graphs showing the in vitro differentiation of piggyBac modified hematopoietic stem and precursor cells (HSPCs) into B cells. Human CD34+ HSPCs were electroporated with mRNA encoding Super piggyBac along with a piggyBac transposon encoding GFP. After electroporation, HSPCs were primed for B cell differentiation in presence of human IL-3, Flt3L, TPO, SCF, and G-CSF for 5 days. On day 6, cells were transferred to a layer of MS-5 feeder cells and fed bi-weekly, along with transfer to a fresh layer of feeders once per week. On day 34 of the in vitro differentiation process, CD19+ B cells were generated and detectable in the culture. Top row: FACs plots showing CD19 (y-axis) and CD34 (x-axis) in, from left to right, human primary bone marrow cells, at day 6 of in vitro differentiation, and at day 34 of in vitro differentiation. Bottom row: graphs depicting GFP expression in the indicated boxed populations of cells from the FACs plots in the top row at days 6 and 34 of in vitro differentiation.

    [0098] FIG. 18 is a schematic depiction of the Csy4-T2A-Clo051-G4Slinker-dCas9 construct map.

    [0099] FIG. 19 is a schematic depiction of the pRT1-Clo051-dCas9 Double NLS construct map.

    DETAILED DESCRIPTION

    [0100] Disclosed are compositions and methods for the ex-vivo genetic modification of an immune cell or a precursor thereof comprising delivering to the immune cell or immune precursor cell, (a) a nucleic acid or amino acid sequence comprising a sequence encoding a transposase enzyme and (b) a recombinant and non-naturally occurring DNA sequence comprising a DNA sequence encoding a transposon. In certain embodiments, the method further comprises the step of stimulating the immune cell or immune precursor cell with one or more cytokine(s).

    Immune and Immune Precursor Cells

    [0101] In certain embodiments, immune cells of the disclosure comprise lymphoid progenitor cells, natural killer (NK) cells, T lymphocytes (T-cell), stem memory T cells (T.sub.SCM cells), Stem cell-like T cells, B lymphocytes (B-cells), myeloid progenitor cells, neutrophils, basophils, eosinophils, monocytes, macrophages, platelets, erythrocytes, red blood cells (RBCs), megakaryocytes or osteoclasts.

    [0102] In certain embodiments, immune precursor cells comprise any cells which can differentiate into one or more types of immune cells. In certain embodiments, immune precursor cells comprise multipotent stem cells that can self renew and develop into immune cells. In certain embodiments, immune precursor cells comprise hematopoietic stem cells (HSCs) or descendants thereof. In certain embodiments, immune precursor cells comprise precursor cells that can develop into immune cells. In certain embodiments, the immune precursor cells comprise hematopoietic progenitor cells (HPCs).

    Hematopoietic Stem Cells (HSCs)

    [0103] Hematopoietic stem cells (HSCs) are multipotent, self-renewing cells. All differentiated blood cells from the lymphoid and myeloid lineages arise from HSCs. HSCs can be found in adult bone marrow, peripheral blood, mobilized peripheral blood, peritoneal dialysis effluent and umbilical cord blood.

    [0104] HSCs of the disclosure may be isolated or derived from a primary or cultured stem cell. HSCs of the disclosure may be isolated or derived from an embryonic stem cell, a multipotent stem cell, a pluripotent stem cell, an adult stem cell, or an induced pluripotent stem cell (iPSC).

    [0105] Immune precursor cells of the disclosure may comprise an HSC or an HSC descendent cell. Exemplary HSC descendent cells of the disclosure include, but are not limited to, multipotent stem cells, lymphoid progenitor cells, natural killer (NK) cells, T lymphocyte cells (T-cells), B lymphocyte cells (B-cells), myeloid progenitor cells, neutrophils, basophils, eosinophils, monocytes, and macrophages.

    [0106] HSCs produced by the methods of the disclosure may retain features of “primitive” stem cells that, while isolated or derived from an adult stem cell and while committed to a single lineage, share characteristics of embryonic stem cells. For example, the “primitive” HSCs produced by the methods of the disclosure retain their “stemness” following division and do not differentiate. Consequently, as an adoptive cell therapy, the “primitive” HSCs produced by the methods of the disclosure not only replenish their numbers, but expand in vivo. “Primitive” HSCs produced by the methods of the disclosure may be therapeutically-effective when administered as a single dose. In some embodiments, primitive HSCs of the disclosure are CD34+. In some embodiments, primitive HSCs of the disclosure are CD34+ and CD38−. In some embodiments, primitive HSCs of the disclosure are CD34+, CD38− and CD90+. In some embodiments, primitive HSCs of the disclosure are CD34+, CD38−, CD90+ and CD45RA−. In some embodiments, primitive HSCs of the disclosure are CD34+, CD38−, CD90+, CD45RA−, and CD49f+. In some embodiments, the most primitive HSCs of the disclosure are CD34+, CD38−, CD90+, CD45RA−, and CD49f+.

    [0107] In some embodiments of the disclosure, primitive HSCs, HSCs, and/or HSC descendent cells may be modified according to the methods of the disclosure to express an exogenous sequence (e.g. a chimeric antigen receptor or therapeutic protein). In some embodiments of the disclosure, modified primitive HSCs, modified HSCs, and/or modified HSC descendent cells may be forward differentiated to produce a modified immune cell including, but not limited to, a modified T cell, a modified natural killer cell and/or a modified B-cell of the disclosure.

    T Cells

    [0108] Modified T cells of the disclosure may be derived from modified hematopoietic stem and progenitor cells (HSPCs) or modified HSCs.

    [0109] Unlike traditional biologics and chemotherapeutics, modified-T cells of the disclosure possess the capacity to rapidly reproduce upon antigen recognition, thereby potentially obviating the need for repeat treatments. To achieve this, in some embodiments, modified-T cells of the disclosure not only drive an initial response, but also persist in the patient as a stable population of viable memory T cells to prevent potential relapses. Alternatively, in some embodiments, when it is not desired, modified-T cells of the disclosure do not persist in the patient.

    [0110] Intensive efforts have been focused on the development of antigen receptor molecules that do not cause T cell exhaustion through antigen-independent (tonic) signaling, as well as of a modified-T cell product containing early memory T cells, especially stem cell memory (T.sub.SCM) or stem cell-like T cells. Stem cell-like modified-T cells of the disclosure exhibit the greatest capacity for self-renewal and multipotent capacity to derive central memory (T.sub.CM) T cells or T.sub.CM like cells, effector memory (T.sub.EM) and effector T cells (T.sub.E), thereby producing better tumor eradication and long-term modified-T cell engraftment. A linear pathway of differentiation may be responsible for generating these cells: Naïve T cells (T.sub.N)>T.sub.SCM>T.sub.CM>T.sub.EM>T.sub.E>T.sub.TE, whereby T.sub.N is the parent precursor cell that directly gives rise to T.sub.SCM, which then, in turn, directly gives rise to T.sub.CM, etc. Compositions of T cells of the disclosure may comprise one or more of each parental T cell subset with T.sub.SCM cells being the most abundant (e.g. T.sub.SCM>T.sub.CM>T.sub.EM>T.sub.E>T.sub.TE).

    [0111] In some embodiments of the methods of the disclosure, the immune cell precursor is differentiated into or is capable of differentiating into an early memory T cell, a stem cell like T-cell, a Naïve T cells (T.sub.N), a T.sub.SCM, a T.sub.CM, a T.sub.EM, a T.sub.E, or a T.sub.TE. In some embodiments, the immune cell precursor is a primitive HSC, an HSC, or a HSC descendent cell of the disclosure.

    [0112] In some embodiments of the methods of the disclosure, the immune cell is an early memory T cell, a stem cell like T-cell, a Naïve T cells (T.sub.N), a T.sub.SCM, a T.sub.CM, a T.sub.EM, a T.sub.E, or a T.sub.TE.

    [0113] In some embodiments of the methods of the disclosure, the immune cell is an early memory T cell.

    [0114] In some embodiments of the methods of the disclosure, the immune cell is a stem cell like T-cell.

    [0115] In some embodiments of the methods of the disclosure, the immune cell is a T.sub.SCM.

    [0116] In some embodiments of the methods of the disclosure, the immune cell is a T.sub.CM.

    [0117] In some embodiments of the methods of the disclosure, the methods modify and/or the methods produce a plurality of modified T cells, wherein at least 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between of the plurality of modified T cells expresses one or more cell-surface marker(s) of an early memory T cell. In certain embodiments, the plurality of modified early memory T cells comprises at least one modified stem cell-like T cell. In certain embodiments, the plurality of modified early memory T cells comprises at least one modified T.sub.SCM. In certain embodiments, the plurality of modified early memory T cells comprises at least one modified T.sub.CM.

    [0118] In some embodiments of the methods of the disclosure, the methods modify and/or the methods produce a plurality of modified T cells, wherein at least 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between of the plurality of modified T cells expresses one or more cell-surface marker(s) of a stem cell-like T cell. In certain embodiments, the plurality of modified stem cell-like T cells comprises at least one modified T.sub.SCM. In certain embodiments, the plurality of modified stem cell-like T cells comprises at least one modified T.sub.CM.

    [0119] In some embodiments of the methods of the disclosure, the methods modify and/or the methods produce a plurality of modified T cells, wherein at least 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between of the plurality of modified T cells expresses one or more cell-surface marker(s) of a stem memory T cell (T.sub.SCM). In certain embodiments, the cell-surface markers comprise CD62L and CD45RA. In certain embodiments, the cell-surface markers comprise one or more of CD62L, CD45RA, CD28, CCR7, CD127, CD45RO, CD95, CD95 and IL-2Rβ. In certain embodiments, the cell-surface markers comprise one or more of CD45RA, CD95, CCR7, and CD62L.

    [0120] In some embodiments of the methods of the disclosure, the methods modify and/or the methods produce a plurality of modified T cells, wherein at least 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between of the plurality of modified T cells expresses one or more cell-surface marker(s) of a central memory T cell (T.sub.CM). In certain embodiments, the cell-surface markers comprise one or more of CD45RO, CD95, CCR7, and CD62L.

    [0121] In some embodiments of the methods of the disclosure, the methods modify and/or the methods produce a plurality of modified T cells, wherein at least 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between of the plurality of modified T cells expresses one or more cell-surface marker(s) of a naïve T cell (T.sub.N). In certain embodiments, the cell-surface markers comprise one or more of CD45RA, CCR7 and CD62L.

    [0122] In some embodiments of the methods of the disclosure, the methods modify and/or the methods produce a plurality of modified T cells, wherein at least 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between of the plurality of modified T cells expresses one or more cell-surface marker(s) of an effector T-cell (modified T.sub.EFF). In certain embodiments, the cell-surface markers comprise one or more of CD45RA, CD95, and IL-2Rβ.

    [0123] In some embodiments of the methods of the disclosure, the methods modify and/or the methods produce a plurality of modified T cells, wherein at least 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between of the plurality of modified T cells expresses one or more cell-surface marker(s) of a stem cell-like T cell, a stem memory T cell (T.sub.SCM) or a central memory T cell (T.sub.CM).

    [0124] In some embodiments of the methods of the disclosure, a buffer comprises the immune cell or precursor thereof. The buffer maintains or enhances a level of cell viability and/or a stem-like phenotype of the immune cell or precursor thereof, including T-cells. In certain embodiments, the buffer maintains or enhances a level of cell viability and/or a stem-like phenotype of the primary human T cells prior to the nucleofection. In certain embodiments, the buffer maintains or enhances a level of cell viability and/or a stem-like phenotype of the primary human T cells during the nucleofection. In certain embodiments, the buffer maintains or enhances a level of cell viability and/or a stem-like phenotype of the primary human T cells following the nucleofection. In certain embodiments, the buffer comprises one or more of KCl, MgCl.sub.2, ClNa, Glucose and Ca (NO.sub.3).sub.2 in any absolute or relative abundance or concentration, and, optionally, the buffer further comprises a supplement selected from the group consisting of HEPES, Tris/HCl, and a phosphate buffer. In certain embodiments, the buffer comprises 5 mM KCl, 15 mM MgCl.sub.2, 90 mM ClNa, 10 mM Glucose and 0.4 mM Ca(NO.sub.3).sub.2. In certain embodiments, the buffer comprises 5 mM KCl, 15 mM MgCl.sub.2, 90 mM ClNa, 10 mM Glucose and 0.4 mM Ca(NO.sub.3).sub.2 and a supplement comprising 20 mM HEPES and 75 mM Tris/HCl. In certain embodiments, the buffer comprises 5 mM KCl, 15 mM MgCl.sub.2, 90 mM ClNa, 10 mM Glucose and 0.4 mM Ca(NO.sub.3).sub.2 and a supplement comprising 40 mM Na.sub.2HPO.sub.4/NaH.sub.2PO.sub.4 at pH 7.2. In certain embodiments, the composition comprising primary human T cells comprises 100 μl of the buffer and between 5×10.sup.6 and 25×10.sup.6 cells. In certain embodiments, the composition comprises a scalable ratio of 250e6 primary human T cells per milliliter of buffer or other media during the introduction step.

    [0125] In some embodiments of the methods of the disclosure, the introducing step may comprise delivery of transposon and/or transposase by a method other than electroporation or nucleofection. In some embodiments, a composition comprises a scalable ratio of 250e6 primary human T cells per milliliter of buffer or other media during the introduction step.

    [0126] In some embodiments of the methods of the disclosure, the introducing step comprises one or more of topical delivery, adsorption, absorption, electroporation, spin-fection, co-culture, transfection, mechanical delivery, sonic delivery, vibrational delivery, magnetofection or by nanoparticle-mediated delivery.

    [0127] In some embodiments of the methods of the disclosure, the introducing step comprises liposomal transfection, calcium phosphate transfection, fugene transfection, and dendrimer-mediated transfection.

    [0128] In some embodiments of the methods of the disclosure, the introducing step comprises mechanical transfection comprises cell squeezing, cell bombardment, or gene gun techniques.

    [0129] In some embodiments of the methods of the disclosure, the introducing step comprises nanoparticle-mediated transfection comprises liposomal delivery, delivery by micelles, and delivery by polymerosomes.

    [0130] In some embodiments of the methods of the disclosure, the methods comprise contacting an immune cell of the disclosure, including a T cell of the disclosure, and a T-cell expansion composition. In some embodiments of the methods of the disclosure, the step of introducing a transposon and/or transposase of the disclosure into an immune cell of the disclosure may further comprise contacting the immune cell and a T-cell expansion composition. In some embodiments, including those in which the introducing step of the methods comprises an electroporation or a nucleofection step, the electroporation or a nucleofection step may be performed with the immune cell contacting T-cell expansion composition of the disclosure.

    [0131] In some embodiments of the methods of the disclosure, the T-cell expansion composition comprises, consists essentially of or consists of phosphorus; one or more of an octanoic acid, a palmitic acid, a linoleic acid, and an oleic acid; a sterol; and an alkane.

    [0132] In certain embodiments of the methods of producing a modified T cell of the disclosure, the expansion supplement comprises one or more cytokine(s). The one or more cytokine(s) may comprise any cytokine, including but not limited to, lymphokines. Exemplary lympokines include, but are not limited to, interleukin-2 (IL-2), interleukin-3 (IL-3), interleukin-4 (IL-4), interleukin-5 (IL-5), interleukin-6 (IL-6), interleukin-7 (IL-7), interleukin-15 (IL-15), interleukin-21 (IL-21), granulocyte-macrophage colony-stimulating factor (GM-CSF) and interferon-gamma (INFγ). The one or more cytokine(s) may comprise IL-2.

    [0133] In some embodiments of the methods of the disclosure, the T-cell expansion composition comprises human serum albumin, recombinant human insulin, human transferrin, 2-Mercaptoethanol, and an expansion supplement. In certain embodiments of this method, the T-cell expansion composition further comprises one or more of octanoic acid, nicotinamide, 2,4,7,9-tetramethyl-5-decyn-4,7-diol (TMDD), diisopropyl adipate (DIPA), n-butyl-benzenesulfonamide, 1,2-benzenedicarboxylic acid, bis(2-methylpropyl) ester, palmitic acid, linoleic acid, oleic acid, stearic acid hydrazide, oleamide, a sterol and an alkane. In certain embodiments of this method, the T-cell expansion composition further comprises one or more of octanoic acid, palmitic acid, linoleic acid, oleic acid and a sterol. In certain embodiments of this method, the T-cell expansion composition further comprises one or more of octanoic acid at a concentration of between 0.9 mg/kg to 90 mg/kg, inclusive of the endpoints; palmitic acid at a concentration of between 0.2 mg/kg to 20 mg/kg, inclusive of the endpoints; linoleic acid at a concentration of between 0.2 mg/kg to 20 mg/kg, inclusive of the endpoints; oleic acid at a concentration of 0.2 mg/kg to 20 mg/kg, inclusive of the endpoints; and a sterol at a concentration of about 0.1 mg/kg to 10 mg/kg, inclusive of the endpoints. In certain embodiments of this method, the T-cell expansion composition further comprises one or more of octanoic acid at a concentration of about 9 mg/kg, palmitic acid at a concentration of about 2 mg/kg, linoleic acid at a concentration of about 2 mg/kg, oleic acid at a concentration of about 2 mg/kg and a sterol at a concentration of about 1 mg/kg. In certain embodiments of this method, the T-cell expansion composition further comprises one or more of octanoic acid at a concentration of between 6.4 μmol/kg and 640 μmol/kg, inclusive of the endpoints; palmitic acid at a concentration of between 0.7 μmol/kg and 70 μmol/kg, inclusive of the endpoints; linoleic acid at a concentration of between 0.75 μmol/kg and 75 μmol/kg, inclusive of the endpoints; oleic acid at a concentration of between 0.75 μmol/kg and 75 μmol/kg, inclusive of the endpoints; and a sterol at a concentration of between 0.25 μmol/kg and 25 μmol/kg, inclusive of the endpoints. In certain embodiments of this method, the T-cell expansion composition further comprises one or more of octanoic acid at a concentration of about 64 μmol/kg, palmitic acid at a concentration of about 7 μmol/kg, linoleic acid at a concentration of about 7.5 μmol/kg, oleic acid at a concentration of about 7.5 μmol/kg and a sterol at a concentration of about 2.5 μmol/kg.

    [0134] In certain embodiments, the T-cell expansion composition comprises one or more of human serum albumin, recombinant human insulin, human transferrin, 2-Mercaptoethanol, and an expansion supplement to produce a plurality of expanded modified T-cells, wherein at least 2% of the plurality of modified T-cells expresses one or more cell-surface marker(s) of an early memory T cell, a stem cell-like T cell, a stem memory T cell (T.sub.SCM) and/or a central memory T cell (T.sub.CM). In certain embodiments, the T-cell expansion composition comprises or further comprises one or more of octanoic acid, nicotinamide, 2,4,7,9-tetramethyl-5-decyn-4,7-diol (TMDD), diisopropyl adipate (DIPA), n-butyl-benzenesulfonamide, 1,2-benzenedicarboxylic acid, bis(2-methylpropyl) ester, palmitic acid, linoleic acid, oleic acid, stearic acid hydrazide, oleamide, a sterol and an alkane. In certain embodiments, the T-cell expansion composition comprises one or more of octanoic acid, palmitic acid, linoleic acid, oleic acid and a sterol (e.g. cholesterol). In certain embodiments, the T-cell expansion composition comprises one or more of octanoic acid at a concentration of between 0.9 mg/kg to 90 mg/kg, inclusive of the endpoints; palmitic acid at a concentration of between 0.2 mg/kg to 20 mg/kg, inclusive of the endpoints; linoleic acid at a concentration of between 0.2 mg/kg to 20 mg/kg, inclusive of the endpoints; oleic acid at a concentration of 0.2 mg/kg to 20 mg/kg, inclusive of the endpoints; and a sterol at a concentration of about 0.1 mg/kg to 10 mg/kg, inclusive of the endpoints (wherein mg/kg=parts per million). In certain embodiments, the T-cell expansion composition comprises one or more of octanoic acid at a concentration of about 9 mg/kg, palmitic acid at a concentration of about 2 mg/kg, linoleic acid at a concentration of about 2 mg/kg, oleic acid at a concentration of about 2 mg/kg, and a sterol at a concentration of about 1 mg/kg (wherein mg/kg=parts per million). In certain embodiments, the T-cell expansion composition comprises one or more of octanoic acid at a concentration of 9.19 mg/kg, palmitic acid at a concentration of 1.86 mg/kg, linoleic acid at a concentration of about 2.12 mg/kg, oleic acid at a concentration of about 2.13 mg/kg, and a sterol at a concentration of about 1.01 mg/kg (wherein mg/kg=parts per million). In certain embodiments, the T-cell expansion composition comprises octanoic acid at a concentration of 9.19 mg/kg, palmitic acid at a concentration of 1.86 mg/kg, linoleic acid at a concentration of 2.12 mg/kg, oleic acid at a concentration of about 2.13 mg/kg, and a sterol at a concentration of 1.01 mg/kg (wherein mg/kg=parts per million). In certain embodiments, the T-cell expansion composition comprises one or more of octanoic acid at a concentration of between 6.4 μmol/kg and 640 μmol/kg, inclusive of the endpoints; palmitic acid at a concentration of between 0.7 μmol/kg and 70 μmol/kg, inclusive of the endpoints; linoleic acid at a concentration of between 0.75 μmol/kg and 75 μmol/kg, inclusive of the endpoints; oleic acid at a concentration of between 0.75 μmol/kg and 75 μmol/kg, inclusive of the endpoints; and a sterol at a concentration of between 0.25 μmol/kg and 25 μmol/kg, inclusive of the endpoints. In certain embodiments, the T-cell expansion composition comprises one or more of octanoic acid at a concentration of about 64 μmol/kg, palmitic acid at a concentration of about 7 μmol/kg, linoleic acid at a concentration of about 7.5 μmol/kg, oleic acid at a concentration of about 7.5 μmol/kg and a sterol at a concentration of about 2.5 μmol/kg. In certain embodiments, the T-cell expansion composition comprises one or more of octanoic acid at a concentration of about 63.75 μmol/kg, palmitic acid at a concentration of about 7.27 μmol/kg, linoleic acid at a concentration of about 7.57 μmol/kg, oleic acid at a concentration of about 7.56 μmol/kg and a sterol at a concentration of about 2.61 μmol/kg. In certain embodiments, the T-cell expansion composition comprises octanoic acid at a concentration of about 63.75 μmol/kg, palmitic acid at a concentration of about 7.27 μmol/kg, linoleic acid at a concentration of about 7.57 μmol/kg, oleic acid at a concentration of 7.56 μmol/kg and a sterol at a concentration of 2.61 μmol/kg.

    [0135] As used herein, the terms “supplemented T-cell expansion composition” or “T-cell expansion composition” may be used interchangeably with a media comprising one or more of human serum albumin, recombinant human insulin, human transferrin, 2-Mercaptoethanol, and an expansion supplement at 37° C. Alternatively, or in addition, the terms “supplemented T-cell expansion composition” or “T-cell expansion composition” may be used interchangeably with a media comprising one or more of phosphorus, an octanoic fatty acid, a palmitic fatty acid, a linoleic fatty acid and an oleic acid. In certain embodiments, the media comprises an amount of phosphorus that is 10-fold higher than may be found in, for example, Iscove's Modified Dulbecco's Medium ((IMDM); available at ThermoFisher Scientific as Catalog number 12440053).

    [0136] As used herein, the terms “supplemented T-cell expansion composition” or “T-cell expansion composition” may be used interchangeably with a media comprising one or more of human serum albumin, recombinant human insulin, human transferrin, 2-Mercaptoethanol, Iscove's MDM, and an expansion supplement at 37° C. Alternatively, or in addition, the terms “supplemented T-cell expansion composition” or “T-cell expansion composition” may be used interchangeably with a media comprising one or more of the following elements: boron, sodium, magnesium, phosphorus, potassium, and calcium. In certain embodiments, the terms “supplemented T-cell expansion composition” or “T-cell expansion composition” may be used interchangeably with a media comprising one or more of the following elements present in the corresponding average concentrations: boron at 3.7 mg/L, sodium at 3000 mg/L, magnesium at 18 mg/L, phosphorus at 29 mg/L, potassium at 15 mg/L and calcium at 4 mg/L.

    [0137] As used herein, the terms “supplemented T-cell expansion composition” or “T-cell expansion composition” may be used interchangeably with a media comprising one or more of human serum albumin, recombinant human insulin, human transferrin, 2-Mercaptoethanol, and an expansion supplement at 37° C. Alternatively, or in addition, the terms “supplemented T-cell expansion composition” or “T-cell expansion composition” may be used interchangeably with a media comprising one or more of the following components: octanoic acid (CAS No. 124-07-2), nicotinamide (CAS No. 98-92-0), 2,4,7,9-tetramethyl-5-decyn-4,7-diol (TMDD) (CAS No. 126-86-3), diisopropyl adipate (DIPA) (CAS No. 6938-94-9), n-butyl-benzenesulfonamide (CAS No. 3622-84-2), 1,2-benzenedicarboxylic acid, bis(2-methylpropyl) ester (CAS No. 84-69-5), palmitic acid (CAS No. 57-10-3), linoleic acid (CAS No. 60-33-3), oleic acid (CAS No. 112-80-1), stearic acid hydrazide (CAS No. 4130-54-5), oleamide (CAS No. 3322-62-1), sterol (e.g., cholesterol) (CAS No. 57-88-5), and alkanes (e.g., nonadecane) (CAS No. 629-92-5). In certain embodiments, the terms “supplemented T-cell expansion composition” or “T-cell expansion composition” may be used interchangeably with a media comprising one or more of the following components: octanoic acid (CAS No. 124-07-2), nicotinamide (CAS No. 98-92-0), 2,4,7,9-tetramethyl-5-decyn-4,7-diol (TMDD) (CAS No. 126-86-3), diisopropyl adipate (DIPA) (CAS No. 6938-94-9), n-butyl-benzenesulfonamide (CAS No. 3622-84-2), 1,2-benzenedicarboxylic acid, bis(2-methylpropyl) ester (CAS No. 84-69-5), palmitic acid (CAS No. 57-10-3), linoleic acid (CAS No. 60-33-3), oleic acid (CAS No. 112-80-1), stearic acid hydrazide (CAS No. 4130-54-5), oleamide (CAS No. 3322-62-1), sterol (e.g., cholesterol) (CAS No. 57-88-5), alkanes (e.g., nonadecane) (CAS No. 629-92-5), and phenol red (CAS No. 143-74-8). In certain embodiments, the terms “supplemented T-cell expansion composition” or “T-cell expansion composition” may be used interchangeably with a media comprising one or more of the following components: octanoic acid (CAS No. 124-07-2), nicotinamide (CAS No. 98-92-0), 2,4,7,9-tetramethyl-5-decyn-4,7-diol (TMDD) (CAS No. 126-86-3), diisopropyl adipate (DIPA) (CAS No. 6938-94-9), n-butyl-benzenesulfonamide (CAS No. 3622-84-2), 1,2-benzenedicarboxylic acid, bis(2-methylpropyl) ester (CAS No. 84-69-5), palmitic acid (CAS No. 57-10-3), linoleic acid (CAS No. 60-33-3), oleic acid (CAS No. 112-80-1), stearic acid hydrazide (CAS No. 4130-54-5), oleamide (CAS No. 3322-62-1), phenol red (CAS No. 143-74-8) and lanolin alcohol.

    [0138] In certain embodiments, the terms “supplemented T-cell expansion composition” or “T-cell expansion composition” may be used interchangeably with a media comprising one or more of human serum albumin, recombinant human insulin, human transferrin, 2-Mercaptoethanol, and an expansion supplement at 37° C. Alternatively, or in addition, the terms “supplemented T-cell expansion composition” or “T-cell expansion composition” may be used interchangeably with a media comprising one or more of the following ions: sodium, ammonium, potassium, magnesium, calcium, chloride, sulfate and phosphate.

    [0139] As used herein, the terms “supplemented T-cell expansion composition” or “T-cell expansion composition” may be used interchangeably with a media comprising one or more of human serum albumin, recombinant human insulin, human transferrin, 2-Mercaptoethanol, and an expansion supplement at 37° C. Alternatively, or in addition, the terms “supplemented T-cell expansion composition” or “T-cell expansion composition” may be used interchangeably with a media comprising one or more of the following free amino acids: histidine, asparagine, serine, glutamate, arginine, glycine, aspartic acid, glutamic acid, threonine, alanine, proline, cysteine, lysine, tyrosine, methionine, valine, isoleucine, leucine, phenylalanine and tryptophan. In certain embodiments, the terms “supplemented T-cell expansion composition” or “T-cell expansion composition” may be used interchangeably with a media comprising one or more of the following free amino acids in the corresponding average mole percentages: histidine (about 1%), asparagine (about 0.5%), serine (about 1.5%), glutamine (about 67%), arginine (about 1.5%), glycine (about 1.5%), aspartic acid (about 1%), glutamic acid (about 2%), threonine (about 2%), alanine (about 1%), proline (about 1.5%), cysteine (about 1.5%), lysine (about 3%), tyrosine (about 1.5%), methionine (about 1%), valine (about 3.5%), isoleucine (about 3%), leucine (about 3.5%), phenylalanine (about 1.5%) and tryptophan (about 0.5%). In certain embodiments, the terms “supplemented T-cell expansion composition” or “T-cell expansion composition” may be used interchangeably with a media comprising one or more of the following free amino acids in the corresponding average mole percentages: histidine (about 0.78%), asparagine (about 0.4%), serine (about 1.6%), glutamine (about 67.01%), arginine (about 1.67%), glycine (about 1.72%), aspartic acid (about 1.00%), glutamic acid (about 1.93%), threonine (about 2.38%), alanine (about 1.11%), proline (about 1.49%), cysteine (about 1.65%), lysine (about 2.84%), tyrosine (about 1.62%), methionine (about 0.85%), valine (about 3.45%), isoleucine (about 3.14%), leucine (about 3.3%), phenylalanine (about 1.64%) and tryptophan (about 0.37%).

    [0140] As used herein, the terms “supplemented T-cell expansion composition” or “T-cell expansion composition” may be used interchangeably with a media comprising one or more of human serum albumin, recombinant human insulin, human transferrin, 2-Mercaptoethanol, Iscove's MDM, and an expansion supplement at 37° C. Alternatively, or in addition, the terms “supplemented T-cell expansion composition” or “T-cell expansion composition” may be used interchangeably with a media comprising one or more of phosphorus, an octanoic fatty acid, a palmitic fatty acid, a linoleic fatty acid and an oleic acid. In certain embodiments, the media comprises an amount of phosphorus that is 10-fold higher than may be found in, for example, Iscove's Modified Dulbecco's Medium ((IMDM); available at ThermoFisher Scientific as Catalog number 12440053).

    [0141] In certain embodiments, the terms “supplemented T-cell expansion composition” or “T-cell expansion composition” may be used interchangeably with a media comprising one or more of octanoic acid, palmitic acid, linoleic acid, oleic acid and a sterol (e.g. cholesterol). In certain embodiments, the terms “supplemented T-cell expansion composition” or “T-cell expansion composition” may be used interchangeably with a media comprising one or more of octanoic acid at a concentration of between 0.9 mg/kg to 90 mg/kg, inclusive of the endpoints; palmitic acid at a concentration of between 0.2 mg/kg to 20 mg/kg, inclusive of the endpoints; linoleic acid at a concentration of between 0.2 mg/kg to 20 mg/kg, inclusive of the endpoints; oleic acid at a concentration of 0.2 mg/kg to 20 mg/kg, inclusive of the endpoints; and a sterol at a concentration of about 0.1 mg/kg to 10 mg/kg, inclusive of the endpoints (wherein mg/kg=parts per million). In certain embodiments, the terms “supplemented T-cell expansion composition” or “T-cell expansion composition” may be used interchangeably with a media comprising one or more of octanoic acid at a concentration of about 9 mg/kg, palmitic acid at a concentration of about 2 mg/kg, linoleic acid at a concentration of about 2 mg/kg, oleic acid at a concentration of about 2 mg/kg, and a sterol at a concentration of about 1 mg/kg (wherein mg/kg=parts per million). In certain embodiments, the terms “supplemented T-cell expansion composition” or “T-cell expansion composition” may be used interchangeably with a media comprising one or more of octanoic acid at a concentration of 9.19 mg/kg, palmitic acid at a concentration of 1.86 mg/kg, linoleic acid at a concentration of about 2.12 mg/kg, oleic acid at a concentration of about 2.13 mg/kg, and a sterol at a concentration of about 1.01 mg/kg (wherein mg/kg=parts per million). In certain embodiments, the terms “supplemented T-cell expansion composition” or “T-cell expansion composition” may be used interchangeably with a media comprising one or more of octanoic acid at a concentration of 9.19 mg/kg, palmitic acid at a concentration of 1.86 mg/kg, linoleic acid at a concentration of 2.12 mg/kg, oleic acid at a concentration of about 2.13 mg/kg, and a sterol at a concentration of 1.01 mg/kg (wherein mg/kg=parts per million). In certain embodiments, the terms “supplemented T-cell expansion composition” or “T-cell expansion composition” may be used interchangeably with a media comprising one or more of octanoic acid at a concentration of between 6.4 μmol/kg and 640 μmol/kg, inclusive of the endpoints; palmitic acid at a concentration of between 0.7 μmol/kg and 70 μmol/kg, inclusive of the endpoints; linoleic acid at a concentration of between 0.75 μmol/kg and 75 μmol/kg, inclusive of the endpoints; oleic acid at a concentration of between 0.75 μmol/kg and 75 μmol/kg, inclusive of the endpoints; and a sterol at a concentration of between 0.25 μmol/kg and 25 μmol/kg, inclusive of the endpoints. In certain embodiments, the terms “supplemented T-cell expansion composition” or “T-cell expansion composition” may be used interchangeably with a media comprising one or more of octanoic acid at a concentration of about 64 μmol/kg, palmitic acid at a concentration of about 7 μmol/kg, linoleic acid at a concentration of about 7.5 μmol/kg, oleic acid at a concentration of about 7.5 μmol/kg and a sterol at a concentration of about 2.5 μmol/kg.

    [0142] In certain embodiments, the terms “supplemented T-cell expansion composition” or “T-cell expansion composition” may be used interchangeably with a media comprising one or more of octanoic acid at a concentration of about 63.75 μmol/kg, palmitic acid at a concentration of about 7.27 μmol/kg, linoleic acid at a concentration of about 7.57 μmol/kg, oleic acid at a concentration of about 7.56 μmol/kg and a sterol at a concentration of about 2.61 μmol/kg. In certain embodiments, the terms “supplemented T-cell expansion composition” or “T-cell expansion composition” may be used interchangeably with a media comprising one or more of octanoic acid at a concentration of about 63.75 μmol/kg, palmitic acid at a concentration of about 7.27 μmol/kg, linoleic acid at a concentration of about 7.57 μmol/kg, oleic acid at a concentration of 7.56 μmol/kg and a sterol at a concentration of 2.61 μmol/kg.

    [0143] Modified T-cells of the disclosure, including modified stem cell-like T cells, T.sub.SCM and/or T.sub.CM of the disclosure, may be incubated, cultured, grown, stored, or otherwise, combined at any step in the methods of the procedure with a growth medium comprising one or more inhibitors a component of a PI3K pathway. Exemplary inhibitors a component of a PI3K pathway include, but are not limited to, an inhibitor of GSK3β such as TWS119 (also known as GSK 3B inhibitor XII; CAS Number 601514-19-6 having a chemical formula C.sub.18H.sub.14N.sub.4O.sub.2). Exemplary inhibitors of a component of a PI3K pathway include, but are not limited to, bb007 (BLUEBIRDBIO™).

    [0144] In some embodiments of the methods of the disclosure, the methods comprise contacting an immune cell of the disclosure and a T-cell activator composition. In some embodiments of the methods of the disclosure, the methods comprise contacting an immune cell precursor of the disclosure and a T-cell activator composition. In some embodiments of the methods of the disclosure, the methods comprise contacting a modified T cell of the disclosure and a T-cell activator composition. In some embodiments, the T-cell activator composition comprises one or more of an anti-human CD3 monospecific tetrameric antibody complex, an anti-human CD28 monospecific tetrameric antibody complex and an activation supplement to produce an activated modified T-cell or a plurality of activated modified T-cells. In some embodiments, the activated modified T-cell expresses one or more cell-surface marker(s) of an early memory T cell, a stem cell-like T cell, a T.sub.SCM or a T.sub.CM. In some embodiments, at least 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between of the plurality of activated modified T-cells express one or more cell-surface marker(s) of an early memory T cell, a stem cell-like T cell, a T.sub.SCM or a T.sub.CM.

    [0145] In certain embodiments of the methods of producing a modified T cell (e.g. a stem cell-like T cell, a T.sub.SCM and/or a T.sub.CM) of the disclosure, the activation supplement may comprise one or more cytokine(s). The one or more cytokine(s) may comprise any cytokine, including but not limited to, lymphokines. Exemplary lympokines include, but are not limited to, interleukin-2 (IL-2), interleukin-3 (IL-3), interleukin-4 (IL-4), interleukin-5 (IL-5), interleukin-6 (IL-6), interleukin-7 (IL-7), interleukin-15 (IL-15), interleukin-21 (IL-21), granulocyte-macrophage colony-stimulating factor (GM-CSF) and interferon-gamma (INFγ). The one or more cytokine(s) may comprise IL-2.

    Natural Killer (NK) Cells

    [0146] In certain embodiments, the modified immune or immune precursor cells of the disclosure are natural killer (NK) cells. In certain embodiments, NK cells are cytotoxic lymphocytes that differentiate from lymphoid progenitor cells.

    [0147] Modified NK cells of the disclosure may be derived from modified hematopoietic stem and progenitor cells (HSPCs) or modified HSCs.

    [0148] In certain embodiments, non-activated NK cells are derived from CD3-depleted leukopheresis (containing CD14/CD19/CD56+ cells).

    [0149] In certain embodiments, NK cells are electroporated using a Lonza 4D nucleofector or BTX ECM 830 (500V, 700 usec pulse length, 0.2 mm electrode gap, one pulse). All Lonza 4D nucleofector programs are contemplated as within the scope of the methods of the disclosure.

    [0150] In certain embodiments, 5×10E6 cells were electroporated per electroporation in 100 μL P3 buffer in cuvettes. However, this ratio of cells per volume is scalable for commercial manufacturing methods.

    [0151] In certain embodiments, NK cells were stimulated by co-culture with an additional cell line. In certain embodiments, the additional cell line comprises artificial antigen presenting cells (aAPCs). In certain embodiments, stimulation occurs at day 1, 2, 3, 4, 5, 6, or 7 following electroporation. In certain embodiments, stimulation occurs at day 2 following electroporation.

    [0152] In certain embodiments, NK cells express CD56.

    B cells

    [0153] In certain embodiments, the modified immune or immune precursor cells of the disclosure are B cells. B cells are a type of lymphocyte that express B cell receptors on the cell surface. B cell receptors bind to specific antigens.

    [0154] Modified B cells of the disclosure may be derived from modified hematopoietic stem and progenitor cells (HSPCs) or modified HSCs.

    [0155] In certain embodiments, HSPCs are modified using the methods of the disclosure, and then primed for B cell differentiation in presence of human IL-3, Flt3L, TPO, SCF, and G-CSF for at least 3 days, at least 4 days, at least 5 days, at least 6 days or at least 7 days. In certain embodiments, HSPCs are modified using the methods of the disclosure, and then primed for B cell differentiation in presence of human IL-3, Flt3L, TPO, SCF, and G-CSF for 5 days.

    [0156] In certain embodiments, following priming, modified HSPC cells are transferred to a layer of feeder cells and fed bi-weekly, along with transfer to a fresh layer of feeders once per week. In certain embodiments, the feeder cells are MS-5 feeder cells.

    [0157] In certain embodiments, modified HSPC cells are cultured with MS-5 feeder cells for at least 7, 14, 21, 28, 30, 33, 35, 42 or 48 days. In certain embodiments, modified HSPC cells were cultured with MS-5 feeder cells for 33 days.

    Chimeric Antigen Receptors

    [0158] In certain embodiments, a modified immune or pre-immune cell of the disclosure comprises a chimeric antigen receptor.

    [0159] In certain embodiments of the methods of the disclosure, the recombinant and non-naturally occurring DNA sequence encoding a transposon further comprises a sequence encoding a chimeric antigen receptor or a portion thereof. Chimeric antigen receptors (CARs) of the disclosure may comprise (a) an ectodomain comprising an antigen recognition region, (b) a transmembrane domain, and (c) an endodomain comprising at least one costimulatory domain. In certain embodiments, the ectodomain may further comprise a signal peptide. Alternatively, or in addition, in certain embodiments, the ectodomain may further comprise a hinge between the antigen recognition region and the transmembrane domain. In certain embodiments of the CARs of the disclosure, the signal peptide may comprise a sequence encoding a human CD2, CD3δ, CD3ε, CD3γ, CD3ζ, CD4, CD8α, CD19, CD28, 4-1BB or GM-CSFR signal peptide. In certain embodiments of the CARs of the disclosure, the signal peptide may comprise a sequence encoding a human CD8α signal peptide. In certain embodiments, the transmembrane domain may comprise a sequence encoding a human CD2, CD3δ, CD3ε, CD3γ, CD3ζ, CD4, CD8α, CD19, CD28, 4-1BB or GM-CSFR transmembrane domain. In certain embodiments of the CARs of the disclosure, the transmembrane domain may comprise a sequence encoding a human CD8α transmembrane domain. In certain embodiments of the CARs of the disclosure, the endodomain may comprise a human CD3 endodomain.

    [0160] In certain embodiments of the CARs of the disclosure, the at least one costimulatory domain may comprise a human 4-1BB, CD28, CD40, ICOS, MyD88, OX-40 intracellular segment, or any combination thereof. In certain embodiments of the CARs of the disclosure, the at least one costimulatory domain may comprise a CD28 and/or a 4-1BB costimulatory domain. In certain embodiments of the CARs of the disclosure, the hinge may comprise a sequence derived from a human CD8α, IgG4, and/or CD4 sequence. In certain embodiments of the CARs of the disclosure, the hinge may comprise a sequence derived from a human CD8α sequence.

    [0161] The CD28 costimulatory domain may comprise an amino acid sequence comprising

    TABLE-US-00018 (SEQ ID NO: 14659) RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR
    or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising

    TABLE-US-00019 (SEQ ID NO: 14659) RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR.
    The CD28 costimulatory domain may be encoded by the nucleic acid sequence comprising

    TABLE-US-00020 (SEQ ID NO: 14660) cgcgtgaagtttagtcgatcagcagatgccccagcttacaaacagggaca gaaccagctgtataacgagctgaatctgggccgccgagaggaatatgacg tgctggataagcggagaggacgcgaccccgaaatgggaggcaagcccagg cgcaaaaaccctcaggaaggcctgtataacgagctgcagaaggacaaaat ggcagaagcctattctgagatcggcatgaagggggagcgacggagaggca aagggcacgatgggctgtaccagggactgagcaccgccacaaaggacacc tatgatgctctgcatatgcaggcactgcctccaagg.

    [0162] The 4-1BB costimulatory domain may comprise an amino acid sequence comprising

    TABLE-US-00021 (SEQ ID NO: 14661) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL
    or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising

    TABLE-US-00022 (SEQ ID NO: 14661) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL.
    The 4-1BB costimulatory domain may be encoded by the nucleic acid sequence comprising

    TABLE-US-00023 (SEQ ID NO: 14662) aagagaggcaggaagaaactgctgtatattttcaaacagcccttcatgcg ccccgtgcagactacccaggaggaagacgggtgctcctgtcgattccctg aggaagaggaaggcgggtgtgagctg.
    The 4-1BB costimulatory domain may be located between the transmembrane domain and the CD28 costimulatory domain.

    [0163] In certain embodiments of the CARs of the disclosure, the hinge may comprise a sequence derived from a human CD8α, IgG4, and/or CD4 sequence. In certain embodiments of the CARs of the disclosure, the hinge may comprise a sequence derived from a human CD8α sequence. The hinge may comprise a human CD8α amino acid sequence comprising

    TABLE-US-00024 (SEQ ID NO: 14663) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
    or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising

    TABLE-US-00025 (SEQ ID NO: 14663) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD.
    The human CD8α hinge amino acid sequence may be encoded by the nucleic acid sequence comprising

    TABLE-US-00026 (SEQ ID NO: 14664) actaccacaccagcacctagaccaccaactccagctccaaccatcgcgag tcagcccctgagtctgagacctgaggcctgcaggccagctgcaggaggag ctgtgcacaccaggggcctggacttcgcctgcgac.

    ScFv

    [0164] The disclosure provides single chain variable fragment (scFv) compositions and methods for use of these compositions to recognize and bind to a specific target protein. ScFv compositions comprise a heavy chain variable region and a light chain variable region of an antibody. ScFv compositions may be incorporated into an antigen recognition region of a chimeric antigen receptor of the disclosure. ScFvs are fusion proteins of the variable regions of the heavy (VH) and light (VL) chains of immunoglobulins, and the VH and VL domains are connected with a short peptide linker. ScFvs retain the specificity of the original immunoglobulin, despite removal of the constant regions and the introduction of the linker. An exemplary linker comprises a sequence of GGGGSGGGGSGGGGS (SEQ ID NO: 14665).

    Centyrins

    [0165] Centyrins of the disclosure specifically bind to an antigen. Chimeric antigen receptors of the disclosure comprising one or more Centyrins that specifically bind an antigen may be used to direct the specificity of a cell, (e.g. a cytotoxic immune cell) towards the specific antigen.

    [0166] Centyrins of the disclosure may comprise a protein scaffold, wherein the scaffold is capable of specifically binding an antigen. Centyrins of the disclosure may comprise a protein scaffold comprising a consensus sequence of at least one fibronectin type III (FN3) domain, wherein the scaffold is capable of specifically binding an antigen. The at least one fibronectin type III (FN3) domain may be derived from a human protein. The human protein may be Tenascin-C. The consensus sequence may comprise

    TABLE-US-00027 (SEQ ID NO: 14488) LPAPKNLVVSEVTEDSLRLSWTAPDAAFDSFLIQYQESEKVGEAINLTVP GSERSYDLTGLKPGTEYTVSIYGVKGGHRSNPLSAEFTT or MLPAPKNLVVSEVTEDSLRLSWTAPDAAFDSFLIQYQESEKVGEAINLTV PGSERSYD
    The consensus sequence may comprise an amino sequence at least 74% identical to

    TABLE-US-00028 (SEQ ID NO: 14488) LPAPKNLVVSEVTEDSLRLSWTAPDAAFDSFLIQYQESEKVGEAINLTVP GSERSYDLTGLKPGTEYTVSIYGVKGGHRSNPLSAEFTT or (SEQ ID NO: 14489) MLPAPKNLVVSEVTEDSLRLSWTAPDAAFDSFLIQYQESEKVGEAINLTV PGSERSYDLTGLKPGTEYTVSIYGVKGGHRSNPLSAEFTT.
    The consensus sequence may encoded by a nucleic acid sequence comprising

    TABLE-US-00029 (SEQ ID NO: 14490) atgctgcctgcaccaaagaacctggtggtgtctcatgtgacagaggatag tgccagactgtcatggactgctcccgacgcagccttcgatagttttatca tcgtgtaccgggagaacatcgaaaccggcgaggccattgtcctgacagtg ccagggtccgaacgctcttatgacctgacagatctgaagcccggaactga gtactatgtgcagatcgccggcgtcaaaggaggcaatatcagcttccctc tgtccgcaatcttcaccaca.
    The consensus sequence may be modified at one or more positions within (a) a A-B loop comprising or consisting of the amino acid residues TEDS (SEQ ID NO: 14491) at positions 13-16 of the consensus sequence; (b) a B-C loop comprising or consisting of the amino acid residues TAPDAAF (SEQ ID NO: 14492) at positions 22-28 of the consensus sequence; (c) a C-D loop comprising or consisting of the amino acid residues SEKVGE (SEQ ID NO: 14493) at positions 38-43 of the consensus sequence; (d) a D-E loop comprising or consisting of the amino acid residues GSER (SEQ ID NO: 14494) at positions 51-54 of the consensus sequence; (e) a E-F loop comprising or consisting of the amino acid residues GLKPG (SEQ ID NO: 14495) at positions 60-64 of the consensus sequence; (f) a F-G loop comprising or consisting of the amino acid residues KGGHRSN (SEQ ID NO: 14496) at positions 75-81 of the consensus sequence; or (g) any combination of (a)-(f). Centyrins of the disclosure may comprise a consensus sequence of at least 5 fibronectin type III (FN3) domains, at least 10 fibronectin type III (FN3) domains or at least 15 fibronectin type III (FN3) domains. The scaffold may bind an antigen with at least one affinity selected from a K.sub.D of less than or equal to 10M, less than or equal to 10.sup.−10 M, less than or equal to 10.sup.−11 M, less than or equal to 10.sup.−12M, less than or equal to 10.sup.−13M, less than or equal to 10.sup.−14M, and less than or equal to 10.sup.−15M. The K.sub.D may be determined by surface plasmon resonance.

    [0167] The term “antibody mimetic” is intended to describe an organic compound that specifically binds a target sequence and has a structure distinct from a naturally-occurring antibody. Antibody mimetics may comprise a protein, a nucleic acid, or a small molecule. The target sequence to which an antibody mimetic of the disclosure specifically binds may be an antigen. Antibody mimetics may provide superior properties over antibodies including, but not limited to, superior solubility, tissue penetration, stability towards heat and enzymes (e.g. resistance to enzymatic degradation), and lower production costs. Exemplary antibody mimetics include, but are not limited to, an affibody, an afflilin, an affimer, an affitin, an alphabody, an anticalin, and avimer (also known as avidity multimer), a DARPin (Designed Ankyrin Repeat Protein), a Fynomer, a Kunitz domain peptide, and a monobody.

    [0168] Affibody molecules of the disclosure comprise a protein scaffold comprising or consisting of one or more alpha helix without any disulfide bridges. Preferably, affibody molecules of the disclosure comprise or consist of three alpha helices. For example, an affibody molecule of the disclosure may comprise an immunoglobulin binding domain. An affibody molecule of the disclosure may comprise the Z domain of protein A.

    [0169] Affilin molecules of the disclosure comprise a protein scaffold produced by modification of exposed amino acids of, for example, either gamma-B crystallin or ubiquitin. Affilin molecules functionally mimic an antibody's affinity to antigen, but do not structurally mimic an antibody. In any protein scaffold used to make an affilin, those amino acids that are accessible to solvent or possible binding partners in a properly-folded protein molecule are considered exposed amino acids. Any one or more of these exposed amino acids may be modified to specifically bind to a target sequence or antigen.

    [0170] Affimer molecules of the disclosure comprise a protein scaffold comprising a highly stable protein engineered to display peptide loops that provide a high affinity binding site for a specific target sequence. Exemplary affimer molecules of the disclosure comprise a protein scaffold based upon a cystatin protein or tertiary structure thereof. Exemplary affimer molecules of the disclosure may share a common tertiary structure of comprising an alpha-helix lying on top of an anti-parallel beta-sheet.

    [0171] Affitin molecules of the disclosure comprise an artificial protein scaffold, the structure of which may be derived, for example, from a DNA binding protein (e.g. the DNA binding protein Sac7d). Affitins of the disclosure selectively bind a target sequence, which may be the entirety or part of an antigen. Exemplary affitins of the disclosure are manufactured by randomizing one or more amino acid sequences on the binding surface of a DNA binding protein and subjecting the resultant protein to ribosome display and selection. Target sequences of affitins of the disclosure may be found, for example, in the genome or on the surface of a peptide, protein, virus, or bacteria. In certain embodiments of the disclosure, an affitin molecule may be used as a specific inhibitor of an enzyme. Affitin molecules of the disclosure may include heat-resistant proteins or derivatives thereof.

    [0172] Alphabody molecules of the disclosure may also be referred to as Cell-Penetrating Alphabodies (CPAB). Alphabody molecules of the disclosure comprise small proteins (typically of less than 10 kDa) that bind to a variety of target sequences (including antigens). Alphabody molecules are capable of reaching and binding to intracellular target sequences. Structurally, alphabody molecules of the disclosure comprise an artificial sequence forming single chain alpha helix (similar to naturally occurring coiled-coil structures). Alphabody molecules of the disclosure may comprise a protein scaffold comprising one or more amino acids that are modified to specifically bind target proteins. Regardless of the binding specificity of the molecule, alphabody molecules of the disclosure maintain correct folding and thermostability.

    [0173] Anticalin molecules of the disclosure comprise artificial proteins that bind to target sequences or sites in either proteins or small molecules. Anticalin molecules of the disclosure may comprise an artificial protein derived from a human lipocalin. Anticalin molecules of the disclosure may be used in place of, for example, monoclonal antibodies or fragments thereof. Anticalin molecules may demonstrate superior tissue penetration and thermostability than monoclonal antibodies or fragments thereof. Exemplary anticalin molecules of the disclosure may comprise about 180 amino acids, having a mass of approximately 20 kDa. Structurally, anticalin molecules of the disclosure comprise a barrel structure comprising antiparallel beta-strands pairwise connected by loops and an attached alpha helix. In preferred embodiments, anticalin molecules of the disclosure comprise a barrel structure comprising eight antiparallel beta-strands pairwise connected by loops and an attached alpha helix.

    [0174] Avimer molecules of the disclosure comprise an artificial protein that specifically binds to a target sequence (which may also be an antigen). Avimers of the disclosure may recognize multiple binding sites within the same target or within distinct targets. When an avimer of the disclosure recognize more than one target, the avimer mimics function of a bi-specific antibody. The artificial protein avimer may comprise two or more peptide sequences of approximately 30-35 amino acids each. These peptides may be connected via one or more linker peptides. Amino acid sequences of one or more of the peptides of the avimer may be derived from an A domain of a membrane receptor. Avimers have a rigid structure that may optionally comprise disulfide bonds and/or calcium. Avimers of the disclosure may demonstrate greater heat stability compared to an antibody.

    [0175] DARPins (Designed Ankyrin Repeat Proteins) of the disclosure comprise genetically-engineered, recombinant, or chimeric proteins having high specificity and high affinity for a target sequence. In certain embodiments, DARPins of the disclosure are derived from ankyrin proteins and, optionally, comprise at least three repeat motifs (also referred to as repetitive structural units) of the ankyrin protein. Ankyrin proteins mediate high-affinity protein-protein interactions. DARPins of the disclosure comprise a large target interaction surface.

    [0176] Fynomers of the disclosure comprise small binding proteins (about 7 kDa) derived from the human Fyn SH3 domain and engineered to bind to target sequences and molecules with equal affinity and equal specificity as an antibody.

    [0177] Kunitz domain peptides of the disclosure comprise a protein scaffold comprising a Kunitz domain. Kunitz domains comprise an active site for inhibiting protease activity. Structurally, Kunitz domains of the disclosure comprise a disulfide-rich alpha+beta fold. This structure is exemplified by the bovine pancreatic trypsin inhibitor. Kunitz domain peptides recognize specific protein structures and serve as competitive protease inhibitors. Kunitz domains of the disclosure may comprise Ecallantide (derived from a human lipoprotein-associated coagulation inhibitor (LACI)).

    [0178] Monobodies of the disclosure are small proteins (comprising about 94 amino acids and having a mass of about 10 kDa) comparable in size to a single chain antibody. These genetically engineered proteins specifically bind target sequences including antigens. Monobodies of the disclosure may specifically target one or more distinct proteins or target sequences. In preferred embodiments, monobodies of the disclosure comprise a protein scaffold mimicking the structure of human fibronectin, and more preferably, mimicking the structure of the tenth extracellular type III domain of fibronectin. The tenth extracellular type III domain of fibronectin, as well as a monobody mimetic thereof, contains seven beta sheets forming a barrel and three exposed loops on each side corresponding to the three complementarity determining regions (CDRs) of an antibody. In contrast to the structure of the variable domain of an antibody, a monobody lacks any binding site for metal ions as well as a central disulfide bond. Multispecific monobodies may be optimized by modifying the loops BC and FG. Monobodies of the disclosure may comprise an adnectin.

    VHH

    [0179] In certain embodiments, the CAR comprises a single domain antibody (SdAb). In certain embodiments, the SdAb is a VHH.

    [0180] The disclosure provides chimeric antigen receptors (CARs) comprising at least one VHH (a VCAR). Chimeric antigen receptors of the disclosure may comprise more than one VHH. For example, a bi-specific VCAR may comprise two VHHs that specifically bind two distinct antigens.

    [0181] VHH proteins of the disclosure specifically bind to an antigen. Chimeric antigen receptors of the disclosure comprising one or more VHHs that specifically bind an antigen may be used to direct the specificity of a cell, (e.g. a cytotoxic immune cell) towards the specific antigen.

    [0182] At least one VHH protein or VCAR of the disclosure can be optionally produced by a cell line, a mixed cell line, an immortalized cell or clonal population of immortalized cells, as well known in the art. See, e.g., Ausubel, et al., ed., Current Protocols in Molecular Biology, John Wiley & Sons, Inc., NY, N.Y. (1987-2001); Sambrook, et al., Molecular Cloning: A Laboratory Manual, 2nd Edition, Cold Spring Harbor, N.Y. (1989); Harlow and Lane, Antibodies, a Laboratory Manual, Cold Spring Harbor, N.Y. (1989); Colligan, et al., eds., Current Protocols in Immunology, John Wiley & Sons, Inc., NY (1994-2001); Colligan et al., Current Protocols in Protein Science, John Wiley & Sons, NY, N.Y., (1997-2001).

    [0183] Amino acids from a VHH protein can be altered, added and/or deleted to reduce immunogenicity or reduce, enhance or modify binding, affinity, on-rate, off-rate, avidity, specificity, half-life, stability, solubility or any other suitable characteristic, as known in the art.

    [0184] Optionally, VHH proteins can be engineered with retention of high affinity for the antigen and other favorable biological properties. To achieve this goal, the VHH proteins can be optionally prepared by a process of analysis of the parental sequences and various conceptual engineered products using three-dimensional models of the parental and engineered sequences. Three-dimensional models are commonly available and are familiar to those skilled in the art. Computer programs are available which illustrate and display probable three-dimensional conformational structures of selected candidate sequences and can measure possible immunogenicity (e.g., Immunofilter program of Xencor, Inc. of Monrovia, Calif.). Inspection of these displays permits analysis of the likely role of the residues in the functioning of the candidate sequence, i.e., the analysis of residues that influence the ability of the candidate VHH protein to bind its antigen. In this way, residues can be selected and combined from the parent and reference sequences so that the desired characteristic, such as affinity for the target antigen(s), is achieved. Alternatively, or in addition to, the above procedures, other suitable methods of engineering can be used.

    [0185] Screening VHH for specific binding to similar proteins or fragments can be conveniently achieved using nucleotide (DNA or RNA display) or peptide display libraries, for example, in vitro display. This method involves the screening of large collections of peptides for individual members having the desired function or structure. The displayed nucleotide or peptide sequences can be from 3 to 5000 or more nucleotides or amino acids in length, frequently from 5-100 amino acids long, and often from about 8 to 25 amino acids long. In addition to direct chemical synthetic methods for generating peptide libraries, several recombinant DNA methods have been described. One type involves the display of a peptide sequence on the surface of a bacteriophage or cell. Each bacteriophage or cell contains the nucleotide sequence encoding the particular displayed peptide sequence. The VHH proteins of the disclosure can bind human or other mammalian proteins with a wide range of affinities (KD). In a preferred embodiment, at least one VHH of the present invention can optionally bind to a target protein with high affinity, for example, with a KD equal to or less than about 10.sup.−7 M, such as but not limited to, 0.1-9.9 (or any range or value therein)×10.sup.−8, 10.sup.−9, 10.sup.−10, 10.sup.−11, 10.sup.−12, 10.sup.−13, 10.sup.−14, 10.sup.−15 or any range or value therein, as determined by surface plasmon resonance or the Kinexa method, as practiced by those of skill in the art.

    [0186] The affinity or avidity of a VHH or a VCAR for an antigen can be determined experimentally using any suitable method. (See, for example, Berzofsky, et al., “Antibody-Antigen Interactions,” In Fundamental Immunology, Paul, W. E., Ed., Raven Press: New York, N.Y. (1984); Kuby, Janis Immunology, W.H. Freeman and Company: New York, N.Y. (1992); and methods described herein). The measured affinity of a particular VHH-antigen or VCAR-antigen interaction can vary if measured under different conditions (e.g., salt concentration, pH). Thus, measurements of affinity and other antigen-binding parameters (e.g., KD, Kon, Koff) are preferably made with standardized solutions of VHH or VCAR and antigen, and a standardized buffer, such as the buffer described herein.

    [0187] Competitive assays can be performed with the VHH or VCAR of the disclosure in order to determine what proteins, antibodies, and other antagonists compete for binding to a target protein with the VHH or VCAR of the present invention and/or share the epitope region. These assays as readily known to those of ordinary skill in the art evaluate competition between antagonists or ligands for a limited number of binding sites on a protein. The protein and/or antibody is immobilized or insolubilized before or after the competition and the sample bound to the target protein is separated from the unbound sample, for example, by decanting (where the protein/antibody was preinsolubilized) or by centrifuging (where the protein/antibody was precipitated after the competitive reaction). Also, the competitive binding may be determined by whether function is altered by the binding or lack of binding of the VHH or VCAR to the target protein, e.g., whether the VCAR molecule inhibits or potentiates the enzymatic activity of, for example, a label. ELISA and other functional assays may be used, as well known in the art.

    VH

    [0188] In certain embodiments, the CAR comprises a single domain antibody (SdAb). In certain embodiments, the SdAb is a VH.

    [0189] The disclosure provides chimeric antigen receptors (CARs) comprising a single domain antibody (VCARs). In certain embodiments, the single domain antibody comprises a VH. In certain embodiments, the VH is isolated or derived from a human sequence. In certain embodiments, VH comprises a human CDR sequence and/or a human framework sequence and a non-human or humanized sequence (e.g. a rat Fc domain). In certain embodiments, the VH is a fully humanized VH. In certain embodiments, the VH s neither a naturally occurring antibody nor a fragment of a naturally occurring antibody. In certain embodiments, the VH is not a fragment of a monoclonal antibody. In certain embodiments, the VH is a UniDab™ antibody (TeneoBio).

    [0190] In certain embodiments, the VH is fully engineered using the UniRat™ (TeneoBio) system and “NGS-based Discovery” to produce the VH. Using this method, the specific VH are not naturally-occurring and are generated using fully engineered systems. The VH are not derived from naturally-occurring monoclonal antibodies (mAbs) that were either isolated directly from the host (for example, a mouse, rat or human) or directly from a single clone of cells or cell line (hybridoma). These VHs were not subsequently cloned from said cell lines. Instead, VH sequences are fully-engineered using the UniRat™ system as transgenes that comprise human variable regions (VH domains) with a rat Fc domain, and are thus human/rat chimeras without a light chain and are unlike the standard mAb format. The native rat genes are knocked out and the only antibodies expressed in the rat are from transgenes with VH domains linked to a Rat Fc (UniAbs). These are the exclusive Abs expressed in the UniRat. Next generation sequencing (NGS) and bioinformatics are used to identify the full antigen-specific repertoire of the heavy-chain antibodies generated by UniRat™ after immunization. Then, a unique gene assembly method is used to convert the antibody repertoire sequence information into large collections of fully-human heavy-chain antibodies that can be screened in vitro for a variety of functions. In certain embodiments, fully humanized VH are generated by fusing the human VH domains with human Fcs in vitro (to generate a non-naturally occurring recombinant VH antibody). In certain embodiments, the VH are fully humanized, but they are expressed in vivo as human/rat chimera (human VH, rat Fc) without a light chain. Fully humanized VHs are expressed in vivo as human/rat chimera (human VH, rat Fc) without a light chain are about 80 kDa (vs 150 kDa).

    [0191] VCARs of the disclosure may comprise at least one VH of the disclosure. In certain embodiments, the VH of the disclosure may be modified to remove an Fc domain or a portion thereof. In certain embodiments, a framework sequence of the VH of the disclosure may be modified to, for example, improve expression, decrease immunogenicity or to improve function.

    [0192] As used throughout the disclosure, the singular forms “a,” “and,” and “the” include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to “a method” includes a plurality of such methods and reference to “a dose” includes reference to one or more doses and equivalents thereof known to those skilled in the art, and so forth.

    [0193] The term “about” or “approximately” means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, e.g., the limitations of the measurement system. For example, “about” can mean within 1 or more standard deviations. Alternatively, “about” can mean a range of up to 20%, or up to 10%, or up to 5%, or up to 1% of a given value. Alternatively, particularly with respect to biological systems or processes, the term can mean within an order of magnitude, preferably within 5-fold, and more preferably within 2-fold, of a value. Where particular values are described in the application and claims, unless otherwise stated the term “about” meaning within an acceptable error range for the particular value should be assumed.

    [0194] The disclosure provides isolated or substantially purified polynucleotide or protein compositions. An “isolated” or “purified” polynucleotide or protein, or biologically active portion thereof, is substantially or essentially free from components that normally accompany or interact with the polynucleotide or protein as found in its naturally occurring environment. Thus, an isolated or purified polynucleotide or protein is substantially free of other cellular material or culture medium when produced by recombinant techniques, or substantially free of chemical precursors or other chemicals when chemically synthesized. Optimally, an “isolated” polynucleotide is free of sequences (optimally protein encoding sequences) that naturally flank the polynucleotide (i.e., sequences located at the 5′ and 3′ ends of the polynucleotide) in the genomic DNA of the organism from which the polynucleotide is derived. For example, in various embodiments, the isolated polynucleotide can contain less than about 5 kb, 4 kb, 3 kb, 2 kb, 1 kb, 0.5 kb, or 0.1 kb of nucleotide sequence that naturally flank the polynucleotide in genomic DNA of the cell from which the polynucleotide is derived. A protein that is substantially free of cellular material includes preparations of protein having less than about 30%, 20%, 10%, 5%, or 1% (by dry weight) of contaminating protein. When the protein of the invention or biologically active portion thereof is recombinantly produced, optimally culture medium represents less than about 30%, 20%, 10%, 5%, or 1% (by dry weight) of chemical precursors or non-protein-of-interest chemicals.

    [0195] The disclosure provides fragments and variants of the disclosed DNA sequences and proteins encoded by these DNA sequences. As used throughout the disclosure, the term “fragment” refers to a portion of the DNA sequence or a portion of the amino acid sequence and hence protein encoded thereby. Fragments of a DNA sequence comprising coding sequences may encode protein fragments that retain biological activity of the native protein and hence DNA recognition or binding activity to a target DNA sequence as herein described. Alternatively, fragments of a DNA sequence that are useful as hybridization probes generally do not encode proteins that retain biological activity or do not retain promoter activity. Thus, fragments of a DNA sequence may range from at least about 20 nucleotides, about 50 nucleotides, about 100 nucleotides, and up to the full-length polynucleotide of the invention.

    [0196] Nucleic acids or proteins of the disclosure can be constructed by a modular approach including preassembling monomer units and/or repeat units in target vectors that can subsequently be assembled into a final destination vector. Polypeptides of the disclosure may comprise repeat monomers of the disclosure and can be constructed by a modular approach by preassembling repeat units in target vectors that can subsequently be assembled into a final destination vector. The disclosure provides polypeptide produced by this method as well nucleic acid sequences encoding these polypeptides. The disclosure provides host organisms and cells comprising nucleic acid sequences encoding polypeptides produced this modular approach.

    [0197] The term “antibody” is used in the broadest sense and specifically covers single monoclonal antibodies (including agonist and antagonist antibodies) and antibody compositions with polyepitopic specificity. It is also within the scope hereof to use natural or synthetic analogs, mutants, variants, alleles, homologs and orthologs (herein collectively referred to as “analogs”) of the antibodies hereof as defined herein. Thus, according to one embodiment hereof, the term “antibody hereof” in its broadest sense also covers such analogs. Generally, in such analogs, one or more amino acid residues may have been replaced, deleted and/or added, compared to the antibodies hereof as defined herein.

    [0198] “Antibody fragment”, and all grammatical variants thereof, as used herein are defined as a portion of an intact antibody comprising the antigen binding site or variable region of the intact antibody, wherein the portion is free of the constant heavy chain domains (i.e. CH2, CH3, and CH4, depending on antibody isotype) of the Fc region of the intact antibody. Examples of antibody fragments include Fab, Fab′, Fab′-SH, F(ab′).sub.2, and Fv fragments; diabodies; any antibody fragment that is a polypeptide having a primary structure consisting of one uninterrupted sequence of contiguous amino acid residues (referred to herein as a “single-chain antibody fragment” or “single chain polypeptide”), including without limitation (l) single-chain Fv (scFv) molecules (2) single chain polypeptides containing only one light chain variable domain, or a fragment thereof that contains the three CDRs of the light chain variable domain, without an associated heavy chain moiety and (3) single chain polypeptides containing only one heavy chain variable region, or a fragment thereof containing the three CDRs of the heavy chain variable region, without an associated light chain moiety; and multispecific or multivalent structures formed from antibody fragments. In an antibody fragment comprising one or more heavy chains, the heavy chain(s) can contain any constant domain sequence (e.g. CHI in the IgG isotype) found in a non-Fc region of an intact antibody, and/or can contain any hinge region sequence found in an intact antibody, and/or can contain a leucine zipper sequence fused to or situated in the hinge region sequence or the constant domain sequence of the heavy chain(s). The term further includes single domain antibodies (“sdAB”) which generally refers to an antibody fragment having a single monomeric variable antibody domain, (for example, from camelids). Such antibody fragment types will be readily understood by a person having ordinary skill in the art.

    [0199] “Binding” refers to a sequence-specific, non-covalent interaction between macromolecules (e.g., between a protein and a nucleic acid). Not all components of a binding interaction need be sequence-specific (e.g., contacts with phosphate residues in a DNA backbone), as long as the interaction as a whole is sequence-specific.

    [0200] The term “comprising” is intended to mean that the compositions and methods include the recited elements, but do not exclude others. “Consisting essentially of” when used to define compositions and methods, shall mean excluding other elements of any essential significance to the combination when used for the intended purpose. Thus, a composition consisting essentially of the elements as defined herein would not exclude trace contaminants or inert carriers. “Consisting of shall mean excluding more than trace elements of other ingredients and substantial method steps. Embodiments defined by each of these transition terms are within the scope of this invention.

    [0201] The term “epitope” refers to an antigenic determinant of a polypeptide. An epitope could comprise three amino acids in a spatial conformation, which is unique to the epitope. Generally, an epitope consists of at least 4, 5, 6, or 7 such amino acids, and more usually, consists of at least 8, 9, or 10 such amino acids. Methods of determining the spatial conformation of amino acids are known in the art, and include, for example, x-ray crystallography and two-dimensional nuclear magnetic resonance.

    [0202] As used herein, “expression” refers to the process by which polynucleotides are transcribed into mRNA and/or the process by which the transcribed mRNA is subsequently being translated into peptides, polypeptides, or proteins. If the polynucleotide is derived from genomic DNA, expression may include splicing of the mRNA in a eukaryotic cell.

    [0203] “Gene expression” refers to the conversion of the information, contained in a gene, into a gene product. A gene product can be the direct transcriptional product of a gene (e.g., mRNA, tRNA, rRNA, antisense RNA, ribozyme, shRNA, micro RNA, structural RNA or any other type of RNA) or a protein produced by translation of an mRNA. Gene products also include RNAs which are modified, by processes such as capping, polyadenylation, methylation, and editing, and proteins modified by, for example, methylation, acetylation, phosphorylation, ubiquitination, ADP-ribosylation, myristilation, and glycosylation.

    [0204] “Modulation” or “regulation” of gene expression refers to a change in the activity of a gene. Modulation of expression can include, but is not limited to, gene activation and gene repression.

    [0205] The term “operatively linked” or its equivalents (e.g., “linked operatively”) means two or more molecules are positioned with respect to each other such that they are capable of interacting to affect a function attributable to one or both molecules or a combination thereof.

    [0206] Non-covalently linked components and methods of making and using non-covalently linked components, are disclosed. The various components may take a variety of different forms as described herein. For example, non-covalently linked (i.e., operatively linked) proteins may be used to allow temporary interactions that avoid one or more problems in the art. The ability of non-covalently linked components, such as proteins, to associate and dissociate enables a functional association only or primarily under circumstances where such association is needed for the desired activity. The linkage may be of duration sufficient to allow the desired effect.

    [0207] A method for directing proteins to a specific locus in a genome of an organism is disclosed. The method may comprise the steps of providing a DNA localization component and providing an effector molecule, wherein the DNA localization component and the effector molecule are capable of operatively linking via a non-covalent linkage.

    [0208] The term “scFv” refers to a single-chain variable fragment. scFv is a fusion protein of the variable regions of the heavy (VH) and light chains (VL) of immunoglobulins, connected with a linker peptide. The linker peptide may be from about 5 to 40 amino acids or from about 10 to 30 amino acids or about 5, 10, 15, 20, 25, 30, 35, or 40 amino acids in length. Single-chain variable fragments lack the constant Fc region found in complete antibody molecules, and, thus, the common binding sites (e.g., Protein G) used to purify antibodies. The term further includes a scFv that is an intrabody, an antibody that is stable in the cytoplasm of the cell, and which may bind to an intracellular protein.

    [0209] The term “single domain antibody” means an antibody fragment having a single monomeric variable antibody domain which is able to bind selectively to a specific antigen. A single-domain antibody generally is a peptide chain of about 110 amino acids long, comprising one variable domain (VH) of a heavy-chain antibody, or of a common IgG, which generally have similar affinity to antigens as whole antibodies, but are more heat-resistant and stable towards detergents and high concentrations of urea. Examples are those derived from camelid or fish antibodies. Alternatively, single-domain antibodies can be made from common murine or human IgG with four chains.

    [0210] The terms “specifically bind” and “specific binding” as used herein refer to the ability of an antibody, an antibody fragment or a nanobody to preferentially bind to a particular antigen that is present in a homogeneous mixture of different antigens. In certain embodiments, a specific binding interaction will discriminate between desirable and undesirable antigens in a sample. In certain embodiments more than about ten- to 100-fold or more (e.g., more than about 1000- or 10,000-fold). “Specificity” refers to the ability of an immunoglobulin or an immunoglobulin fragment, such as a nanobody, to bind preferentially to one antigenic target versus a different antigenic target and does not necessarily imply high affinity.

    [0211] A “target site” or “target sequence” is a nucleic acid sequence that defines a portion of a nucleic acid to which a binding molecule will bind, provided sufficient conditions for binding exist.

    [0212] The terms “nucleic acid” or “oligonucleotide” or “polynucleotide” refer to at least two nucleotides covalently linked together. The depiction of a single strand also defines the sequence of the complementary strand. Thus, a nucleic acid may also encompass the complementary strand of a depicted single strand. A nucleic acid of the disclosure also encompasses substantially identical nucleic acids and complements thereof that retain the same structure or encode for the same protein.

    [0213] Probes of the disclosure may comprise a single stranded nucleic acid that can hybridize to a target sequence under stringent hybridization conditions. Thus, nucleic acids of the disclosure may refer to a probe that hybridizes under stringent hybridization conditions.

    [0214] Nucleic acids of the disclosure may be single- or double-stranded. Nucleic acids of the disclosure may contain double-stranded sequences even when the majority of the molecule is single-stranded. Nucleic acids of the disclosure may contain single-stranded sequences even when the majority of the molecule is double-stranded. Nucleic acids of the disclosure may include genomic DNA, cDNA, RNA, or a hybrid thereof. Nucleic acids of the disclosure may contain combinations of deoxyribo- and ribo-nucleotides. Nucleic acids of the disclosure may contain combinations of bases including uracil, adenine, thymine, cytosine, guanine, inosine, xanthine hypoxanthine, isocytosine and isoguanine. Nucleic acids of the disclosure may be synthesized to comprise non-natural amino acid modifications. Nucleic acids of the disclosure may be obtained by chemical synthesis methods or by recombinant methods.

    [0215] Nucleic acids of the disclosure, either their entire sequence, or any portion thereof, may be non-naturally occurring. Nucleic acids of the disclosure may contain one or more mutations, substitutions, deletions, or insertions that do not naturally-occur, rendering the entire nucleic acid sequence non-naturally occurring. Nucleic acids of the disclosure may contain one or more duplicated, inverted or repeated sequences, the resultant sequence of which does not naturally-occur, rendering the entire nucleic acid sequence non-naturally occurring. Nucleic acids of the disclosure may contain modified, artificial, or synthetic nucleotides that do not naturally-occur, rendering the entire nucleic acid sequence non-naturally occurring.

    [0216] Given the redundancy in the genetic code, a plurality of nucleotide sequences may encode any particular protein. All such nucleotides sequences are contemplated herein.

    [0217] As used throughout the disclosure, the term “operably linked” refers to the expression of a gene that is under the control of a promoter with which it is spatially connected. A promoter can be positioned 5′ (upstream) or 3′ (downstream) of a gene under its control. The distance between a promoter and a gene can be approximately the same as the distance between that promoter and the gene it controls in the gene from which the promoter is derived. Variation in the distance between a promoter and a gene can be accommodated without loss of promoter function.

    [0218] As used throughout the disclosure, the term “promoter” refers to a synthetic or naturally-derived molecule which is capable of conferring, activating or enhancing expression of a nucleic acid in a cell. A promoter can comprise one or more specific transcriptional regulatory sequences to further enhance expression and/or to alter the spatial expression and/or temporal expression of same. A promoter can also comprise distal enhancer or repressor elements, which can be located as much as several thousand base pairs from the start site of transcription. A promoter can be derived from sources including viral, bacterial, fungal, plants, insects, and animals. A promoter can regulate the expression of a gene component constitutively or differentially with respect to cell, the tissue or organ in which expression occurs or, with respect to the developmental stage at which expression occurs, or in response to external stimuli such as physiological stresses, pathogens, metal ions, or inducing agents. Representative examples of promoters include the bacteriophage T7 promoter, bacteriophage T3 promoter, SP6 promoter, lac operator-promoter, tac promoter, SV40 late promoter, SV40 early promoter, RSV-LTR promoter, CMV IE promoter, EF-1 Alpha promoter, CAG promoter, SV40 early promoter or SV40 late promoter and the CMV IE promoter.

    [0219] As used throughout the disclosure, the term “substantially complementary” refers to a first sequence that is at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98% or 99% identical to the complement of a second sequence over a region of 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 180, 270, 360, 450, 540, or more nucleotides or amino acids, or that the two sequences hybridize under stringent hybridization conditions.

    [0220] As used throughout the disclosure, the term “substantially identical” refers to a first and second sequence are at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98% or 99% identical over a region of 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 180, 270, 360, 450, 540 or more nucleotides or amino acids, or with respect to nucleic acids, if the first sequence is substantially complementary to the complement of the second sequence.

    [0221] As used throughout the disclosure, the term “variant” when used to describe a nucleic acid, refers to (i) a portion or fragment of a referenced nucleotide sequence; (ii) the complement of a referenced nucleotide sequence or portion thereof; (iii) a nucleic acid that is substantially identical to a referenced nucleic acid or the complement thereof; or (iv) a nucleic acid that hybridizes under stringent conditions to the referenced nucleic acid, complement thereof, or a sequences substantially identical thereto.

    [0222] As used throughout the disclosure, the term “vector” refers to a nucleic acid sequence containing an origin of replication. A vector can be a viral vector, bacteriophage, bacterial artificial chromosome or yeast artificial chromosome. A vector can be a DNA or RNA vector. A vector can be a self-replicating extrachromosomal vector, and preferably, is a DNA plasmid. A vector may comprise a combination of an amino acid with a DNA sequence, an RNA sequence, or both a DNA and an RNA sequence.

    [0223] As used throughout the disclosure, the term “variant” when used to describe a peptide or polypeptide, refers to a peptide or polypeptide that differs in amino acid sequence by the insertion, deletion, or conservative substitution of amino acids, but retain at least one biological activity. Variant can also mean a protein with an amino acid sequence that is substantially identical to a referenced protein with an amino acid sequence that retains at least one biological activity.

    [0224] A conservative substitution of an amino acid, i.e., replacing an amino acid with a different amino acid of similar properties (e.g., hydrophilicity, degree and distribution of charged regions) is recognized in the art as typically involving a minor change. These minor changes can be identified, in part, by considering the hydropathic index of amino acids, as understood in the art. Kyte et al., J. Mol. Biol. 157: 105-132 (1982). The hydropathic index of an amino acid is based on a consideration of its hydrophobicity and charge. Amino acids of similar hydropathic indexes can be substituted and still retain protein function. In one aspect, amino acids having hydropathic indexes of ±2 are substituted. The hydrophilicity of amino acids can also be used to reveal substitutions that would result in proteins retaining biological function. A consideration of the hydrophilicity of amino acids in the context of a peptide permits calculation of the greatest local average hydrophilicity of that peptide, a useful measure that has been reported to correlate well with antigenicity and immunogenicity. U.S. Pat. No. 4,554,101, incorporated fully herein by reference.

    [0225] Substitution of amino acids having similar hydrophilicity values can result in peptides retaining biological activity, for example immunogenicity. Substitutions can be performed with amino acids having hydrophilicity values within ±2 of each other. Both the hyrophobicity index and the hydrophilicity value of amino acids are influenced by the particular side chain of that amino acid. Consistent with that observation, amino acid substitutions that are compatible with biological function are understood to depend on the relative similarity of the amino acids, and particularly the side chains of those amino acids, as revealed by the hydrophobicity, hydrophilicity, charge, size, and other properties.

    [0226] As used herein, “conservative” amino acid substitutions may be defined as set out in Tables A, B, or C below. In some embodiments, fusion polypeptides and/or nucleic acids encoding such fusion polypeptides include conservative substitutions have been introduced by modification of polynucleotides encoding polypeptides of the invention. Amino acids can be classified according to physical properties and contribution to secondary and tertiary protein structure. A conservative substitution is a substitution of one amino acid for another amino acid that has similar properties. Exemplary conservative substitutions are set out in Table A.

    TABLE-US-00030 TABLE A Conservative Substitutions I Side chain characteristics Amino Acid Aliphatic Non-polar G A P I L V F Polar-uncharged C S T M N Q Polar-charged D E K R Aromatic H F W Y Other N Q D E

    [0227] Alternately, conservative amino acids can be grouped as described in Lehninger, (Biochemistry, Second Edition; Worth Publishers, Inc. NY, N.Y. (1975), pp. 71-77) as set forth in Table B.

    TABLE-US-00031 TABLE B Conservative Substitutions II Side Chain Characteristic Amino Acid Non-polar Aliphatic: A L I V P (hydrophobic) Aromatic: F W Y Sulfur-containing: M Borderline: G Y Uncharged-polar Hydroxyl: S T Y Amides: N Q Sulfhydryl: C Borderline: G Y Positively Charged (Basic): K R H Negatively Charged (Acidic): D E

    [0228] Alternately, exemplary conservative substitutions are set out in Table C.

    TABLE-US-00032 TABLE C Conservative Substitutions III Original Residue Exemplary Substitution Ala (A) Val Leu Ile Met Arg (R) Lys His Asn (N) Gln Asp (D) Glu Cys (C) Ser Thr Gln (Q) Asn Glu (E) Asp Gly (G) Ala Val Leu Pro His (H) Lys Arg Ile (I) Leu Val Met Ala Phe Leu (L) Ile Val Met Ala Phe Lys (K) Arg His Met (M) Leu Ile Val Ala Phe (F) Trp Tyr Ile Pro (P) Gly Ala Val Leu Ile Ser (S) Thr Thr (T) Ser Trp (W) Tyr Phe Ile Tyr (Y) Trp Phe Thr Ser Val (V) Ile Leu Met Ala

    [0229] It should be understood that the polypeptides of the disclosure are intended to include polypeptides bearing one or more insertions, deletions, or substitutions, or any combination thereof, of amino acid residues as well as modifications other than insertions, deletions, or substitutions of amino acid residues. Polypeptides or nucleic acids of the disclosure may contain one or more conservative substitution.

    [0230] As used throughout the disclosure, the term “more than one” of the aforementioned amino acid substitutions refers to 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 or more of the recited amino acid substitutions. The term “more than one” may refer to 2, 3, 4, or 5 of the recited amino acid substitutions.

    [0231] Polypeptides and proteins of the disclosure, either their entire sequence, or any portion thereof, may be non-naturally occurring. Polypeptides and proteins of the disclosure may contain one or more mutations, substitutions, deletions, or insertions that do not naturally-occur, rendering the entire amino acid sequence non-naturally occurring. Polypeptides and proteins of the disclosure may contain one or more duplicated, inverted or repeated sequences, the resultant sequence of which does not naturally-occur, rendering the entire amino acid sequence non-naturally occurring. Polypeptides and proteins of the disclosure may contain modified, artificial, or synthetic amino acids that do not naturally-occur, rendering the entire amino acid sequence non-naturally occurring.

    [0232] As used throughout the disclosure, “sequence identity” may be determined by using the stand-alone executable BLAST engine program for blasting two sequences (bl2seq), which can be retrieved from the National Center for Biotechnology Information (NCBI) ftp site, using the default parameters (Tatusova and Madden, FEMS Microbiol Lett., 1999, 174, 247-250; which is incorporated herein by reference in its entirety). The terms “identical” or “identity” when used in the context of two or more nucleic acids or polypeptide sequences, refer to a specified percentage of residues that are the same over a specified region of each of the sequences. The percentage can be calculated by optimally aligning the two sequences, comparing the two sequences over the specified region, determining the number of positions at which the identical residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the specified region, and multiplying the result by 100 to yield the percentage of sequence identity. In cases where the two sequences are of different lengths or the alignment produces one or more staggered ends and the specified region of comparison includes only a single sequence, the residues of single sequence are included in the denominator but not the numerator of the calculation. When comparing DNA and RNA, thymine (T) and uracil (U) can be considered equivalent. Identity can be performed manually or by using a computer sequence algorithm such as BLAST or BLAST 2.0.

    [0233] As used throughout the disclosure, the term “endogenous” refers to nucleic acid or protein sequence naturally associated with a target gene or a host cell into which it is introduced.

    [0234] As used throughout the disclosure, the term “exogenous” refers to nucleic acid or protein sequence not naturally associated with a target gene or a host cell into which it is introduced, including non-naturally occurring multiple copies of a naturally occurring nucleic acid, e.g., DNA sequence, or naturally occurring nucleic acid sequence located in a non-naturally occurring genome location.

    [0235] The disclosure provides methods of introducing a polynucleotide construct comprising a DNA sequence into a host cell. By “introducing” is intended presenting to the plant the polynucleotide construct in such a manner that the construct gains access to the interior of the host cell. The methods of the invention do not depend on a particular method for introducing a polynucleotide construct into a host cell, only that the polynucleotide construct gains access to the interior of one cell of the host. Methods for introducing polynucleotide constructs into bacteria, plants, fungi and animals are known in the art including, but not limited to, stable transformation methods, transient transformation methods, and virus-mediated methods.

    Transposons/Transposases

    [0236] Exemplary transposon/transposase systems of the disclosure include, but are not limited to, piggyBac transposons and transposases, Sleeping Beauty transposons and transposases, Helraiser transposons and transposases and Tol2 transposons and transposases.

    [0237] The piggyBac transposase recognizes transposon-specific inverted terminal repeat sequences (ITRs) on the ends of the transposon, and moves the contents between the ITRs into TTAA chromosomal sites. The piggyBac transposon system has no payload limit for the genes of interest that can be included between the ITRs. In certain embodiments, and, in particular, those embodiments wherein the transposon is a piggyBac transposon, the transposase is a piggyBac™ or a Super piggyBac™ (SPB) transposase. In certain embodiments, and, in particular, those embodiments wherein the transposase is a Super piggyBac™ (SPB) transposase, the sequence encoding the transposase is an mRNA sequence.

    [0238] In certain embodiments of the methods of the disclosure, the transposase enzyme is a piggyBac™ (PB) transposase enzyme. The piggyBac (PB) transposase enzyme may comprise or consist of an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:

    TABLE-US-00033 (SEQ ID NO: 14487)   1 MGSSLDDEHI LSALLQSDDE LVGEDSDSEI SDHVSEDDVQ SDTEEAFIDE VHEVQPTSSG  61 SEILDEQNVI EQPGSSLASN RILTLPQRTI RGKNKHCWST SKSTRRSRVS ALNIVRSQRG 121 PTRMCRNIYD PLLCFKLFFT DEIISEIVKW TNAEISLKRR ESMTGATFRD TNEDEIYAFF 181 GILVMTAVRK DNHMSTDDLF DRSLSMVYVS VMSRDRFDFL IRCLRMDDKS IRPTLRENDV 241 FTPVRKIWDL FIHQCIQNYT PGAHLTIDEQ LLGFRGRCPF RMYIPNKPSK YGIKILMMCD 301 SGTKYMINGM PYLGRGTQTN GVPLGEYYVK ELSKPVHGSC RNITCDNWFT SIPLAKNLLQ 361 EPYKLTIVGT VRSNKREIPE VLKNSRSRPV GTSMFCFDGP LTLVSYKPKP AKMVYLLSSC 421 DEDASINEST GKPQMVMYYN QTKGGVDTLD QMCSVMTCSR KTNRWPMALL YGMINIACIN 481 SFIIYSHNVS SKGEKVQSRK KFMRNLYMSL TSSFMRKRLE APTLKRYLRD NISNILPNEV 541 PGTSDDSTEE PVMKKRTYCT YCPSKIRRKA NASCKKCKKV ICREHNIDMC QSCF.

    [0239] In certain embodiments of the methods of the disclosure, the transposase enzyme is a piggyBac™ (PB) transposase enzyme that comprises or consists of an amino acid sequence having an amino acid substitution at one or more of positions 30, 165, 282, or 538 of the sequence:

    TABLE-US-00034 (SEQ ID NO: 14487)   1 MGSSLDDEHI LSALLQSDDE LVGEDSDSEI SDHVSEDDVQ SDTEEAFIDE VHEVQPTSSG  61 SEILDEQNVI EQPGSSLASN RILTLPQRTI RGKNKHCWST SKSTRRSRVS ALNIVRSQRG 121 PTRMCRNIYD PLLCFKLFFT DEIISEIVKW TNAEISLKRR ESMTGATFRD TNEDEIYAFF 181 GILVMTAVRK DNHMSTDDLF DRSLSMVYVS VMSRDRFDFL IRCLRMDDKS IRPTLRENDV 241 FTPVRKIWDL FIHQCIQNYT PGAHLTIDEQ LLGFRGRCPF RMYIPNKPSK YGIKILMMCD 301 SGTKYMINGM PYLGRGTQTN GVPLGEYYVK ELSKPVHGSC RNITCDNWFT SIPLAKNLLQ 361 EPYKLTIVGT VRSNKREIPE VLKNSRSRPV GTSMFCFDGP LTLVSYKPKP AKMVYLLSSC 421 DEDASINEST GKPQMVMYYN QTKGGVDTLD QMCSVMTCSR KTNRWPMALL YGMINIACIN 481 SFIIYSHNVS SKGEKVQSRK KFMRNLYMSL TSSFMRKRLE APTLKRYLRD NISNILPNEV 541 PGTSDDSTEE PVMKKRTYCT YCPSKIRRKA NASCKKCKKV ICREHNIDMC QSCF.

    [0240] In certain embodiments, the transposase enzyme is a piggyBac™ (PB) transposase enzyme that comprises or consists of an amino acid sequence having an amino acid substitution at two or more of positions 30, 165, 282, or 538 of the sequence of SEQ ID NO: 14487. In certain embodiments, the transposase enzyme is a piggyBac™ (PB) transposase enzyme that comprises or consists of an amino acid sequence having an amino acid substitution at three or more of positions 30, 165, 282, or 538 of the sequence of SEQ ID NO: 14487. In certain embodiments, the transposase enzyme is a piggyBac™ (PB) transposase enzyme that comprises or consists of an amino acid sequence having an amino acid substitution at each of the following positions 30, 165, 282, and 538 of the sequence of SEQ ID NO: 14487. In certain embodiments, the amino acid substitution at position 30 of the sequence of SEQ ID NO: 14487 is a substitution of a valine (V) for an isoleucine (I). In certain embodiments, the amino acid substitution at position 165 of the sequence of SEQ ID NO: 14487 is a substitution of a serine (S) for a glycine (G). In certain embodiments, the amino acid substitution at position 282 of the sequence of SEQ ID NO: 14487 is a substitution of a valine (V) for a methionine (M). In certain embodiments, the amino acid substitution at position 538 of the sequence of SEQ ID NO: 14487 is a substitution of a lysine (K) for an asparagine (N).

    [0241] In certain embodiments of the methods of the disclosure, the transposase enzyme is a Super piggyBac™ (SPB) transposase enzyme. In certain embodiments, the Super piggyBac™ (SPB) transposase enzymes of the disclosure may comprise or consist of the amino acid sequence of the sequence of SEQ ID NO: 14487 wherein the amino acid substitution at position 30 is a substitution of a valine (V) for an isoleucine (I), the amino acid substitution at position 165 is a substitution of a serine (S) for a glycine (G), the amino acid substitution at position 282 is a substitution of a valine (V) for a methionine (M), and the amino acid substitution at position 538 is a substitution of a lysine (K) for an asparagine (N). In certain embodiments, the Super piggyBac™ (SPB) transposase enzyme may comprise or consist of an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:

    TABLE-US-00035 (SEQ ID NO: 14484)   1 MGSSLDDEHI LSALLQSDDE LVGEDSDSEV SDHVSEDDVQ SDTEEAFIDE VHEVQPTSSG  61 SEILDEQNVI EQPGSSLASN RILTLPQRTI RGKNKHCWST SKSTRRSRVS ALNIVRSQRG 121 PTRMCRNIYD PLLCFKLFFT DEIISEIVKW TNAEISLKRR ESMTSATFRD TNEDEIYAFF 181 GILVMTAVRK DNHMSTDDLF DRSLSMVYVS VMSRDREDFL IRCLRMDDKS IRPTLRENDV 241 FTPVRKIWDL FIHQCIQNYT PGAHLTIDEQ LLGFRGRCPF RVYIPNKPSK YGIKILMMCD 301 SGTKYMINGM PYLGRGTQTN GVPLGEYYVK ELSKPVHGSC RNITCDNWFT SIPLAKNLLQ 361 EPYKLTIVGT VRSNKREIPE VLKNSRSRPV GTSMFCFDGP LTLVSYKPKP AKMVYLLSSC 421 DEDASINEST GKPQMVMYYN QTKGGVDTLD QMCSVMTCSR KTNRWPMALL YGMINIACIN 481 SFIIYSHNVS SKGEKVQSRK KFMRNLYMSL TSSFMRKRLE APTLKRYLRD NISNILPKEV 541 PGTSDDSTEE PVMKKRTYCT YCPSKIRRKA NASCKKCKKV ICREHNIDMC QSCF.

    [0242] In certain embodiments of the methods of the disclosure, including those embodiments wherein the transposase comprises the above-described mutations at positions 30, 165, 282 and/or 538, the piggyBac™ or Super piggyBac™ transposase enzyme may further comprise an amino acid substitution at one or more of positions 3, 46, 82, 103, 119, 125, 177, 180, 185, 187, 200, 207, 209, 226, 235, 240, 241, 243, 258, 296, 298, 311, 315, 319, 327, 328, 340, 421, 436, 456, 470, 486, 503, 552, 570 and 591 of the sequence of SEQ ID NO: 14487 or SEQ ID NO: 14484. In certain embodiments, including those embodiments wherein the transposase comprises the above-described mutations at positions 30, 165, 282 and/or 538, the piggyBac™ or Super piggyBac™ transposase enzyme may further comprise an amino acid substitution at one or more of positions 46, 119, 125, 177, 180, 185, 187, 200, 207, 209, 226, 235, 240, 241, 243, 296, 298, 311, 315, 319, 327, 328, 340, 421, 436, 456, 470, 485, 503, 552 and 570. In certain embodiments, the amino acid substitution at position 3 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an asparagine (N) for a serine (S). In certain embodiments, the amino acid substitution at position 46 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a serine (S) for an alanine (A). In certain embodiments, the amino acid substitution at position 46 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a threonine (T) for an alanine (A). In certain embodiments, the amino acid substitution at position 82 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a tryptophan (W) for an isoleucine (I). In certain embodiments, the amino acid substitution at position 103 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a proline (P) for a serine (S). In certain embodiments, the amino acid substitution at position 119 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a proline (P) for an arginine (R). In certain embodiments, the amino acid substitution at position 125 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an alanine (A) a cysteine (C). In certain embodiments, the amino acid substitution at position 125 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a leucine (L) for a cysteine (C). In certain embodiments, the amino acid substitution at position 177 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a lysine (K) for a tyrosine (Y). In certain embodiments, the amino acid substitution at position 177 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a histidine (H) for a tyrosine (Y). In certain embodiments, the amino acid substitution at position 180 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a leucine (L) for a phenylalanine (F). In certain embodiments, the amino acid substitution at position 180 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an isoleucine (I) for a phenylalanine (F). In certain embodiments, the amino acid substitution at position 180 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a valine (V) for a phenylalanine (F). In certain embodiments, the amino acid substitution at position 185 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a leucine (L) for a methionine (M). In certain embodiments, the amino acid substitution at position 187 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a glycine (G) for an alanine (A). In certain embodiments, the amino acid substitution at position 200 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a tryptophan (W) for a phenylalanine (F). In certain embodiments, the amino acid substitution at position 207 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a proline (P) for a valine (V). In certain embodiments, the amino acid substitution at position 209 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a phenylalanine (F) for a valine (V). In certain embodiments, the amino acid substitution at position 226 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a phenylalanine (F) for a methionine (M). In certain embodiments, the amino acid substitution at position 235 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an arginine (R) for a leucine (L). In certain embodiments, the amino acid substitution at position 240 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a lysine (K) for a valine (V). In certain embodiments, the amino acid substitution at position 241 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a leucine (L) for a phenylalanine (F). In certain embodiments, the amino acid substitution at position 243 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a lysine (K) for a proline (P). In certain embodiments, the amino acid substitution at position 258 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a serine (S) for an asparagine (N). In certain embodiments, the amino acid substitution at position 296 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a tryptophan (W) for a leucine (L). In certain embodiments, the amino acid substitution at position 296 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a tyrosine (Y) for a leucine (L). In certain embodiments, the amino acid substitution at position 296 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a phenylalanine (F) for a leucine (L). In certain embodiments, the amino acid substitution at position 298 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a leucine (L) for a methionine (M). In certain embodiments, the amino acid substitution at position 298 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an alanine (A) for a methionine (M). In certain embodiments, the amino acid substitution at position 298 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a valine (V) for a methionine (M). In certain embodiments, the amino acid substitution at position 311 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an isoleucine (I) for a proline (P). In certain embodiments, the amino acid substitution at position 311 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a valine for a proline (P). In certain embodiments, the amino acid substitution at position 315 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a lysine (K) for an arginine (R). In certain embodiments, the amino acid substitution at position 319 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a glycine (G) for a threonine (T). In certain embodiments, the amino acid substitution at position 327 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an arginine (R) for a tyrosine (Y). In certain embodiments, the amino acid substitution at position 328 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a valine (V) for a tyrosine (Y). In certain embodiments, the amino acid substitution at position 340 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a glycine (G) for a cysteine (C). In certain embodiments, the amino acid substitution at position 340 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a leucine (L) for a cysteine (C). In certain embodiments, the amino acid substitution at position 421 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a histidine (H) for the aspartic acid (D). In certain embodiments, the amino acid substitution at position 436 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an isoleucine (I) for a valine (V). In certain embodiments, the amino acid substitution at position 456 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a tyrosine (Y) for a methionine (M). In certain embodiments, the amino acid substitution at position 470 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a phenylalanine (F) for a leucine (L). In certain embodiments, the amino acid substitution at position 485 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a lysine (K) for a serine (S). In certain embodiments, the amino acid substitution at position 503 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a leucine (L) for a methionine (M). In certain embodiments, the amino acid substitution at position 503 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an isoleucine (I) for a methionine (M). In certain embodiments, the amino acid substitution at position 552 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a lysine (K) for a valine (V). In certain embodiments, the amino acid substitution at position 570 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a threonine (T) for an alanine (A). In certain embodiments, the amino acid substitution at position 591 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a proline (P) for a glutamine (Q). In certain embodiments, the amino acid substitution at position 591 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an arginine (R) for a glutamine (Q).

    [0243] In certain embodiments of the methods of the disclosure, including those embodiments wherein the transposase comprises the above-described mutations at positions 30, 165, 282 and/or 538, the piggyBac™ transposase enzyme may comprise or the Super piggyBac™ transposase enzyme may further comprise an amino acid substitution at one or more of positions 103, 194, 372, 375, 450, 509 and 570 of the sequence of SEQ ID NO: 14487 or SEQ ID NO: 14484. In certain embodiments of the methods of the disclosure, including those embodiments wherein the transposase comprises the above-described mutations at positions 30, 165, 282 and/or 538, the piggyBac™ transposase enzyme may comprise or the Super piggyBac™ transposase enzyme may further comprise an amino acid substitution at two, three, four, five, six or more of positions 103, 194, 372, 375, 450, 509 and 570 of the sequence of SEQ ID NO: 14487 or SEQ ID NO: 14484. In certain embodiments, including those embodiments wherein the transposase comprises the above-described mutations at positions 30, 165, 282 and/or 538, the piggyBac™ transposase enzyme may comprise or the Super piggyBac™ transposase enzyme may further comprise an amino acid substitution at positions 103, 194, 372, 375, 450, 509 and 570 of the sequence of SEQ ID NO: 14487 or SEQ ID NO: 14484. In certain embodiments, the amino acid substitution at position 103 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a proline (P) for a serine (S). In certain embodiments, the amino acid substitution at position 194 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a valine (V) for a methionine (M). In certain embodiments, the amino acid substitution at position 372 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an alanine (A) for an arginine (R). In certain embodiments, the amino acid substitution at position 375 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an alanine (A) for a lysine (K). In certain embodiments, the amino acid substitution at position 450 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an asparagine (N) for an aspartic acid (D). In certain embodiments, the amino acid substitution at position 509 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a glycine (G) for a serine (S). In certain embodiments, the amino acid substitution at position 570 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a serine (S) for an asparagine (N). In certain embodiments, the piggyBac™ transposase enzyme may comprise a substitution of a valine (V) for a methionine (M) at position 194 of SEQ ID NO: 14487. In certain embodiments, including those embodiments wherein the piggyBac™ transposase enzyme may comprise a substitution of a valine (V) for a methionine (M) at position 194 of SEQ ID NO: 14487, the piggyBac™ transposase enzyme may further comprise an amino acid substitution at positions 372, 375 and 450 of the sequence of SEQ ID NO: 14487 or SEQ ID NO: 14484. In certain embodiments, the piggyBac™ transposase enzyme may comprise a substitution of a valine (V) for a methionine (M) at position 194 of SEQ ID NO: 14487, a substitution of an alanine (A) for an arginine (R) at position 372 of SEQ ID NO: 14487, and a substitution of an alanine (A) for a lysine (K) at position 375 of SEQ ID NO: 14487. In certain embodiments, the piggyBac™ transposase enzyme may comprise a substitution of a valine (V) for a methionine (M) at position 194 of SEQ ID NO: 14487, a substitution of an alanine (A) for an arginine (R) at position 372 of SEQ ID NO: 14487, a substitution of an alanine (A) for a lysine (K) at position 375 of SEQ ID NO: 14487 and a substitution of an asparagine (N) for an aspartic acid (D) at position 450 of SEQ ID NO: 14487.

    [0244] The sleeping beauty transposon is transposed into the target genome by the Sleeping Beauty transposase that recognizes ITRs, and moves the contents between the ITRs into TA chromosomal sites. In various embodiments, SB transposon-mediated gene transfer, or gene transfer using any of a number of similar transposons, may be used in the compositions and methods of the disclosure.

    [0245] In certain embodiments, and, in particular, those embodiments wherein the transposon is a Sleeping Beauty transposon, the transposase is a Sleeping Beauty transposase or a hyperactive Sleeping Beauty transposase (SB100X).

    [0246] In certain embodiments of the methods of the disclosure, the Sleeping Beauty transposase enzyme comprises an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:

    TABLE-US-00036 (SEQ ID NO: 14485)   1 MGKSKEISQD LRKKIVDLHK SGSSLGAISK RLKVPRSSVQ TIVRKYKHHG TTQPSYRSGR  61 RRVLSPRDER TLVRKVQINP RTTAKDLVKM LEETGTKVSI STVKRVLYRH NLKGRSARKK 121 PLLQNRHKKA RLRFATAHGD KDRTFWRNVL WSDETKIELF GHNDHRYVWR KKGEACKPKN 181 TIPTVKHGGG SIMLWGCFAA GGTGALHKID GIMRKENYVD ILKQHLKTSV RKLKLGRKWV 241 FQMDNDPKHT SKVVAKWLKD NKVKVLEWPS QSPDLNPIEN LWAELKKRVR ARRPTNLTQL 301 HQLCQEEWAK IHPTYCGKLV EGYPKRLTQV KQFKGNATKY.

    [0247] In certain embodiments of the methods of the disclosure, the hyperactive Sleeping Beauty (SB100X) transposase enzyme comprises an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:

    TABLE-US-00037 (SEQ ID NO: 14486)   1 MGKSKEISQD LRKRIVDLHK SGSSLGAISK RLAVPRSSVQ TIVRKYKHHG TTQPSYRSGR  61 RRVLSPRDER TLVRKVQINP RTTAKDLVKM LEETGTKVSI STVKRVLYRH NLKGHSARKK 121 PLLQNRHKKA RLRFATAHGD KDRTFWRNVL WSDETKIELF GHNDHRYVWR KKGEACKPKN 181 TIPTVKHGGG SIMLWGCFAA GGTGALHKID GIMDAVQYVD ILKQHLKTSV RKLKLGRKWV 241 FQHDNDPKHT SKVVAKWLKD NKVKVLEWPS QSPDLNPIEN LWAELKKRVR ARRPTNLTQL 301 HQLCQEEWAK IHPNYCGKLV EGYPKRLTQV KQFKGNATKY.

    [0248] The Helraiser transposon is transposed by the Helitron transposase. Helitron transposases mobilize the Helraiser transposon, an ancient element from the bat genome that was active about 30 to 36 million years ago. An exemplary Helraiser transposon of the disclosure includes Helibat1, which comprises a nucleic acid sequence comprising:

    TABLE-US-00038 (SEQ ID NO: 14652)    1 TCCTATATAA TAAAAGAGAA ACATGCAAAT TGACCATCCC TCCGCTACGC TCAAGCCACG   61 CCCACCAGCC AATCAGAAGT GACTATGCAA ATTAACCCAA CAAAGATGGC AGTTAAATTT  121 GCATACGCAG GTGTCAAGCG CCCCAGGAGG CAACGGCGGC CGCGGGCTCC CAGGACCTTC  181 GCTGGCCCCG GGAGGCGAGG CCGGCCGCGC CTAGCCACAC CCGCGGGCTC CCGGGACCTT  241 CGCCAGCAGA GAGCAGAGCG GGAGAGCGGG CGGAGAGCGG GAGGTTTGGA GGACTTGGCA  301 GAGCAGGAGG CCGCTGGACA TAGAGCAGAG CGAGAGAGAG GGTGGCTTGG AGGGCGTGGC  361 TCCCTCTGTC ACCCCAGCTT CCTCATCACA GCTGTGGAAA CTGACAGCAG GGAGGAGGAA  421 GTCCCACCCC CACAGAATCA GCCAGAATCA GCCGTTGGTC AGACAGCTCT CAGCGGCCTG  481 ACAGCCAGGA CTCTCATTCA CCTGCATCTC AGACCGTGAC AGTAGAGAGG TGGGACTATG  541 TCTAAAGAAC AACTGTTGAT ACAACGTAGC TCTGCAGCCG AAAGATGCCG GCGTTATCGA  601 CAGAAAATGT CTGCAGAGCA ACGTGCGTCT GATCTTGAAA GAAGGCGGCG CCTGCAACAG  661 AATGTATCTG AAGAGCAGCT ACTGGAAAAA CGTCGCTCTG AAGCCGAAAA ACAGCGGCGT  721 CATCGACAGA AAATGTCTAA AGACCAACGT GCCTTTGAAG TTGAAAGAAG GCGGTGGCGA  781 CGACAGAATA TGTCTAGAGA ACAGTCATCA ACAAGTACTA CCAATACCGG TAGGAACTGC  841 CTTCTCAGCA AAAATGGAGT ACATGAGGAT GCAATTCTCG AACATAGTTG TGGTGGAATG  901 ACTGTTCGAT GTGAATTTTG CCTATCACTA AATTTCTCTG ATGAAAAACC ATCCGATGGG  961 AAATTTACTC GATGTTGTAG CAAAGGGAAA GTCTGTCCAA ATGATATACA TTTTCCAGAT 1021 TACCCGGCAT ATTTAAAAAG ATTAATGACA AACGAAGATT CTGACAGTAA AAATTTCATG 1081 GAAAATATTC GTTCCATAAA TAGTTCTTTT GCTTTTGCTT CCATGGGTGC AAATATTGCA 1141 TCGCCATCAG GATATGGGCC ATACTGTTTT AGAATACACG GACAAGTTTA TCACCGTACT 1201 GGAACTTTAC ATCCTTCGGA TGGTGTTTCT CGGAAGTTTG CTCAACTCTA TATTTTGGAT 1261 ACAGCCGAAG CTACAAGTAA AAGATTAGCA ATGCCAGAAA ACCAGGGCTG CTCAGAAAGA 1321 CTCATGATCA ACATCAACAA CCTCATGCAT GAAATAAATG AATTAACAAA ATCGTACAAG 1381 ATGCTACATG AGGTAGAAAA GGAAGCCCAA TCTGAAGCAG CAGCAAAAGG TATTGCTCCC 1441 ACAGAAGTAA CAATGGCGAT TAAATACGAT CGTAACAGTG ACCCAGGTAG ATATAATTCT 1501 CCCCGTGTAA CCGAGGTTGC TGTCATATTC AGAAACGAAG ATGGAGAACC TCCTTTTGAA 1561 AGGGACTTGC TCATTCATTG TAAACCAGAT CCCAATAATC CAAATGCCAC TAAAATGAAA 1621 CAAATCAGTA TCCTGTTTCC TACATTAGAT GCAATGACAT ATCCTATTCT TTTTCCACAT 1681 GGTGAAAAAG GCTGGGGAAC AGATATTGCA TTAAGACTCA GAGACAACAG TGTAATCGAC 1741 AATAATACTA GACAAAATGT AAGGACACGA GTCACACAAA TGCAGTATTA TGGATTTCAT 1801 CTCTCTGTGC GGGACACGTT CAATCCTATT TTAAATGCAG GAAAATTAAC TCAACAGTTT 1861 ATTGTGGATT CATATTCAAA AATGGAGGCC AATCGGATAA ATTTCATCAA AGCAAACCAA 1921 TCTAAGTTGA GAGTTGAAAA ATATAGTGGT TTGATGGATT ATCTCAAATC TAGATCTGAA 1981 AATGACAATG TGCCGATTGG TAAAATGATA ATACTTCCAT CATCTTTTGA GGGTAGTCCC 2041 AGAAATATGC AGCAGCGATA TCAGGATGCT ATGGCAATTG TAACGAAGTA TGGCAAGCCC 2101 GATTTATTCA TAACCATGAC ATGCAACCCC AAATGGGCAG ATATTACAAA CAATTTACAA 2161 CGCTGGCAAA AAGTTGAAAA CAGACCTGAC TTGGTAGCCA GAGTTTTTAA TATTAAGCTG 2221 AATGCTCTTT TAAATGATAT ATGTAAATTC CATTTATTTG GCAAAGTAAT AGCTAAAATT 2281 CATGTCATTG AATTTCAGAA ACGCGGACTG CCTCACGCTC ACATATTATT GATATTAGAT 2341 AGTGAGTCCA AATTACGTTC AGAAGATGAC ATTGACCGTA TAGTTAAGGC AGAAATTCCA 2401 GATGAAGACC AGTGTCCTCG ACTTTTTCAA ATTGTAAAAT CAAATATGGT ACATGGACCA 2461 TGTGGAATAC AAAATCCAAA TAGTCCATGT ATGGAAAATG GAAAATGTTC AAAGGGATAT 2521 CCAAAAGAAT TTCAAAATGC GACCATTGGA AATATTGATG GATATCCCAA ATACAAACGA 2581 AGATCTGGTA GCACCATGTC TATTGGAAAT AAAGTTGTCG ATAACACTTG GATTGTCCCT 2641 TATAACCCGT ATTTGTGCCT TAAATATAAC TGTCATATAA ATGTTGAAGT CTGTGCATCA 2701 ATTAAAAGTG TCAAATATTT ATTTAAATAC ATCTATAAAG GGCACGATTG TGCAAATATT 2761 CAAATTTCTG AAAAAAATAT TATCAATCAT GACGAAGTAC AGGACTTCAT TGACTCCAGG 2821 TATGTGAGCG CTCCTGAGGC TGTTTGGAGA CTTTTTGCAA TGCGAATGCA TGACCAATCT 2881 CATGCAATCA CAAGATTAGC TATTCATTTG CCAAATGATC AGAATTTGTA TTTTCATACC 2941 GATGATTTTG CTGAAGTTTT AGATAGGGCT AAAAGGCATA ACTCGACTTT GATGGCTTGG 3001 TTCTTATTGA ATAGAGAAGA TTCTGATGCA CGTAATTATT ATTATTGGGA GATTCCACAG 3061 CATTATGTGT TTAATAATTC TTTGTGGACA AAACGCCGAA AGGGTGGGAA TAAAGTATTA 3121 GGTAGACTGT TCACTGTGAG CTTTAGAGAA CCAGAACGAT ATTACCTTAG ACTTTTGCTT 3181 CTGCATGTAA AAGGTGCGAT AAGTTTTGAG GATCTGCGAA CTGTAGGAGG TGTAACTTAT 3241 GATACATTTC ATGAAGCTGC TAAACACCGA GGATTATTAC TTGATGACAC TATCTGGAAA 3301 GATACGATTG ACGATGCAAT CATCCTTAAT ATGCCCAAAC AACTACGGCA ACTTTTTGCA 3361 TATATATGTG TGTTTGGATG TCCTTCTGCT GCAGACAAAT TATGGGATGA GAATAAATCT 3421 CATTTTATTG AAGATTTCTG TTGGAAATTA CACCGAAGAG AAGGTGCCTG TGTGAACTGT 3481 GAAATGCATG CCCTTAACGA AATTCAGGAG GTATTCACAT TGCATGGAAT GAAATGTTCA 3541 CATTTCAAAC TTCCGGACTA TCCTTTATTA ATGAATGCAA ATACATGTGA TCAATTGTAC 3601 GAGCAACAAC AGGCAGAGGT TTTGATAAAT TCTCTGAATG ATGAACAGTT GGCAGCCTTT 3661 CAGACTATAA CTTCAGCCAT CGAAGATCAA ACTGTACACC CCAAATGCTT TTTCTTGGAT 3721 GGTCCAGGTG GTAGTGGAAA AACATATCTG TATAAAGTTT TAACACATTA TATTAGAGGT 3781 CGTGGTGGTA CTGTTTTACC CACAGCATCT ACAGGAATTG CTGCAAATTT ACTTCTTGGT 3841 GGAAGAACCT TTCATTCCCA ATATAAATTA CCAATTCCAT TAAATGAAAC TTCAATTTCT 3901 AGACTCGATA TAAAGAGTGA AGTTGCTAAA ACCATTAAAA AGGCCCAACT TCTCATTATT 3961 GATGAATGCA CCATGGCATC CAGTCATGCT ATAAACGCCA TAGATAGATT ACTAAGAGAA 4021 ATTATGAATT TGAATGTTGC ATTTGGTGGG AAAGTTCTCC TTCTCGGAGG GGATTTTCGA 4081 CAATGTCTCA GTATTGTACC ACATGCTATG CGATCGGCCA TAGTACAAAC GAGTTTAAAG 4141 TACTGTAATG TTTGGGGATG TTTCAGAAAG TTGTCTCTTA AAACAAATAT GAGATCAGAG 4201 GATTCTGCTT ATAGTGAATG GTTAGTAAAA CTTGGAGATG GCAAACTTGA TAGCAGTTTT 4261 CATTTAGGAA TGGATATTAT TGAAATCCCC CATGAAATGA TTTGTAACGG ATCTATTATT 4321 GAAGCTACCT TTGGAAATAG TATATCTATA GATAATATTA AAAATATATC TAAACGTGCA 4381 ATTCTTTGTC CAAAAAATGA GCATGTTCAA AAATTAAATG AAGAAATTTT GGATATACTT 4441 GATGGAGATT TTCACACATA TTTGAGTGAT GATTCCATTG ATTCAACAGA TGATGCTGAA 4501 AAGGAAAATT TTCCCATCGA ATTTCTTAAT AGTATTACTC CTTCGGGAAT GCCGTGTCAT 4561 AAATTAAAAT TGAAAGTGGG TGCAATCATC ATGCTATTGA GAAATCTTAA TAGTAAATGG 4621 GGTCTTTGTA ATGGTACTAG ATTTATTATC AAAAGATTAC GACCTAACAT TATCGAAGCT 4681 GAAGTATTAA CAGGATCTGC AGAGGGAGAG GTTGTTCTGA TTCCAAGAAT TGATTTGTCC 4741 CCATCTGACA CTGGCCTCCC ATTTAAATTA ATTCGAAGAC AGTTTCCCGT GATGCCAGCA 4801 TTTGCGATGA CTATTAATAA ATCACAAGGA CAAACTCTAG ACAGAGTAGG AATATTCCTA 4861 CCTGAACCCG TTTTCGCACA TGGTCAGTTA TATGTTGCTT TCTCTCGAGT TCGAAGAGCA 4921 TGTGACGTTA AAGTTAAAGT TGTAAATACT TCATCACAAG GGAAATTAGT CAAGCACTCT 4981 GAAAGTGTTT TTACTCTTAA TGTGGTATAC AGGGAGATAT TAGAATAAGT TTAATCACTT 5041 TATCAGTCAT TGTTTGCATC AATGTTGTTT TTATATCATG TTTTTGTTGT TTTTATATCA 5101 TGTCTTTGTT GTTGTTATAT CATGTTGTTA TTGTTTATTT ATTAATAAAT TTATGTATTA 5161 TTTTCATATA CATTTTACTC ATTTCCTTTC ATCTCTCACA CTTCTATTAT AGAGAAAGGG 5221 CAAATAGCAA TATTAAAATA TTTCCTCTAA TTAATTCCCT TTCAATGTGC ACGAATTTCG 5281 TGCACCGGGC CACTAG.

    [0249] Unlike other transposases, the Helitron transposase does not contain an RNase-H like catalytic domain, but instead comprises a RepHel motif made up of a replication initiator domain (Rep) and a DNA helicase domain. The Rep domain is a nuclease domain of the HUH superfamily of nucleases.

    [0250] An exemplary Helitron transposase of the disclosure comprises an amino acid sequence comprising:

    TABLE-US-00039 (SEQ ID NO: 14501)    1 MSKEQLLIQR SSAAERCRRY RQKMSAEQRA SDLERRRRLQ QNVSEEQLLE KRRSEAEKQR   61 RHRQKMSKDQ RAFEVERRRW RRQNMSREQS STSTTNTGRN CLLSKNGVHE DAILEHSCGG  121 MTVRCEFCLS LNFSDEKPSD GKFTRCCSKG KVCPNDIHFP DYPAYLKRLM TNEDSDSKNF  181 MENIRSINSS FAFASMGANI ASPSGYGPYC FRIHGQVYHR TGTLHPSDGV SRKFAQLYIL  241 DTAEATSKRL AMPENQGCSE RLMININNLM HEINELTKSY KMLHEVEKEA QSEAAAKGIA  301 PTEVIMAIKY DRNSDPGRYN SPRVTEVAVI FRNEDGEPPF ERDLLIHCKP DPNNPNATKM  361 KQISILFPTL DAMTYPILFP HGEKGWGTDI ALRLRDNSVI DNNTRQNVRT RVTQMQYYGF  421 HLSVRDTFNP ILNAGKLTQQ FIVDSYSKME ANRINFIKAN QSKLRVEKYS GLMDYLKSRS  481 ENDNVPIGKM IILPSSFEGS PRNMQQRYQD AMAIVTKYGK PDLFITMTCN PKWADITNNL  541 QRWQKVENRP DLVARVFNIK LNALLNDICK FHLFGKVIAK IHVIEFQKRG LPHAHILLIL  601 DSESKLRSED DIDRIVKAEI PDEDQCPRLF QIVKSNMVHG PCGIQNPNSP CMENGKCSKG  661 YPKEFQNATI GNIDGYPKYK RRSGSTMSIG NKVVDNTWIV PYNPYLCLKY NCHINVEVCA  721 SIKSVKYLFK YIYKGHDCAN IQISEKNIIN HDEVQDFIDS RYVSAPEAVW RLFAMRMHDQ  781 SHAITRLAIH LPNDQNLYFH TDDFAEVLDR AKRHNSTLMA WFLLNREDSD ARNYYYWEIP  841 QHYVFNNSLW TKRRKGGNKV LGRLFTVSFR EPERYYLRLL LLHVKGAISF EDLRTVGGVT  901 YDTFHEAAKH RGLLLDDTIW KDTIDDAIIL NMPKQLRQLF AYICVFGCPS AADKLWDENK  961 SHFIEDFCWK LHRREGACVN CEMHALNEIQ EVFTLHGMKC SHFKLPDYPL LMNANTCDQL 1021 YEQQQAEVLI NSLNDEQLAA FQTITSAIED QTVHPKCFFL DGPGGSGKTY LYKVLTHYIR 1081 GRGGTVLPTA STGIAANLLL GGRTFHSQYK LPIPLNETSI SRLDIKSEVA KTIKKAQLLI 1141 IDECTMASSH AINAIDRLLR EIMNLNVAFG GKVLLLGGDF RQCLSIVPHA MRSAIVQTSL 1201 KYCNVWGCFR KLSLKTNMRS EDSAYSEWLV KLGDGKLDSS FHLGMDIIEI PHEMICNGSI 1261 IEATFGNSIS IDNIKNISKR AILCPKNEHV QKLNEEILDI LDGDFHTYLS DDSIDSTDDA 1321 EKENFPIEFL NSITPSGMPC HKLKLKVGAI IMLLRNLNSK WGLCNGTRFI IKRLRPNIIE 1381 AEVLTGSAEG EVVLIPRIDL SPSDTGLPFK LIRRQFPVMP AFAMTINKSQ GQTLDRVGIF 1441 LPEPVFAHGQ LYVAFSRVRR ACDVKVKVVN TSSQGKLVKH SESVFTLNVV YREILE.

    [0251] In Helitron transpositions, a hairpin close to the 3′ end of the transposon functions as a terminator. However, this hairpin can be bypassed by the transposase, resulting in the transduction of flanking sequences. In addition, Helraiser transposition generates covalently closed circular intermediates. Furthermore, Helitron transpositions can lack target site duplications. In the Helraiser sequence, the transposase is flanked by left and right terminal sequences termed LTS and RTS. These sequences terminate with a conserved 5′-TC/CTAG-3′ motif. A 19 bp palindromic sequence with the potential to form the hairpin termination structure is located 11 nucleotides upstream of the RTS and consists of the sequence

    TABLE-US-00040 (SEQ ID NO: 14500) GTGCACGAATTTCGTGCACCGGGCCACTAG.

    [0252] Tol2 transposons may be isolated or derived from the genome of the medaka fish, and may be similar to transposons of the hAT family. Exemplary Tol2 transposons of the disclosure are encoded by a sequence comprising about 4.7 kilobases and contain a gene encoding the Tol2 transposase, which contains four exons. An exemplary Tol2 transposase of the disclosure comprises an amino acid sequence comprising the following:

    TABLE-US-00041 (SEQ ID NO: 14502)   1 MEEVCDSSAA ASSTVQNQPQ DQEHPWPYLR EFFSLSGVNK DSFKMKCVLC LPLNKEISAF  61 KSSPSNLRKH IERMHPNYLK NYSKLTAQKR KIGTSTHASS SKQLKVDSVF PVKHVSPVTV 121 NKAILRYIIQ GLHPFSTVDL PSFKELISTL QPGISVITRP TLRSKIAEAA LIMKQKVTAA 181 MSEVEWIATT TDCWTARRKS FIGVTAHWIN PGSLERHSAA LACKRLMGSH TFEVLASAMN 241 DIHSEYEIRD KVVCTTTDSG SNFMKAFRVF GVENNDIETE ARRCESDDTD SEGCGEGSDG 301 VEFQDASRVL DQDDGFEFQL PKHQKCACHL LNLVSSVDAQ KALSNEHYKK LYRSVFGKCQ 361 ALWNKSSRSA LAAEAVESES RLQLLRPNQT RWNSTFMAVD RILQICKEAG EGALRNICTS 421 LEVPMFNPAE MLFLTEWANT MRPVAKVLDI LQAETNTQLG WLLPSVHQLS LKLQRLHHSL 481 RYCDPLVDAL QQGIQTRFKH MFEDPEITAA AILLPKFRTS WTNDETIIKR GMDYIRVHLE 541 PLDHKKELAN SSSDDEDFFA SLKPTTHEAS KELDGYLACV SDTRESLLTF PAICSLSIKT 601 NTPLPASAAC ERLFSTAGLL FSPKRARLDT NNFENQLLLK LNLRFYNFE.

    [0253] An exemplary Tol2 transposon of the disclosure, including inverted repeats, subterminal sequences and the Tol2 transposase, is encoded by a nucleic acid sequence comprising the following:

    TABLE-US-00042 (SEQ ID NO: 14653)    1 CAGAGGTGTA AAGTACTTGA GTAATTTTAC TTGATTACTG TACTTAAGTA TTATTTTTGG   61 GGATTTTTAC TTTACTTGAG TACAATTAAA AATCAATACT TTTACTTTTA CTTAATTACA  121 TTTTTTTAGA AAAAAAAGTA CTTTTTACTC CTTACAATTT TATTTACAGT CAAAAAGTAC  181 TTATTTTTTG GAGATCACTT CATTCTATTT TCCCTTGCTA TTACCAAACC AATTGAATTG  241 CGCTGATGCC CAGTTTAATT TAAATGTTAT TTATTCTGCC TATGAAAATC GTTTTCACAT  301 TATATGAAAT TGGTCAGACA TGTTCATTGG TCCTTTGGAA GTGACGTCAT GTCACATCTA  361 TTACCACAAT GCACAGCACC TTGACCTGGA AATTAGGGAA ATTATAACAG TCAATCAGTG  421 GAAGAAAATG GAGGAAGTAT GTGATTCATC AGCAGCTGCG AGCAGCACAG TCCAAAATCA  481 GCCACAGGAT CAAGAGCACC CGTGGCCGTA TCTTCGCGAA TTCTTTTCTT TAAGTGGTGT  541 AAATAAAGAT TCATTCAAGA TGAAATGTGT CCTCTGTCTC CCGCTTAATA AAGAAATATC  601 GGCCTTCAAA AGTTCGCCAT CAAACCTAAG GAAGCATATT GAGGTAAGTA CATTAAGTAT  661 TTTGTTTTAC TGATAGTTTT TTTTTTTTTT TTTTTTTTTT TTTTTGGGTG TGCATGTTTT  721 GACGTTGATG GCGCGCCTTT TATATGTGTA GTAGGCCTAT TTTCACTAAT GCATGCGATT  781 GACAATATAA GGCTCACGTA ATAAAATGCT AAAATGCATT TGTAATTGGT AACGTTAGGT  841 CCACGGGAAA TTTGGCGCCT ATTGCAGCTT TGAATAATCA TTATCATTCC GTGCTCTCAT  901 TGTGTTTGAA TTCATGCAAA ACACAAGAAA ACCAAGCGAG AAATTTTTTT CCAAACATGT  961 TGTATTGTCA AAACGGTAAC ACTTTACAAT GAGGTTGATT AGTTCATGTA TTAACTAACA 1021 TTAAATAACC ATGAGCAATA CATTTGTTAC TGTATCTGTT AATCTTTGTT AACGTTAGTT 1081 AATAGAAATA CAGATGTTCA TTGTTTGTTC ATGTTAGTTC ACAGTGCATT AACTAATGTT 1141 AACAAGATAT AAAGTATTAG TAAATGTTGA AATTAACATG TATACGTGCA GTTCATTATT 1201 AGTTCATGTT AACTAATGTA GTTAACTAAC GAACCTTATT GTAAAAGTGT TACCATCAAA 1261 ACTAATGTAA TGAAATCAAT TCACCCTGTC ATGTCAGCCT TACAGTCCTG TGTTTTTGTC 1321 AATATAATCA GAAATAAAAT TAATGTTTGA TTGTCACTAA ATGCTACTGT ATTTCTAAAA 1381 TCAACAAGTA TTTAACATTA TAAAGTGTGC AATTGGCTGC AAATGTCAGT TTTATTAAAG 1441 GGTTAGTTCA CCCAAAAATG AAAATAATGT CATTAATGAC TCGCCCTCAT GTCGTTCCAA 1501 GCCCGTAAGA CCTCCGTTCA TCTTCAGAAC ACAGTTTAAG ATATTTTAGA TTTAGTCCGA 1561 GAGCTTTCTG TGCCTCCATT GAGAATGTAT GTACGGTATA CTGTCCATGT CCAGAAAGGT 1621 AATAAAAACA TCAAAGTAGT CCATGTGACA TCAGTGGGTT AGTTAGAATT TTTTGAAGCA 1681 TCGAATACAT TTTGGTCCAA AAATAACAAA ACCTACGACT TTATTCGGCA TTGTATTCTC 1741 TTCCGGGTCT GTTGTCAATC CGCGTTCACG ACTTCGCAGT GACGCTACAA TGCTGAATAA 1801 AGTCGTAGGT TTTGTTATTT TTGGACCAAA ATGTATTTTC GATGCTTCAA ATAATTCTAC 1861 CTAACCCACT GATGTCACAT GGACTACTTT GATGTTTTTA TTACCTTTCT GGACATGGAC 1921 AGTATACCGT ACATACATTT TCAGTGGAGG GACAGAAAGC TCTCGGACTA AATCTAAAAT 1981 ATCTTAAACT GTGTTCCGAA GATGAACGGA GGTGTTACGG GCTTGGAACG ACATGAGGGT 2041 GAGTCATTAA TGACATCTTT TCATTTTTGG GTGAACTAAC CCTTTAATGC TGTAATCAGA 2101 GAGTGTATGT GTAATTGTTA CATTTATTGC ATACAATATA AATATTTATT TGTTGTTTTT 2161 ACAGAGAATG CACCCAAATT ACCTCAAAAA CTACTCTAAA TTGACAGCAC AGAAGAGAAA 2221 GATCGGGACC TCCACCCATG CTTCCAGCAG TAAGCAACTG AAAGTTGACT CAGTTTTCCC 2281 AGTCAAACAT GTGTCTCCAG TCACTGTGAA CAAAGCTATA TTAAGGTACA TCATTCAAGG 2341 ACTTCATCCT TTCAGCACTG TTGATCTGCC ATCATTTAAA GAGCTGATTA GTACACTGCA 2401 GCCTGGCATT TCTGTCATTA CAAGGCCTAC TTTACGCTCC AAGATAGCTG AAGCTGCTCT 2461 GATCATGAAA CAGAAAGTGA CTGCTGCCAT GAGTGAAGTT GAATGGATTG CAACCACAAC 2521 GGATTGTTGG ACTGCACGTA GAAAGTCATT CATTGGTGTA ACTGCTCACT GGATCAACCC 2581 TGGAAGTCTT GAAAGACATT CCGCTGCACT TGCCTGCAAA AGATTAATGG GCTCTCATAC 2641 TTTTGAGGTA CTGGCCAGTG CCATGAATGA TATCCACTCA GAGTATGAAA TACGTGACAA 2701 GGTTGTTTGC ACAACCACAG ACAGTGGTTC CAACTTTATG AAGGCTTTCA GAGTTTTTGG 2761 TGTGGAAAAC AATGATATCG AGACTGAGGC AAGAAGGTGT GAAAGTGATG ACACTGATTC 2821 TGAAGGCTGT GGTGAGGGAA GTGATGGTGT GGAATTCCAA GATGCCTCAC GAGTCCTGGA 2881 CCAAGACGAT GGCTTCGAAT TCCAGCTACC AAAACATCAA AAGTGTGCCT GTCACTTACT 2941 TAACCTAGTC TCAAGCGTTG ATGCCCAAAA AGCTCTCTCA AATGAACACT ACAAGAAACT 3001 CTACAGATCT GTCTTTGGCA AATGCCAAGC TTTATGGAAT AAAAGCAGCC GATCGGCTCT 3061 AGCAGCTGAA GCTGTTGAAT CAGAAAGCCG GCTTCAGCTT TTAAGGCCAA ACCAAACGCG 3121 GTGGAATTCA ACTTTTATGG CTGTTGACAG AATTCTTCAA ATTTGCAAAG AAGCAGGAGA 3181 AGGCGCACTT CGGAATATAT GCACCTCTCT TGAGGTTCCA ATGTAAGTGT TTTTCCCCTC 3241 TATCGATGTA AACAAATGTG GGTTGTTTTT GTTTAATACT CTTTGATTAT GCTGATTTCT 3301 CCTGTAGGTT TAATCCAGCA GAAATGCTGT TCTTGACAGA GTGGGCCAAC ACAATGCGTC 3361 CAGTTGCAAA AGTACTCGAC ATCTTGCAAG CGGAAACGAA TACACAGCTG GGGTGGCTGC 3421 TGCCTAGTGT CCATCAGTTA AGCTTGAAAC TTCAGCGACT CCACCATTCT CTCAGGTACT 3481 GTGACCCACT TGTGGATGCC CTACAACAAG GAATCCAAAC ACGATTCAAG CATATGTTTG 3541 AAGATCCTGA GATCATAGCA GCTGCCATCC TTCTCCCTAA ATTTCGGACC TCTTGGACAA 3601 ATGATGAAAC CATCATAAAA CGAGGTAAAT GAATGCAAGC AACATACACT TGACGAATTC 3661 TAATCTGGGC AACCTTTGAG CCATACCAAA ATTATTCTTT TATTTATTTA TTTTTGCACT 3721 TTTTAGGAAT GTTATATCCC ATCTTTGGCT GTGATCTCAA TATGAATATT GATGTAAAGT 3781 ATTCTTGCAG CAGGTTGTAG TTATCCCTCA GTGTTTCTTG AAACCAAACT CATATGTATC 3841 ATATGTGGTT TGGAAATGCA GTTAGATTTT ATGCTAAAAT AAGGGATTTG CATGATTTTA 3901 GATGTAGATG ACTGCACGTA AATGTAGTTA ATGACAAAAT CCATAAAATT TGTTCCCAGT 3961 CAGAAGCCCC TCAACCAAAC TTTTCTTTGT GTCTGCTCAC TGTGCTTGTA GGCATGGACT 4021 ACATCAGAGT GCATCTGGAG CCTTTGGACC ACAAGAAGGA ATTGGCCAAC AGTTCATCTG 4081 ATGATGAAGA TTTTTTCGCT TCTTTGAAAC CGACAACACA TGAAGCCAGC AAAGAGTTGG 4141 ATGGATATCT GGCCTGTGTT TCAGACACCA GGGAGTCTCT GCTCACGTTT CCTGCTATTT 4201 GCAGCCTCTC TATCAAGACT AATACACCTC TTCCCGCATC GGCTGCCTGT GAGAGGCTTT 4261 TCAGCACTGC AGGATTGCTT TTCAGCCCCA AAAGAGCTAG GCTTGACACT AACAATTTTG 4321 AGAATCAGCT TCTACTGAAG TTAAATCTGA GGTTTTACAA CTTTGAGTAG CGTGTACTGG 4381 CATTAGATTG TCTGTCTTAT AGTTTGATAA TTAAATACAA ACAGTTCTAA AGCAGGATAA 4441 AACCTTGTAT GCATTTCATT TAATGTTTTT TGAGATTAAA AGCTTAAACA AGAATCTCTA 4501 GTTTTCTTTC TTGCTTTTAC TTTTACTTCC TTAATACTCA AGTACAATTT TAATGGAGTA 4561 CTTTTTTACT TTTACTCAAG TAAGATTCTA GCCAGATACT TTTACTTTTA ATTGAGTAAA 4621 ATTTTCCCTA AGTACTTGTA CTTTCACTTG AGTAAAATTT TTGAGTACTT TTTACACCTC 4681 TG.

    [0254] Exemplary transposon/transposase systems of the disclosure include, but are not limited to, piggyBac and piggyBac-like transposons and transposases.

    [0255] PiggyBac and piggyBac-like transposases recognizes transposon-specific inverted terminal repeat sequences (ITRs) on the ends of the transposon, and moves the contents between the ITRs into TTAA or TTAT chromosomal sites. The piggyBac or piggyBac-like transposon system has no payload limit for the genes of interest that can be included between the ITRs.

    [0256] In certain embodiments, and, in particular, those embodiments wherein the transposon is a piggyBac transposon, the transposase is a piggyBac™, Super piggyBac™ (SPB) transposase. In certain embodiments, and, in particular, those embodiments wherein the transposase is a piggyBac™, Super piggyBac™ (SPB), the sequence encoding the transposase is an mRNA sequence.

    [0257] In certain embodiments of the methods of the disclosure, the transposase enzyme is a piggyBac or piggyBac-like transposase enzyme.

    [0258] In certain embodiments of the methods of the disclosure, the transposase enzyme is a piggyBac or a piggyBac-like transposase enzyme. The piggyBac (PB) or piggyBac-like transposase enzyme may comprise or consist of an amino acid sequence at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:

    TABLE-US-00043 (SEQ ID NO: 14487)   1 MGSSLDDEHI LSALLQSDDE LVGEDSDSEI SDHVSEDDVQ SDTEEAFIDE VHEVQPTSSG  61 SEILDEQNVI EQPGSSLASN RILTLPQRTI RGKNKHCWST SKSTRRSRVS ALNIVRSQRG 121 PTRMCRNIYD PLLCFKLFFT DEIISEIVKW TNAEISLKRR ESMTGATFRD TNEDEIYAFF 181 GILVMTAVRK DNHMSTDDLF DRSLSMVYVS VMSRDRFDFL IRCLRMDDKS IRPTLRENDV 241 FTPVRKIWDL FIHQCIQNYT PGAHLTIDEQ LLGFRGRCPF RMYIPNKPSK YGIKILMMCD 301 SGTKYMINGM PYLGRGTQTN GVPLGEYYVK ELSKPVHGSC RNITCDNWFT SIPLAKNLLQ 361 EPYKLTIVGT VRSNKREIPE VLKNSRSRPV GTSMFCFDGP LTLVSYKPKP AKMVYLLSSC 421 DEDASINEST GKPQMVMYYN QTKGGVDTLD QMCSVMTCSR KTNRWPMALL YGMINIACIN 481 SFIIYSHNVS SKGEKVQSRK KFMRNLYMSL TSSFMRKRLE APTLKRYLRD NISNILPNEV 541 PGTSDDSTEE PVMKKRTYCT YCPSKIRRKA NASCKKCKKV ICREHNIDMC QSCF.

    [0259] In certain embodiments of the methods of the disclosure, the transposase enzyme is a piggyBac or piggyBac-like transposase enzyme that comprises or consists of an amino acid sequence having an amino acid substitution at one or more of positions 30, 165, 282, or 538 of the sequence:

    TABLE-US-00044 (SEQ ID NO: 14487)   1 MGSSLDDEHI LSALLQSDDE LVGEDSDSEI SDHVSEDDVQ SDTEEAFIDE VHEVQPTSSG  61 SEILDEQNVI EQPGSSLASN RILTLPQRTI RGKNKHCWST SKSTRRSRVS ALNIVRSQRG 121 PTRMCRNIYD PLLCFKLFFT DEIISEIVKW TNAEISLKRR ESMTGATFRD TNEDEIYAFF 181 GILVMTAVRK DNHMSTDDLF DRSLSMVYVS VMSRDRFDFL IRCLRMDDKS IRPTLRENDV 241 FTPVRKIWDL FIHQCIQNYT PGAHLTIDEQ LLGFRGRCPF RMYIPNKPSK YGIKILMMCD 301 SGTKYMINGM PYLGRGTQTN GVPLGEYYVK ELSKPVHGSC RNITCDNWFT SIPLAKNLLQ 361 EPYKLTIVGT VRSNKREIPE VLKNSRSRPV GTSMFCFDGP LTLVSYKPKP AKMVYLLSSC 421 DEDASINEST GKPQMVMYYN QTKGGVDTLD QMCSVMTCSR KTNRWPMALL YGMINIACIN 481 SFIIYSHNVS SKGEKVQSRK KFMRNLYMSL TSSFMRKRLE APTLKRYLRD NISNILPNEV 541 PGTSDDSTEE PVMKKRTYCT YCPSKIRRKA NASCKKCKKV ICREHNIDMC QSCF.

    [0260] In certain embodiments, the transposase enzyme is a piggyBac or piggyBac-like transposase enzyme that comprises or consists of an amino acid sequence having an amino acid substitution at two or more of positions 30, 165, 282, or 538 of the sequence of SEQ ID NO: 14487. In certain embodiments, the transposase enzyme is a piggyBac or piggyBac-like transposase enzyme that comprises or consists of an amino acid sequence having an amino acid substitution at three or more of positions 30, 165, 282, or 538 of the sequence of SEQ ID NO: 14487. In certain embodiments, the transposase enzyme is a piggyBac or piggyBac-like transposase enzyme that comprises or consists of an amino acid sequence having an amino acid substitution at each of the following positions 30, 165, 282, and 538 of the sequence of SEQ ID NO: 14487. In certain embodiments, the amino acid substitution at position 30 of the sequence of SEQ ID NO: 14487 is a substitution of a valine (V) for an isoleucine (I). In certain embodiments, the amino acid substitution at position 165 of the sequence of SEQ ID NO: 14487 is a substitution of a serine (S) for a glycine (G). In certain embodiments, the amino acid substitution at position 282 of the sequence of SEQ ID NO: 14487 is a substitution of a valine (V) for a methionine (M). In certain embodiments, the amino acid substitution at position 538 of the sequence of SEQ ID NO: 14487 is a substitution of a lysine (K) for an asparagine (N).

    [0261] In certain embodiments of the methods of the disclosure, the transposase enzyme is a Super piggyBac™ (SPB) or piggyBac-like transposase enzyme. In certain embodiments, the Super piggyBac™ (SPB) or piggyBac-like transposase enzyme of the disclosure may comprise or consist of the amino acid sequence of the sequence of SEQ ID NO: 14487 wherein the amino acid substitution at position 30 is a substitution of a valine (V) for an isoleucine (I), the amino acid substitution at position 165 is a substitution of a serine (S) for a glycine (G), the amino acid substitution at position 282 is a substitution of a valine (V) for a methionine (M), and the amino acid substitution at position 538 is a substitution of a lysine (K) for an asparagine (N). In certain embodiments, the Super piggyBac™ (SPB) or piggyBac-like transposase enzyme may comprise or consist of an amino acid sequence at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:

    TABLE-US-00045 (SEQ ID NO: 14484)   1 MGSSLDDEHI LSALLQSDDE LVGEDSDSEV SDHVSEDDVQ SDTEEAFIDE VHEVQPTSSG  61 SEILDEQNVI EQPGSSLASN RILTLPQRTI RGKNKHCWST SKSTRRSRVS ALNIVRSQRG 121 PTRMCRNIYD PLLCFKLFFT DEIISEIVKW TNAEISLKRR ESMTSATFRD TNEDEIYAFF 181 GILVMTAVRK DNHMSTDDLF DRSLSMVYVS VMSRDRFDFL IRCLRMDDKS IRPTLRENDV 241 FTPVRKIWDL FIHQCIQNYT PGAHLTIDEQ LLGFRGRCPF RVYIPNKPSK YGIKILMMCD 301 SGTKYMINGM PYLGRGTQTN GVPLGEYYVK ELSKPVHGSC RNITCDNWFT SIPLAKNLLQ 361 EPYKLTIVGT VRSNKREIPE VLKNSRSRPV GTSMFCFDGP LTLVSYKPKP AKMVYLLSSC 421 DEDASINEST GKPQMVMYYN QTKGGVDTLD QMCSVMTCSR KTNRWPMALL YGMINIACIN 481 SFIIYSHNVS SKGEKVQSRK KFMRNLYMSL TSSFMRKRLE APTLKRYLRD NISNILPKEV 541 PGTSDDSTEE PVMKKRTYCT YCPSKIRRKA NASCKKCKKV ICREHNIDMC QSCF.

    [0262] In certain embodiments of the methods of the disclosure, including those embodiments wherein the transposase comprises the above-described mutations at positions 30, 165, 282 and/or 538, the piggyBac™, Super piggyBac™ or piggyBac-like transposase enzyme may further comprise an amino acid substitution at one or more of positions 3, 46, 82, 103, 119, 125, 177, 180, 185, 187, 200, 207, 209, 226, 235, 240, 241, 243, 258, 296, 298, 311, 315, 319, 327, 328, 340, 421, 436, 456, 470, 486, 503, 552, 570 and 591 of the sequence of SEQ ID NO: 14487 or SEQ ID NO: 14484. In certain embodiments, including those embodiments wherein the transposase comprises the above-described mutations at positions 30, 165, 282 and/or 538, the piggyBac™, Super piggyBac™ or piggyBac-like transposase enzyme may further comprise an amino acid substitution at one or more of positions 46, 119, 125, 177, 180, 185, 187, 200, 207, 209, 226, 235, 240, 241, 243, 296, 298, 311, 315, 319, 327, 328, 340, 421, 436, 456, 470, 485, 503, 552 and 570. In certain embodiments, the amino acid substitution at position 3 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an asparagine (N) for a serine (S). In certain embodiments, the amino acid substitution at position 46 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a serine (S) for an alanine (A). In certain embodiments, the amino acid substitution at position 46 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a threonine (T) for an alanine (A). In certain embodiments, the amino acid substitution at position 82 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a tryptophan (W) for an isoleucine (I). In certain embodiments, the amino acid substitution at position 103 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a proline (P) for a serine (S). In certain embodiments, the amino acid substitution at position 119 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a proline (P) for an arginine (R). In certain embodiments, the amino acid substitution at position 125 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an alanine (A) a cysteine (C). In certain embodiments, the amino acid substitution at position 125 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a leucine (L) for a cysteine (C). In certain embodiments, the amino acid substitution at position 177 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a lysine (K) for a tyrosine (Y). In certain embodiments, the amino acid substitution at position 177 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a histidine (H) for a tyrosine (Y). In certain embodiments, the amino acid substitution at position 180 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a leucine (L) for a phenylalanine (F). In certain embodiments, the amino acid substitution at position 180 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an isoleucine (I) for a phenylalanine (F). In certain embodiments, the amino acid substitution at position 180 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a valine (V) for a phenylalanine (F). In certain embodiments, the amino acid substitution at position 185 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a leucine (L) for a methionine (M). In certain embodiments, the amino acid substitution at position 187 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a glycine (G) for an alanine (A). In certain embodiments, the amino acid substitution at position 200 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a tryptophan (W) for a phenylalanine (F). In certain embodiments, the amino acid substitution at position 207 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a proline (P) for a valine (V). In certain embodiments, the amino acid substitution at position 209 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a phenylalanine (F) for a valine (V). In certain embodiments, the amino acid substitution at position 226 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a phenylalanine (F) for a methionine (M). In certain embodiments, the amino acid substitution at position 235 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an arginine (R) for a leucine (L). In certain embodiments, the amino acid substitution at position 240 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a lysine (K) for a valine (V). In certain embodiments, the amino acid substitution at position 241 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a leucine (L) for a phenylalanine (F). In certain embodiments, the amino acid substitution at position 243 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a lysine (K) for a proline (P). In certain embodiments, the amino acid substitution at position 258 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a serine (S) for an asparagine (N). In certain embodiments, the amino acid substitution at position 296 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a tryptophan (W) for a leucine (L). In certain embodiments, the amino acid substitution at position 296 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a tyrosine (Y) for a leucine (L). In certain embodiments, the amino acid substitution at position 296 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a phenylalanine (F) for a leucine (L). In certain embodiments, the amino acid substitution at position 298 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a leucine (L) for a methionine (M). In certain embodiments, the amino acid substitution at position 298 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an alanine (A) for a methionine (M). In certain embodiments, the amino acid substitution at position 298 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a valine (V) for a methionine (M). In certain embodiments, the amino acid substitution at position 311 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an isoleucine (I) for a proline (P). In certain embodiments, the amino acid substitution at position 311 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a valine for a proline (P). In certain embodiments, the amino acid substitution at position 315 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a lysine (K) for an arginine (R). In certain embodiments, the amino acid substitution at position 319 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a glycine (G) for a threonine (T). In certain embodiments, the amino acid substitution at position 327 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an arginine (R) for a tyrosine (Y). In certain embodiments, the amino acid substitution at position 328 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a valine (V) for a tyrosine (Y). In certain embodiments, the amino acid substitution at position 340 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a glycine (G) for a cysteine (C). In certain embodiments, the amino acid substitution at position 340 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a leucine (L) for a cysteine (C). In certain embodiments, the amino acid substitution at position 421 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a histidine (H) for the aspartic acid (D). In certain embodiments, the amino acid substitution at position 436 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an isoleucine (I) for a valine (V). In certain embodiments, the amino acid substitution at position 456 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a tyrosine (Y) for a methionine (M). In certain embodiments, the amino acid substitution at position 470 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a phenylalanine (F) for a leucine (L). In certain embodiments, the amino acid substitution at position 485 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a lysine (K) for a serine (S). In certain embodiments, the amino acid substitution at position 503 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a leucine (L) for a methionine (M). In certain embodiments, the amino acid substitution at position 503 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an isoleucine (I) for a methionine (M). In certain embodiments, the amino acid substitution at position 552 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a lysine (K) for a valine (V). In certain embodiments, the amino acid substitution at position 570 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a threonine (T) for an alanine (A). In certain embodiments, the amino acid substitution at position 591 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a proline (P) for a glutamine (Q). In certain embodiments, the amino acid substitution at position 591 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an arginine (R) for a glutamine (Q).

    [0263] In certain embodiments of the methods of the disclosure, including those embodiments wherein the transposase comprises the above-described mutations at positions 30, 165, 282 and/or 538, the piggyBac™ or piggyBac-like transposase enzyme or may comprise or the Super piggyBac™ transposase enzyme may further comprise an amino acid substitution at one or more of positions 103, 194, 372, 375, 450, 509 and 570 of the sequence of SEQ ID NO: 14487 or SEQ ID NO: 14484. In certain embodiments of the methods of the disclosure, including those embodiments wherein the transposase comprises the above-described mutations at positions 30, 165, 282 and/or 538, the piggyBac™ or piggyBac-like transposase enzyme may comprise or the Super piggyBac™ transposase enzyme may further comprise an amino acid substitution at two, three, four, five, six or more of positions 103, 194, 372, 375, 450, 509 and 570 of the sequence of SEQ ID NO: 14487 or SEQ ID NO: 14484. In certain embodiments, including those embodiments wherein the transposase comprises the above-described mutations at positions 30, 165, 282 and/or 538, the piggyBac™ or piggyBac-like transposase enzyme may comprise or the Super piggyBac™ transposase enzyme may further comprise an amino acid substitution at positions 103, 194, 372, 375, 450, 509 and 570 of the sequence of SEQ ID NO: 14487 or SEQ ID NO: 14484. In certain embodiments, the amino acid substitution at position 103 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a proline (P) for a serine (S). In certain embodiments, the amino acid substitution at position 194 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a valine (V) for a methionine (M). In certain embodiments, the amino acid substitution at position 372 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an alanine (A) for an arginine (R). In certain embodiments, the amino acid substitution at position 375 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an alanine (A) for a lysine (K). In certain embodiments, the amino acid substitution at position 450 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an asparagine (N) for an aspartic acid (D). In certain embodiments, the amino acid substitution at position 509 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a glycine (G) for a serine (S). In certain embodiments, the amino acid substitution at position 570 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a serine (S) for an asparagine (N). In certain embodiments, the piggyBac™ or piggyBac-like transposase enzyme may comprise a substitution of a valine (V) for a methionine (M) at position 194 of SEQ ID NO: 14487. In certain embodiments, including those embodiments wherein the piggyBac™ or piggyBac-like transposase enzyme may comprise a substitution of a valine (V) for a methionine (M) at position 194 of SEQ ID NO: 14487, the piggyBac™ or piggyBac-like transposase enzyme may further comprise an amino acid substitution at positions 372, 375 and 450 of the sequence of SEQ ID NO: 14487 or SEQ ID NO: 14484. In certain embodiments, the piggyBac™ or piggyBac-like transposase enzyme may comprise a substitution of a valine (V) for a methionine (M) at position 194 of SEQ ID NO: 14487, a substitution of an alanine (A) for an arginine (R) at position 372 of SEQ ID NO: 14487, and a substitution of an alanine (A) for a lysine (K) at position 375 of SEQ ID NO: 14487. In certain embodiments, the piggyBac™ or piggyBac-like transposase enzyme may comprise a substitution of a valine (V) for a methionine (M) at position 194 of SEQ ID NO: 14487, a substitution of an alanine (A) for an arginine (R) at position 372 of SEQ ID NO: 14487, a substitution of an alanine (A) for a lysine (K) at position 375 of SEQ ID NO: 14487 and a substitution of an asparagine (N) for an aspartic acid (D) at position 450 of SEQ ID NO: 14487.

    [0264] In certain embodiments, the piggyBac or piggyBac-like transposase enzyme is isolated or derived from an insect. In certain embodiments, the insect is Trichoplusia ni (GenBank Accession No. AAA87375; SEQ ID NO: 14666), Argyrogramma agnata (GenBank Accession No. GU477713; SEQ ID NO: 14534, SEQ ID NO: 14667), Anopheles gambiae (GenBank Accession No. XP 312615 (SEQ ID NO: 14668); GenBank Accession No. XP 320414 (SEQ ID NO: 14669); GenBank Accession No. XP 310729 (SEQ ID NO: 14670)), Aphis gossypii (GenBank Accession No. GU329918; SEQ ID NO: 14671, SEQ ID NO: 14672), Acyrthosiphon pisum (GenBank Accession No. XP 001948139; SEQ ID NO: 14673), Agrotis ipsilon (GenBank Accession No. GU477714; SEQ ID NO: 14537, SEQ ID NO: 14674), Bombyx mori (GenBank Accession No. BAD11135; SEQ ID NO: 14505), Chilo suppressalis (GenBank Accession No. JX294476; SEQ ID NO: 14675, SEQ ID NO: 14676), Drosophila melanogaster (GenBank Accession No. AAL39784; SEQ ID NO: 14677), Helicoverpa armigera (GenBank Accession No. ABS18391; SEQ ID NO: 14525), Heliothis virescens (GenBank Accession No. ABD76335; SEQ ID NO: 14678), Macdunnoughia crassisigna (GenBank Accession No. EU287451; SEQ ID NO: 14679, SEQ ID NO: 14680), Pectinophora gossypiella (GenBank Accession No. GU270322; SEQ ID NO: 14530, SEQ ID NO: 14681), Tribolium castaneum (GenBank Accession No. XP 001814566; SEQ ID NO: 14682), Ctenoplusia agnata (also called Argyrogramma agnata), Messour bouvieri, Megachile rotundata, Bombus impatiens, Mamestra brassicae, Mayetiola destructor or Apis mellifera.

    [0265] In certain embodiments, the piggyBac or piggyBac-like transposase enzyme is isolated or derived from an insect. In certain embodiments, the insect is Trichoplusia ni (AAA87375).

    [0266] In certain embodiments, the piggyBac or piggyBac-like transposase enzyme is isolated or derived from an insect. In certain embodiments, the insect is Bombyx mori (BAD11135).

    [0267] In certain embodiments, the piggyBac or piggyBac-like transposase enzyme is isolated or derived from a crustacean. In certain embodiments, the crustacean is Daphnia pulicaria (AAM76342, SEQ ID NO: 14683).

    [0268] In certain embodiments, the piggyBac or piggyBac-like transposase enzyme is isolated or derived from a vertebrate. In certain embodiments, the vertebrate is Xenopus tropicalis (GenBank Accession No. BAF82026; SEQ ID NO: 14518), Homo sapiens (GenBank Accession No. NP 689808; SEQ ID NO: 14684), Mus musculus (GenBank Accession No. NP 741958; SEQ ID NO: 14685), Macaca fascicularis (GenBank Accession No. AB179012; SEQ ID NO: 14686, SEQ ID NO: 14687), Rattus norvegicus (GenBank Accession No. XP 220453; SEQ ID NO: 14688) or Myotis lucifugus.

    [0269] In certain embodiments, the piggyBac or piggyBac-like transposase enzyme is isolated or derived from a urochordate. In certain embodiments, the urochordate is Ciona intestinalis (GenBank Accession No. XP 002123602; SEQ ID NO: 14689).

    [0270] In certain embodiments, the piggyBac or piggyBac-like transposase inserts a transposon at the sequence 5′-TTAT-3′ within a chromosomal site (a TTAT target sequence).

    [0271] In certain embodiments, the piggyBac or piggyBac-like transposase inserts a transposon at the sequence 5′-TTAA-3′ within a chromosomal site (a TTAA target sequence).

    [0272] In certain embodiments, the target sequence of the piggyBac or piggyBac-like transposon comprises or consists of 5′-CTAA-3′, 5′-TTAG-3′, 5′-ATAA-3′, 5′-TCAA-3′, 5′AGTT-3′, 5′-ATTA-3′, 5′-GTTA-3′, 5′-TTGA-3′, 5′-TTTA-3′, 5′-TTAC-3′, 5′-ACTA-3′, 5′-AGGG-3′, 5′-CTAG-3′, 5′-TGAA-3′, 5′-AGGT-3′, 5′-ATCA-3′, 5′-CTCC-3′, 5′-TAAA-3′, 5′-TCTC-3′, 5′TGAA-3′, 5′-AAAT-3′, 5′-AATC-3′, 5′-ACAA-3′, 5′-ACAT-3′, 5′-ACTC-3′, 5′-AGTG-3′, 5′-ATAG-3′, 5′-CAAA-3′, 5′-CACA-3′, 5′-CATA-3′, 5′-CCAG-3′, 5′-CCCA-3′, 5′-CGTA-3′, 5′-GTCC-3′, 5′-TAAG-3′, 5′-TCTA-3′, 5′-TGAG-3′, 5′-TGTT-3′, 5′-TTCA-3′5′-TTCT-3′ and 5′-TTTT-3′.

    [0273] In certain embodiments of the methods of the disclosure, the transposase enzyme is a piggyBac or piggyBac-like transposase enzyme. In certain embodiments, the piggyBac or piggyBac-like transposase enzyme is isolated or derived from Bombyx mori. The piggyBac or piggyBac-like transposase enzyme may comprise or consist of an amino acid sequence at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:

    TABLE-US-00046 (SEQ ID NO: 14504)   1 MDIERQEERI RAMLEEELSD YSDESSSEDE TDHCSEHEVN YDTEEERIDS VDVPSNSRQE  61 EANAIIANES DSDPDDDLPL SLVRQRASAS RQVSGPFYTS KDGTKWYKNC QRPNVRLRSE 121 NIVTEQAQVK NIARDASTEY ECWNIFVTSD MLQEILTHTN SSIRHRQTKT AAENSSAETS 181 FYMQETTLCE LKALIALLYL AGLIKSNRQS LKDLWRTDGT GVDIFRTTMS LQRFQFLQNN 241 IRFDDKSTRD ERKQTDNMAA FRSIFDQFVQ CCQNAYSPSE FLTIDEMLLS FRGRCLFRVY 301 IPNKPAKYGI KILALVDAKN FDVVNLEVYA GKQPSGPYAV SNRPFEVVER LIQPVARSHR 361 NVTFDNWFTG YELMLHLLNE YRLTSVGTVR KNKRQIPESF IRTDRQPNSS VFGFQKDITL 421 VSYAPKKNKV VVVMSTMHHD NSIDESTGEK QKPEMITFYN STKAGVDVVD ELSANYNVSR 481 NSKRWPMTLF YGVLNMAAIN ACIIYRANKN VTIKRTEFIR SLGLSMIYEH LHSRNKKKNI 541 PTYLRQRIEK QLGEPSPRHV NVPGRYVRCQ DCPYKKDRKT KHSCNACAKP ICMEHAKFLC 601 ENCAELDSSL.

    [0274] The piggyBac (PB) or piggyBac-like transposase enzyme may comprise or consist of an amino acid sequence at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:

    TABLE-US-00047 (SEQ ID NO: 14505)   1 MDIERQEERI RAMLEEELSD YSDESSSEDE TDHCSEHEVN YDTEEERIDS VDVPSNSRQE  61 EANAIIANES DSDPDDDLPL SLVRQRASAS RQVSGPFYTS KDGTKWYKNC QRPNVRLRSE 121 NIVTEQAQVK NIARDASTEY ECWNIFVTSD MLQEILTHTN SSIRHRQTKT AAENSSAETS     181 FYMQETTLCE LKALIALLYL AGLIKSNRQS LKDLWRTDGT GVDIFRTTMS LQRFQFLQNN 241 IRFDDKSTRD ERKQTDNMAA FRSIFDQFVQ CCQNAYSPSE FLTIDEMLLS FRGRCLFRVY 301 IPNKPAKYGI KILALVDAKN FYVVNLEVYA GKQPSGPYAV SNRPFEVVER LIQPVARSHR 361 NVTFDNWFTG YELMLHLLNE YRLTSVGTVR KNKRQIPESF IRTDRQPNSS VFGFQKDITL 421 VSYAPKKNKV VVVMSTMHHD NSIDESTGEK QKPEMITFYN STKAGVDVVD ELCANYNVSR 481 NSKRWPMTLF YGVLNMAAIN ACIIYRTNKN VTIKRTEFIR SLGLSMIYEH LHSRNKKKNI 541 PTYLRQRIEK QLGEPSPRHV NVPGRYVRCQ DCPYKKDRKT KRSCNACAKP ICMEHAKFLC 601 ENCAELDSSL.

    [0275] In certain embodiments, the piggyBac or piggyBac-like transposase is fused to a nuclear localization signal. In certain embodiments, the amino acid sequence of the piggyBac or piggyBac-like transposase fused to a nuclear localization signal is encoded by a polynucleotide sequence comprising:

    TABLE-US-00048 (SEQ ID NO: 14629)    1 atggcaccca aaaagaaacg taaagtgatg gacattgaaa gacaggaaga aagaatcagg   61 gcgatgctcg aagaagaact gagcgactac tccgacgaat cgtcatcaga ggatgaaacc  121 gaccactgta gcgagcatga ggttaactac gacaccgagg aggagagaat cgactctgtg  181 gatgtgccct ccaactcacg ccaagaagag gccaatgcaa ttatcgcaaa cgaatcggac  241 agcgatccag acgatgatct gccactgtcc ctcgtgcgcc agcgggccag cgcttcgaga  301 caagtgtcag gtccattcta cacttcgaag gacggcacta agtggtacaa gaattgccag  361 cgacctaacg tcagactccg ctccgagaat atcgtgaccg aacaggctca ggtcaagaat  421 atcgcccgcg acgcctcgac tgagtacgag tgttggaata tcttcgtgac ttcggacatg  481 ctgcaagaaa ttctgacgca caccaacagc tcgattaggc atcgccagac caagactgca  541 gcggagaact catcggccga aacctccttc tatatgcaag agactactct gtgcgaactg  601 aaggcgctga ttgcactgct gtacttggcc ggcctcatca aatcaaatag gcagagcctc  661 aaagatctct ggagaacgga tggaactgga gtggatatct ttcggacgac tatgagcttg  721 cagcggttcc agtttctgca aaacaatatc agattcgacg acaagtccac ccgggacgaa  781 aggaaacaga ctgacaacat ggctgcgttc cggtcaatat tcgatcagtt tgtgcagtgc  841 tgccaaaacg cttatagccc atcggaattc ctgaccatcg acgaaatgct tctctccttc  901 cgggggcgct gcctgttccg agtgtacatc ccgaacaagc cggctaaata cggaatcaaa  961 atcctggccc tggtggacgc caagaatttc tacgtcgtga atctcgaagt gtacgcagga 1021 aagcaaccgt cgggaccgta cgctgtttcg aaccgcccgt ttgaagtcgt cgagcggctt 1081 attcagccgg tggccagatc ccaccgcaat gttaccttcg acaattggtt caccggctac 1141 gagctgatgc ttcaccttct gaacgagtac cggctcacta gcgtggggac tgtcaggaag 1201 aacaagcggc agatcccaga atccttcatc cgcaccgacc gccagcctaa ctcgtccgtg 1261 ttcggatttc aaaaggatat cacgcttgtc tcgtacgccc ccaagaaaaa caaggtcgtg 1321 gtcgtgatga gcaccatgca tcacgacaac agcatcgacg agtcaaccgg agaaaagcaa 1381 aagcccgaga tgatcacctt ctacaattca actaaggccg gcgtcgacgt cgtggatgaa 1441 ctgtgcgcga actataacgt gtcccggaac tctaagcggt ggcctatgac tctcttctac 1501 ggagtgctga atatggccgc aatcaacgcg tgcatcatct accgcaccaa caagaacgtg 1561 accatcaagc gcaccgagtt catcagatcg ctgggtttga gcatgatcta cgagcacctc 1621 cattcacgga acaagaagaa gaatatccct acttacctga ggcagcgtat cgagaagcag 1681 ttgggagaac caagcccgcg ccacgtgaac gtgccggggc gctacgtgcg gtgccaagat 1741 tgcccgtaca aaaaggaccg caaaaccaaa agatcgtgta acgcgtgcgc caaacctatc 1801 tgcatggagc atgccaaatt tctgtgtgaa aattgtgctg aactcgattc ctccctg.

    [0276] In certain embodiments, the piggyBac or piggyBac-like transposase is hyperactive. A hyperactive piggyBac or piggyBac-like transposase is a transposase that is more active than the naturally occurring variant from which it is derived. In certain embodiments, the hyperactive piggyBac or piggyBac-like transposase enzyme is isolated or derived from Bombyx mori. In certain embodiments, the piggyBac or piggyBac-like transposase is a hyperactive variant of SEQ ID NO: 14505. In certain embodiments, the hyperactive piggyBac or piggyBac-like transposase comprises a sequence that is at least 90% identical to:

    TABLE-US-00049 (SEQ ID NO: 14576)   1 MDIERQEERI RAMLEEELSD YSDESSSEDE TDHCSEHEVN YDTEEERIDS VDVPSNSRQE  61 EANAIIANES DSDPDDDLPL SLVRQRASAS RQMSGPHYTS KDGTKWYKNC QRPNVRLRSE 121 NIVTEQAQVK NIARDASTEY ECWNIFVTSD MLQEILTHTN SSIRWRQTKT AAENSSASTS 181 FYMQETTLCE LKALIGLLYI AGLIKSNRQS LKDLWRTDGT GVDIFRTTMS LQRFQFLQNN 241 IRFDDKSTRD ERKQTDNMAA FRSIFDQFVQ SCQNAYSPSE FLTIDEMLLS FRGRCLFRVY 301 IPNKPAKYGI KILALVDAKN FYVKNLEVYA GKQPSGPYAV SNRPFEVVER LIQPVARSHR 361 NVTFDNWFTG YELMLHLLNE YRLTSVGTVR KNKRQIPESF IRTDRQPNSS VFGFQKDITL 421 VSYAPKKNKV VVVMSTMHHD NSIDESTGEK QKPEMITFYN STKAGVDVVD ELCANYNVSR 481 NSKRWPMTLF YGVLNMAAIN ACIIYRTNKN VTIKRTEFIR SLGLSMIYEH LHSRNKKKNI 541 PTYLRQRIEK QLGEPSPRHV NVPGRYVRCQ DCPYKKDRKT KRSCNACAKP ICMEHAKFLC 601 ENCAELDSHL.

    [0277] In certain embodiments, the hyperactive piggyBac or piggyBac-like transposase comprises SEQ ID NO: 14576. In certain embodiments, the hyperactive piggyBac or piggyBac-like transposase comprises a sequence of:

    TABLE-US-00050 (SEQ ID NO: 14630)   1 MDIERQEERI RAMLEEELSD YSDESSSEDE TDHCSEHEVN YDTEEERIDS VDVPSNSRQE  61 EANAIIANES DSDPDDDLPL SLVRQRASAS RQVSGPFYTS KDGTKWYKNC QRPNVRLRSE 121 NIVTEQAQVK NIARDASTEY ECWNIFVTSD MLQEILTHTN SSIRWRQTKT AAENSSAETS 181 FYMQETTLCE LKALIGLLYI AGLIKSNRQS LKDLWRTDGT GVDIFRTTMS LQRFQFLLNN 241 IRFDDKSTRD ERKQTDNMAA FRSIFDQFVQ SCQNAYSPSE FLTIDEMLLS FRGRCLFRVY 301 IPNKPAKYGI KILALVDAKN FYVHNLEVYA GKQPSGPYAV SNRPFEVVER LIQPVARSHR 361 NVTFDNWFTG YEVMLHLLNE YRLTSVGTVR KNKRQIPESF IRTDRQPNSS VFGFQKDITL 421 VSYAPKKNKV VVVMSTMHHD NSIDESTGEK QKPEMITFYN STKAGVDVVD ELCANYNVSR 481 NSKRWPMTLF YGVLNMAAIN ACIIYRTNKN VTIKRTEFIR SLGLSMIYEH LHSRNKKKNI 541 PTYLRQRIEK QLGEPSPRHV NVPGRYVRCQ DCPYKKDRKT KRSCNACAKP ICMEHAKFLC 601 ENCAHLDS.

    [0278] In certain embodiments, the hyperactive piggyBac or piggyBac-like transposase comprises a sequence of:

    TABLE-US-00051 (SEQ ID NO: 14631)   1 MDIERQEERI RAMLEEELSD YSDESSSEDE TDHCSEHEVN YDTEEERIDS VDVPSNSRQE  61 EANAIIANES DSDPDDDLPL SLVRQRASAS RQVSGPFYTS KDGTKWYKNC QRPNVRLRSE 121 NIVTEQAQVK NIARDASTEY ECWNIFVTSD MLQEILTHTN SSIRWRQTKT AAENSSASTS 181 FYMQETTLCE LKALIGLLYI AGLIKSNRQS LKDLWRTDGT GVDIFRTTMS LQRFQFLLNN 241 IRFDDKSTRD ERKQTDNMAA FRSIFDQFVQ SCQNAYSPSE FLTIDEMLLS FRGRCLFRVY 301 IPNKPAKYGI KILALVDAKN FYVKNLEVYA GKQPSGPYAV SNRPFEVVER LIQPVARSHR 361 NVTFDNWFTG YELMLHLLNE YRLTSVGTVR KNKRQIPESF IRTDRQPNSS VFGFQKDITL 421 VSYAPKKNKV VVVMSTMHHD NSIDESTGEK QKPEMITFYN STKAGVDVVD ELCANYNVSR 481 NSKRWPMTLF YGVLNMAAIN ACIIYRTNKN VTIKRTEFIR SLGLSMIYEH LHSRNKKKNI 541 PTYLRQRIAM QLGEPSPRHV NVPGRYVRCQ DCPYKKDRKT KRSCNACAKP ICMEHAKFLC 601 ENCAELDSSL.

    [0279] In certain embodiments, the hyperactive piggyBac or piggyBac-like transposase comprises a sequence of:

    TABLE-US-00052 (SEQ ID NO: 14632)   1 MDIERQEERI RAMLEEELSD YSDESSSEDE TDHCSEHEVN YDTEEERIDS VDVPSNSRQE  61 EANAIIANES DSDPDDDLPL SLVRQRASAS RQVSGPFYTS KDGTKWYKNC QRPNVRLRSE 121 NIVTEQAQVK NIARDASTEY ECWNIFVTSD MLQEILTHTN SSIRWRQTKT AAENSSAETS 181 FYMQETTLCE LKALIGLLYI AGLIKSNRQS LKDLWRTDGT GVDIFRTTMS LQRFQFLLNN 241 IRFDDKSTRD ERKQTDNMAA FRSIFDQFVQ SCQNAYSPSE FLTIDEMLLS FRGRCLFRVY 301 IPNKPAKYGI KILALVDAKN FYVKNLEVYA GKQPSGPYAV SNRPFEVVER LIQPVARSHR 361 NVTFDNWFTG YELMLHLLNE YRLTSVGTVR KNKTQIPENF IRTDRQPNSS VFGFQKDITL 421 VSYAPKKNKV VVVMSTMHHD NSIDESTGEK QKPEMITFYN STKAGVDVVD ELQANYNVSR 481 NSKRWPMTLF YGVLNMAAIN ACIIYRTNKN VTIKRTEFIR SLGLSMIYEH LHSRNKKKNI 541 PTYLRQRIEK QLGEPSPRHV NVPGRYVRCQ DCPYKKDRKT KRSCNACAKP ICMEHAKFLC 601 ENCAELDSSL.

    [0280] In certain embodiments, the hyperactive piggyBac or piggyBac-like transposase comprises a sequence of:

    TABLE-US-00053 (SEQ ID NO: 14633)   1 MDIERQEERI RAMLEEELSD YSDESSSEDE TDHCSEHEVN YDTEEERIDS VDVPSNSRQE  61 EANAIIANES DSDPDDDLPL SLVRQRASAS RQVSGPFYTS KDGTKWYKNC QRPNVRLRSE 121 NIVTEQAQVK NIARDASTEY ECWNIFVTSD MLQEILTHTN SSIRWRQTKT AAENSSAETS 181 FYMQETTLCE LKALIGLLYI AGLIKSNRQS LKDLWRTDGT GVDIFRTTMS LQRFQFLQNN 241 IRFDDKSTRD ERKQTDNMAA FRSIFDQFVQ SCQNAYSPSE FLTIDEMLLS FRGRCLFRVY 301 IPNKPAKYGI KILALVDAKN FYVKNLEVYA GKQPSGPYAV SNRPFEVVER LIQPVARSHR 361 NVTFDNWFTG YELMLHLLNE YRLTSVGTVR KNKRQIPESF IRTDRQPNSS VFGFQKDITL 421 VSYAPKKNKV VVVMSTMHHD NSIDESTGEK QKPEMITFYN STKAGVDVVD ELCANYNVSR 481 NSKRWPMTLF YGVLNMAAIN ACIIYRTNKN VTIKRTEFIR SLGLSMIYEH LHSRNKKKNI 541 PTYLRQRIEK QLGEPSPRHV NVPGRYVRCQ DCPYKKDRKT KRSCNACAKP ICMEHAKFLC 601 ENCAELDSSL.

    [0281] In certain embodiments, the hyperactive piggyBac or piggyBac-like transposase comprises a sequence of:

    TABLE-US-00054 (SEQ ID NO: 14634)   1 MDIERQEERI RAMLEEELSD YSDESSSEDE TDHCSEHEVN YDTEEERIDS VDVPSNSRQE  61 EANAIIANES DSDPDDDLPL SLVRQRASAS RQVSGPFYTS KDGTKWYKNC QRPNVRLRSE 121 NIVTEQAQVK NIARDASTEY ECWNIFVTSD MLQEILTHTN SSIRHRQTKT AAENSSAETS 181 FYMQETTLCE LKALIALLYL AGLIKSNRQS LKDLWRTDGT GVDIFRTTMS LQRFQFLQNN 241 IRFDDKSTRD ERKQTDNMAA FRSIFDQFVQ CCQNAYSPSE FLTIDEMLLS FRGRCLFRVY 301 IPNKPAKYGI KILALVDAKN DYVVNLEVYA GKQPSGPYAV SNRPFEVVER LIQPVARSHR 361 NVTFDNWFTG YELMLHLLNE YRLTSVGTVR KNKRQIPESF IRTDRQPNSS VFGFQKDITL 421 VSYAPKKNKV VVVMSTMHHD NSIDESTGEK QKPEMITFYN STKAGVDVVD ELCANYNVSR 481 NSKRWPMTLF YGVLNMAAIN ACIIYRTNKN VTIKRTEFIR SLGLSMIYEH LHSRNKKKNI 541 PTYLRQRIEK QLGEPSSRHV NVKGRYVRCQ DCPYKKDRKT KRSCNACAKP ICMEHAKFLC 601 ENCAELDSSL.

    [0282] In certain embodiments, the hyperactive piggyBac or piggyBac-like transposase is more active than the transposase of SEQ ID NO: 14505. In certain embodiments, the hyperactive piggyBac or piggyBac-like transposase is at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% or any percentage in between identical to SEQ ID NO: 14505.

    [0283] In certain embodiments, the hyperactive piggyBac or piggyBac-like transposase comprises an amino acid substitution at a position selected from 92, 93, 96, 97, 165, 178, 189, 196, 200, 201, 211, 215, 235, 238, 246, 253, 258, 261, 263, 271, 303, 321, 324, 330, 373, 389, 399, 402, 403, 404, 448, 473, 484, 507, 523, 527, 528, 543, 549, 550, 557, 601, 605, 607, 609, 610 or a combination thereof (relative to SEQ ID NO: 14505). In certain embodiments, the hyperactive piggyBac or piggyBac-like transposase comprises an amino acid substitution of Q92A, V93L, V93M, P96G, F97H, F97C, H165E, H165W, E178S, E178H, C189P, A196G, L200I, A201Q, L211A, W215Y, G2195, Q235Y, Q235G, Q238L, K246I, K253V, M258V, F261L, S263K, C271S, N303R, F321W, F321D, V324K, V324H, A330V, L373C, L373V, V389L, S399N, R402K, T403L, D404Q, D404S, D404M, N441R, G448W, E449A, V469T, C473Q, R484K T507C, G523A, I527M, Y528K Y543I, E549A, K550M, P557S, E601V, E605H, E605W, D607H, 5609H, L610I or any combination thereof. In certain embodiments, the hyperactive piggyBac or piggyBac-like transposase comprises an amino acid substitution of Q92A, V93L, V93M, P96G, F97H, F97C, H165E, H165W, E178S, E178H, C189P, A196G, L200I, A201Q, L211A, W215Y, G2195, Q235Y, Q235G, Q238L, K246I, K253V, M258V, F261L, S263K, C271S, N303R, F321W, F321D, V324K, V324H, A330V, L373C, L373V, V389L, S399N, R402K, T403L, D404Q, D404S, D404M, N441R, G448W, E449A, V469T, C473Q, R484K T507C, G523A, I527M, Y528K Y543I, E549A, K550M, P557S, E601V, E605H, E605W, D607H, 5609H and L610I.

    [0284] In certain embodiments, the hyperactive piggyBac or piggyBac-like transposase comprises one or more substitutions of an amino acid that is not wild type, wherein the one or more substitutions a for wild type amino acid comprises a substitution of E4X, A12X, M13X, L14X, E15X, D20X, E24X, S25X, S26X, S27X, D32X, H33X, E36X, E44X, E45X, E46X, I48X, D49X, R58X, A62X, N63X, A64X, I65X, I66X, N68X, E69X, D71X, S72X, D76X, P79X, R84X, Q85X, A87X, S88X, Q92X, V93X, S94X, G95X, P96X, F97X, Y98X, T99X, I145X, S149X, D150X, L152X, E154X, T157X, N160X, S161X, S162X, H165X, R166X, T168X, K169X, T170X, A171X, E173X, S175X, S176X, E178X, T179X, M183X, Q184X, T186X, T187X, L188X, C189X, L194X, I195X, A196X, L198X, L200X, A201X, L203X, I204X, K205X, A206X, N207X, Q209X, S210X, L211X, K212X, D213X, L214X, W215X, R216X, T217X, G219X, V222X, D223X, I224X, T227X, M229X, Q235X, L237X, Q238X, N239X, N240X, P302X, N303X, P305X, A306X, K307X, Y308X, I310X, K311X, I312X, L313X, A314X, L315X, V316X, D317X, A318X, K319X, N320X, F321X, Y322X, V323X, V324X, L326X, E327X, V328X, A330X, Q333X, P334X, S335X, G336X, P337X, A339X, V340X, S341X, N342X, R343X, P344X, F345X, E346X, V347X, E349X, I352X, Q353X, V355X, A356X, R357X, N361X, D365X, W367X, T369X, G370X, L373X, M374X, L375X, H376X, N379X, E380X, R382X, V386X, V389X, N392X, R394X, Q395X, S399X, F400X, I401X, R402XT403X, D404X, R405X, Q406X, P407X, N408X, S409X, S410X, V411X, F412X, F414X, Q415X, I418X, T419X, L420X, N428XV432X, M434X, D440X, N441X, S442X, I443X, D444X, E445X, G448X, E449X, Q451X, K452X, M455X, I456X, T457X, F458X, S461X, A464X, V466X, Q468X, V469X, E471X, L472X, C473X, A474X, K483X, W485X, T488X, L489X, Y491X, G492X, V493X, M496X, I499X, C502X, I503X, T507X, K509X, N510X, V511X, T512X, I513X, R515X, E517X, S521X, G523X, L524X, S525X, I527X, Y528X, E529X, H532X, S533X, N535X, K536X, K537X, N539X, I540X, T542X, Y543X, Q546X, E549X, K550X, Q551X, G553X, E554X, P555X, S556X, P557X, R558X, H559X, V560X, N561X, V562X, P563X, G564X, R565X, Y566X, V567X, Q570X, D571X, P573X, Y574X, K576X, K581X, S583X, A586X, A588X, E594X, F598X, L599X, E601X, N602X, C603X, A604X, E605X, L606X, D607X, S608X, S609X or L610X (relative to SEQ ID NO: 14505). A list of hyperactive amino acid substitutions can be found in U.S. Pat. No. 10,041,077, the contents of which are incorporated herein by reference in their entirety.

    [0285] In certain embodiments, the piggyBac or piggyBac-like transposase is integration deficient. In certain embodiments, an integration deficient piggyBac or piggyBac-like transposase is a transposase that can excise its corresponding transposon, but that integrates the excised transposon at a lower frequency than a corresponding wild type transposase. In certain embodiments, the piggyBac or piggyBac-like transposase is an integration deficient variant of SEQ ID NO: 14505.

    [0286] In certain embodiments, the excision competent, integration deficient piggyBac or piggyBac-like transposase comprises one or more substitutions of an amino acid that is not wild type, wherein the one or more substitutions a for wild type amino acid comprises a substitution of R9X, A12X, M13X, D20X, Y21K, D23X, E24X, 525X, S26X, S27X, E28X, E30X, D32X, H33X, E36X, H37X, A39X, Y41X, D42X, T43X, E44X, E45X, E46X, R47X, D49X, S50X, 555X, A62X, N63X, A64X, I66X, A67X, N68X, E69X, D70X, D71X, S72X, D73X, P74X, D75X, D76X, D77X, I78X, 581X, V83X, R84X, Q85X, A87X, S88X, A89X, 590X, R91X, Q92X, V93X, S94X, G95X, P96X, F97X, Y98X, T99X, W012X, G103X, Y107X, K108X, L117X, I122X, Q128X, I312X, D135X, 5137X, E139X, Y140X, I145X, 5149X, D150X, Q153X, E154X, T157X, 5161X, 5162X, R164X, H165X, R166X, Q167X, T168X, K169X, T170X, A171X, A172X, E173X, R174X, 5175X, 5176X, A177X, E178X, T179X, 5180X, Y182X, Q184X, E185X, T187X, L188X, C189X, L194X, I195X, A196X, L198X, L200X, A201X, L203X, I204X, K205X, N207X, Q209X, L211X, D213X, L214X, W215X, R216X, T217X, G219X, T220X, V222X, D223X, I224X, T227X, T228X, F234X, Q235X, L237X, Q238X, N239X, N240X, N303X, K304X, I310X, I312X, L313X, A314X, L315X, V316X, D317X, A318X, K319X, N320X, F321X, Y322X, V323X, V324X, N325X, L326X, E327X, V328X, A330X, G331X, K332X, Q333X, 5335X, P337X, P344X, F345X, E349X, H359X, N361X, V362X, D365X, F368X, Y371X, E372X, L373X, H376X, E380X, R382X, R382X, V386X, G387X, T388X, V389X, K391X, N392X, R394X, Q395X, E398X, 5399X, F400X, I401X, R402XT403X, D404X, R405X, Q406X, P407X, N408X, 5409X, 5410X, Q415X, K416X, A424X, K426X, N428X, V430X, V432X, V433X, M434X, D436X, D440X, N441X, 5442X, I443X, D444X, E445X, 5446X, T447X, G448X, E449X, K450X, Q451X, E454X, M455X, I456X, T457X, F458X, 5461X, A464X, V466X, Q468X, V469X, C473X, A474X, N475X, N477X, K483X, R484X, P486X, T488X, L489X, G492X, V493X, M496X, I499X, I503X, Y505X, T507X, N510X, V511X, T512X, I513X, K514X, T516X, E517X, 5521X, G523X, L524X, 5525X, I527X, Y528X, L531X, H532X, S533X, N535X, I540X, T542X, Y543X, R545X, Q546X, E549X, L552X, G553X, E554X, P555X, S556X, P557X, R558X, H559X, V560X, N561X, V562X, P563X, G564X, V567X, Q570X, D571X, P573X, Y574X, K575X, K576X, N585X, A586X, M593X, K596X, E601X, N602X, A604X, E605X, L606X, D607X, S608X, S609X or L610X (relative to SEQ ID NO: 14505). A list of integration deficient amino acid substitutions can be found in U.S. Pat. No. 10,041,077, the contents of which are incorporated by reference in their entirety.

    [0287] In certain embodiments, the integration deficient piggyBac or piggyBac-like transposase comprises a sequence of:

    TABLE-US-00055 (SEQ ID NO: 14606)   1 MDIERQEERI RAMLEEELSD YSDESSSEDE TDHCSEHEVN YDTEEERIDS VDVPSNSRQE  61 EANAIIANES DSDPDDDLPL SLVRQRASAS RQVSGPFYTS KDGTKWYKNC QRPNVRLRSE 121 NIVTEQAQVK NIARDASTEY ECWNIFVTSD MLQEILTHTN SSIRHRQTKT AAENSSAETS 181 FYMQETTLCE LKALIALLYL AGLIKSNRQS LKDLWRKDGT GVDIFRTTMS LQRFQFLLNN 241 IRFDDISTRD ERKQTDNMAA FRSIFDQFVQ CCQNAYSPSE FLTIDEMLLS FRGRCLFRVY 301 IPNKPAKYGI KILALVDAKN FYVVNLEVYA GKQPSGPYAV SNRPFEVVER LIQPVARSHR 361 NVTFDNWFTG YELMLHLLNE YRLTSVGTVR KNKRQIPESF IRTDRQPNSS VFGFQKDITL 421 VSYAPKKNKV VVVMSTMHHD NSIDESTGEK QKPEMITFYN STKAGVDVVD ELCANYNVSR 481 NSKKWPMTLF YGVLNMAAIN ACIIYRTNKN VTIKRTEFIR SLGLSMMYEH LHSRNKKKNI 541 PTYLRQRIEK QLGEPVPRHV NVPGRYVRCQ DCPYKKDRKT KRSCNACAKP ICMEHAKFLC 601 ENCAELDSSL.
    In certain embodiments, the integration deficient piggyBac or piggyBac-like transposase comprises a sequence of:

    TABLE-US-00056 (SEQ ID NO: 14607)   1 MDIERQEERI RAMLEEELSD YSDESSSEDE TDHCSEHEVN YDTEEERIDS VDVPSNSRQE  61 EANAIIANES DSDPDDDLPL SLVRQRASAS RQVSGPFYTS KDGTKWYKNC QRPNVRLRSE 121 NIVTEQAQVK NIARDASTEY ECWNIFVTSD MLQEILTHTN SSIRHRQTKT AAENSSAETS 181 FYMQETTLCE LKALIGLLYL AGLIKSNRQS LKDLWRTDGT GVDIFRTTMS LQRFYFLQNN 241 IRFDDKSTLD ERKQTDNMAA FRSIFDQFVQ SCQNAYSPSE FLTIDEMLLS FRGRCLFRVY 301 IPNKPAKYGI KILALVDAKN FYVVNLEVYA GKQPSGPYAV SNRPFEVVER LIQPVARSHR 361 NVTFDNWFTG YELMLHLLNE YRLTSVGTVR KNKRQIPESF IRTDRQPNSS VFGFQKDITL 421 VSYAPKKNKV VVVMSTMHHD NSIDESTGEK QKPEMITFYN STKAGVDVVD ELCANYNVSR 481 NSKRWPMTLF YGVLNMAAIN ACIIYRTNKN VTIKRTEFIR SLGLSMIYEH LHSRNKKKNI 541 PTYLRQRIEK QLGEPSPRHV NYPGRYVRCQ DCPYKKDRKT KRSCNACAKP ICMEHAKFLC 601 VNCAELDSSL.
    In certain embodiments, the piggyBac or piggyBac-like transposase that is is integration deficient comprises a sequence of:

    TABLE-US-00057 (SEQ ID NO: 14608)   1 MDIERQEERI RAMLEEELSD YSDESSSEDE TDHCSEHEVN YDTEEERIDS VDVPSNSRQE  61 EANAIIANES DSDPDDDLPL SLVRQRASAS RQVSGPFYTS KDGTKWYKNC QRPNVRLRSE 121 NIVTEQAQVK NIARDASTEY ECWNIFVTSD MLQEILTHTN SSIRHRQTKT AAENSSAETS 181 FYMQETTLCE LKALIALLYL AGLIKSNRQS LKDLWRKDGT GVDIFRTTMS LQRFQFLLNN 241 IRFDDKSTRD ERKQTDNMAA FRSIFDQFVQ CCQNAYSPSE FLTIDEMLLS FRGRCLFRVY 301 IPNKPAKYGI KILALVDAKN DYVVNLEVYA GKQPSGPYAV SNRPFEVVER LIQPVARSHR 361 NVTFDNWFTG YECMLHLLNE YRLTSVGTVR KNKRQIPESF IRTDRQPNSS VFGFQKDITL 421 VSYAPKKNKV VVVMSTMHHD NSIDESTGEK QKPEMITFYN STKAGVDVVD ELCANYNVSR 481 NSKKWPMTLF YGVLNMAAIN ACIIYRTNKN VTIKRTEFIR SLGLSMIKEH LHSRNKKKNI 541 PTYLRQRIEK QLGEPSPRHV NVPGRYVRCQ DCPYKKDRKT KRSCNACAKP ICMEHAKFLC 601 ENCAELDSSL.
    In certain embodiments, the integration deficient transposase comprises a sequence that is at least 90% identical to SEQ ID NO: 14608.

    [0288] In certain embodiments, the piggyBac or piggyBac-like transposon is isolated or derived from Bombyx mori. In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00058 (SEQ ID NO: 14506)   1 ttatcccggc gagcatgagg cagggtatct cataccctgg taaaatttta aagttgtgta  61 ttttataaaa ttttcgtctg acaacactag cgcgctcagt agctggaggc aggagcgtgc 121 gggaggggat agtggcgtga tcgcagtgtg gcacgggaca ccggcgagat attcgtgtgc 181 aaacctgttt cgggtatgtt ataccctgcc tcattgttga cgtatttttt ttatgtaatt 241 tttccgatta ttaatttcaa ctgttttatt ggtattttta tgttatccat tgttcttttt 301 ttatgattta ctgtatcggt tgtctttcgt tcctttagtt gagttttttt ttattatttt 361 cagtttttga tcaaa.
    In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00059 (SEQ ID NO: 14507)   1 tcatattttt agtttaaaaa aataattata tgttttataa tgaaaagaat ctcattatct  61 ttcagtatta ggttgattta tattccaaag aataatattt ttgttaaatt gttgattttt 121 gtaaacctct aaatgtttgt tgctaaaatt actgtgttta agaaaaagat taataaataa 181 taataatttc ataattaaaa acttctttca ttgaatgcca ttaaataaac cattatttta 241 caaaataaga tcaacataat tgagtaaata ataataagaa caatattata gtacaacaaa 301 atatgggtat gtcataccct gccacattct tgatgtaact ttttttcacc tcatgctcgc 361 cgggttat.
    In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00060 (SEQ ID NO: 14508)   1 ttatcccggc gagcatgagg cagggtatct cataccctgg taaaatttta aagttgtgta  61 ttttataaaa ttttcgtctg acaacactag cgcgctcagt agctggaggc aggagcgtgc 121 gggaggggat agtggcgtga tcgcagtgtg gcacgggaca ccggcgagat attcgtgtgc 181 aaacctgttt cgggtatgtt ataccctgcc tcat.
    In certain embodiments, the piggyBac™ (PB) or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00061 (SEQ ID NO: 14509)   1 taaataataa taatttcata attaaaaact tctttcattg aatgccatta aataaaccat  61 tattttacaa aataagatca acataattga gtaaataata ataagaacaa tattatagta 121 caacaaaata tgggtatgtc ataccctgcc acattcttga tgtaactttt tttcacctca 181 tgctcgccgg gttat.

    [0289] In certain embodiments, the piggyBac or piggyBac-like transposon comprises a left sequence corresponding to SEQ ID NO: 14506 and a right sequence corresponding to SEQ ID NO: 14507. In certain embodiments, one piggyBac or piggyBac-like transposon end is at least 85%, at least 90%, at least 95%, at least 98%, at least 99% identical or any percentage in between identical to SEQ ID NO: 14506 and the other piggyBac or piggyBac-like transposon end is at least 85%, at least 90%, at least 95%, at least 98%, at least 99% or any percentage in between identical to SEQ ID NO: 14507. In certain embodiments, the piggyBac or piggyBac-like transposon comprises SEQ ID NO: 14506 and SEQ ID NO: 14507 or SEQ ID NO: 14509. In certain embodiments, the piggyBac or piggyBac-like transposon comprises SEQ ID NO: 14508 and SEQ ID NO: 14507 or SEQ ID NO: 14509. In certain embodiments, the left and right transposon ends share a 16 bp repeat sequence at their ends of CCCGGCGAGCATGAGG (SEQ ID NO: 14510) immediately adjacent to the 5′-TTAT-3 target insertion site, which is inverted in the orientation in the two ends. In certain embodiments, left transposon end begins with a sequence comprising 5′-TTATCCCGGCGAGCATGAGG-3 (SEQ ID NO: 14511), and the right transposon ends with a sequence comprising the reverse complement of this sequence:

    TABLE-US-00062 (SEQ ID NO: 14512) 5′-CCTCATGCTCGCCGGGTTAT-3′.

    [0290] In certain embodiments, the piggyBac or piggyBac-like transposon comprises one end comprising at least 14, 16, 18, 20, 30 or 40 contiguous nucleotides of SEQ ID NO: 14506 or SEQ ID NO: 14508. In certain embodiments, the piggyBac or piggyBac-like transposon comprises one end comprising at least 14, 16, 18, 20, 30 or 40 contiguous nucleotides of SEQ ID NO: 14507 or SEQ ID NO: 14509. In certain embodiments, the piggyBac or piggyBac-like transposon comprises one end with at least 90% identity to SEQ ID NO: 14506 or SEQ ID NO: 14508. In certain embodiments, the piggyBac or piggyBac-like transposon comprises one end with at least 90% identity to SEQ ID NO: 14507 or SEQ ID NO: 14509.

    [0291] In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00063 (SEQ ID NO: 14515)   1 ttaacccggc gagcatgagg cagggtatct cataccctgg taaaatttta aagttgtgta  61 ttttataaaa ttttcgtctg acaacactag cgcgctcagt agctggaggc aggagcgtgc 121 gggaggggat agtggcgtga tcgcagtgtg gcacgggaca ccggcgagat attcgtgtgc 181 aaacctgttt cgggtatgtt ataccctgcc tcattgttga cgtatttttt ttatgtaatt 241 tttccgatta ttaatttcaa ctgttttatt ggtattttta tgttatccat tgttcttttt 301 ttatgattta ctgtatcggt tgtctttcgt tcctttagtt gagttttttt ttattatttt 361 cagtttttga tcaaa.

    [0292] In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00064 (SEQ ID NO: 14516)   1 tcatattttt agtttaaaaa aataattata tgttttataa tgaaaagaat ctcattatct  61 ttcagtatta ggttgattta tattccaaag aataatattt ttgttaaatt gttgattttt 121 gtaaacctct aaatgtttgt tgctaaaatt actgtgttta agaaaaagat taataaataa 181 taataatttc ataattaaaa acttctttca ttgaatgcca ttaaataatt cattatttta 241 caaaataaga tcaacataat tgagtaaata ataataagaa caatattata gtacaacaaa 301 atatgggtat gtcataccct tttttttttt tttttttttt ttttttcggg tagagggccg 361 aacctcctac gaggtccccg cgcaaaaggg gcgcgcgggg tatgtgagac tcaacgatct 421 gcatggtgtt gtgagcagac cgcgggccca aggattttag agcccaccca ctaaacgact 481 cctctgcact cttacacccg acgtccgatc ccctccgagg tcagaacccg gatgaggtag 541 gggggctacc gcggtcaaca ctacaaccag acggcgcggc tcaccccaag gacgcccagc 601 cgacggagcc ttcgaggcga atcgaaggct ctgaaacgtc ggccgtctcg gtacggcagc 661 ccgtcgggcc gcccagacgg tgccgctggt gtcccggaat accccgctgg accagaacca 721 gcctgccggg tcgggacgcg atacaccgtc gaccggtcgc tctaatcact ccacggcagc 781 gcgctagagt gctggta.

    [0293] In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of CCCGGCGAGCATGAGG (SEQ ID NO: 14510). In certain embodiments, the piggyBac or piggyBac-like transposon comprises an ITR sequence of SEQ ID NO: 14510. In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of TTATCCCGGCGAGCATGAGG (SEQ ID NO: 14511). In certain embodiments, the piggyBac or piggyBac-like transposon comprises at least 16 contiguous nucleotides from SEQ ID NO: 14511. In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of CCTCATGCTCGCCGGGTTAT (SEQ ID NO: 14512). In certain embodiments, the piggyBac or piggyBac-like transposon comprises at least 16 contiguous nucleotides from SEQ ID NO: 14512. In certain embodiments, the piggyBac or piggyBac-like transposon comprises one end comprising at least 16 contiguous nucleotides from SEQ ID NO: 14511 and one end comprising at least 16 contiguous nucleotides from SEQ ID NO: 14512. In certain embodiments, the piggyBac or piggyBac-like transposon comprises SEQ ID NO: 14511 and SEQ ID NO: 14512. In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of TTAACCCGGCGAGCATGAGG (SEQ ID NO: 14513). In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of CCTCATGCTCGCCGGGTTAA (SEQ ID NO: 14514).

    [0294] In certain embodiments, the piggyBac or piggyBac-like transposon may have ends comprising SEQ ID NO: 14506 and SEQ ID NO: 14507, or a variant of either or both of these having at least 90% sequence identity to SEQ ID NO: 14506 or SEQ ID NO: 14507, and the piggyBac or piggyBac-like transposase has the sequence of SEQ ID NO: 14504 or SEQ ID NO: 14505, or a sequence at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identity to SEQ ID NO: 14504 or SEQ ID NO: 14505. In certain embodiments, the piggyBac or piggyBac-like transposon comprises a heterologous polynucleotide inserted between a pair of inverted repeats, where the transposon is capable of transposition by a piggyBac or piggyBac-like transposase having at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identity to SEQ ID NO: 14504 or SEQ ID NO: 14505. In certain embodiments, the transposon comprises two transposon ends, each of which comprises SEQ ID NO: 14510 in inverted orientations in the two transposon ends. In certain embodiments, each inverted terminal repeat (ITR) is at least 90% identical to SEQ ID NO: 14510.

    [0295] In certain embodiments, the piggyBac or piggyBac-like transposon is capable of insertion by a piggyBac or piggyBac-like transposase at the sequence 5′-TTAT-3 within a target nucleic acid. In certain embodiments, one end of the piggyBac or piggyBac-like transposon comprises at least 16 contiguous nucleotides from SEQ ID NO: 14506 and the other transposon end comprises at least 16 contiguous nucleotides from SEQ ID NO: 14507. In certain embodiments, one end of the piggyBac or piggyBac-like transposon comprises at least 17, at least 18, at least 19, at least 20, at least 22, at least 25, at least 30 contiguous nucleotides from SEQ ID NO: 14506 and the other transposon end comprises at least 17, at least 18, at least 19, at least 20, at least 22, at least 25, at least 30 contiguous nucleotides from SEQ ID NO: 14507.

    [0296] In certain embodiments, the piggyBac or piggyBac-like transposon comprises transposon ends (each end comprising an ITR) corresponding to SEQ ID NO: 14506 and SEQ ID NO: 14507, and has a target sequence corresponding to 5′-TTAT3′. In certain embodiments, the piggyBac or piggyBac-like transposon also comprises a sequence encoding a transposase (e.g. SEQ ID NO: 14505). In certain embodiments, the piggyBac or piggyBac-like transposon comprises one transposon end corresponding to SEQ ID NO: 14506 and a second transposon end corresponding to SEQ ID NO: 14516. SEQ ID NO: 14516 is very similar to SEQ ID NO: 14507, but has a large insertion shortly before the ITR. Although the ITR sequences for the two transposon ends are identical (they are both identical to SEQ ID NO: 14510), they have different target sequences: the second transposon has a target sequence corresponding to 5′-TTAA-3′, providing evidence that no change in ITR sequence is necessary to modify the target sequence specificity. The piggyBac or piggyBac-like transposase (SEQ ID NO: 14504), which is associated with the 5′-TTAA-3′ target site differs from the 5′-TTAT-3′-associated transposase (SEQ ID NO: 14505) by only 4 amino acid changes (D322Y, S473C, A507T, H582R). In certain embodiments, the piggyBac or piggyBac-like transposase (SEQ ID NO: 14504), which is associated with the 5′-TTAA-3′ target site is less active than the 5′-TTAT-3′-associated piggyBac or piggyBac-like transposase (SEQ ID NO: 14505) on the transposon with 5′-TTAT-3′ ends. In certain embodiments, piggyBac or piggyBac-like transposons with 5′-TTAA-3′ target sites can be converted to piggyBac or piggyBac-like transposases with 5′-TTAT-3 target sites by replacing 5′-TTAA-3′ target sites with 5′-TTAT-3′. Such transposons can be used either with a piggyBac or piggyBac-like transposase such as SEQ ID NO: 14504 which recognizes the 5′-TTAT-3′ target sequence, or with a variant of a transposase originally associated with the 5′-TTAA-3′ transposon. In certain embodiments, the high similarity between the 5′-TTAA-3′ and 5′-TTAT-3′ piggyBac or piggyBac-like transposases demonstrates that very few changes to the amino acid sequence of a piggyBac or piggyBac-like transposase alter target sequence specificity. In certain embodiments, modification of any piggyBac or piggyBac-like transposon-transposase gene transfer system, in which 5′-TTAA-3′ target sequences are replaced with 5′-TTAT-3′-target sequences, the ITRs remain the same, and the transposase is the original piggyBac or piggyBac-like transposase or a variant thereof resulting from using a low-level mutagenesis to introduce mutations into the transposase. In certain embodiments, piggyBac or piggyBac-like transposon transposase transfer systems can be formed by the modification of a 5′-TTAT-3′-active piggyBac or piggyBac-like transposon-transposase gene transfer systems in which 5′-TTAT-3′ target sequences are replaced with 5′-TTAA-3′-target sequences, the ITRs remain the same, and the piggyBac or piggyBac-like transposase is the original transposase or a variant thereof.

    [0297] In certain embodiments, the piggyBac or piggyBac-like transposon is isolated or derived from Bombyx mori. In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00065 (SEQ ID NO: 14577)   1 cccggcgagc atgaggcagg gtatctcata ccctggtaaa attttaaagt tgtgtatttt  61 ataaaatttt cgtctgacaa cactagcgcg ctcagtagct ggaggcagga gcgtgcggga 121 ggggatagtg gcgtgatcgc agtgtggcac gggacaccgg cgagatattc gtgtgcaaac 181 ctgtttcggg tatgttatac cctgcctcat tgttgacgta t.
    In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00066 (SEQ ID NO: 14578)   1 tttaagaaaa agattaataa ataataataa tttcataatt aaaaacttct ttcattgaat  61 gccattaaat aaaccattat tttacaaaat aagatcaaca taattgagta aataataata 121 agaacaatat tatagtacaa caaaatatgg gtatgtcata ccctgccaca ttcttgatgt 181 aacttttttt cacctcatgc tcgccggg.
    In certain embodiments, the transposon comprises at least 16 contiguous bases from SEQ ID NO: 14577 and at least 16 contiguous bases from SEQ ID NO: 14578, and inverted terminal repeats that are at least 87% identical to CCCGGCGAGCATGAGG (SEQ ID NO: 14510). In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00067 (SEQ ID NO: 14595)   1 cccggcgagc atgaggcagg gtatctcata ccctggtaaa attttaaagt tgtgtatttt  61 ataaaatttt cgtctgacaa cactagcgcg ctcagtagct ggaggcagga gcgtgcggga 121 ggggatagtg gcgtgatcgc agtgtggcac gggacaccgg cgagatattc gtgtgcaaac 181 ctgtttcggg tatgttatac cctgcctcat tgttgacgta ttttttttat gtaatttttc 241 cgattattaa tttcaactgt tttattggta tttttatgtt atccattgtt ctttttttat 301 gatttactgt atcggttgtc tttcgttcct ttagttgagt ttttttttat tattttcagt 361 ttttgatcaa a.
    In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00068 (SEQ ID NO: 14596)   1 tcatattttt agtttaaaaa aataattata tgttttataa tgaaaagaat ctcattatct  61 ttcagtatta ggttgattta tattccaaag aataatattt ttgttaaatt gttgattttt 121 gtaaacctct aaatgtttgt tgctaaaatt actgtgttta agaaaaagat taataaataa 181 taataatttc ataattaaaa acttctttca ttgaatgcca ttaaataaac cattatttta 241 caaaataaga tcaacataat tgagtaaata ataataagaa caatattata gtacaacaaa 301 atatgggtat gtcataccct gccacattct tgatgtaact ttttttcacc tcatgctcgc 361 cggg.

    [0298] In certain embodiments, the piggyBac or piggyBac-like transposon comprises SEQ ID NO: 14595 and SEQ ID NO: 14596, and is transposed by the piggyBac or piggyBac-like transposase of SEQ ID NO: 14505. In certain embodiments, the ITRs of SEQ ID NO: 14595 and SEQ ID: 14596 are not flanked by a 5′-TTAA-3′ sequence. In certain embodiments, the ITRs of SEQ ID NO: 14595 and SEQ ID: 14596 are flanked by a 5′-TTAT-3′ sequence.

    [0299] In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00069 (SEQ ID NO: 14597)   1 cccggcgagc atgaggcagg gtatctcata ccctggtaaa attttaaagt tgtgtatttt  61 ataaaatttt cgtctgacaa cactagcgcg ctcagtagct ggaggcagga gcgtgcggga 121 ggggatagtg gcgtgatcgc agtgtggcac gggacaccgg cgagatattc gtgtgcaaac 181 ctgtttcggg tatgttatac cctgcctcat tgttgacgta ttttttttat gtaatttttc 241 cgattattaa tttcaactgt tttattggta tttttatgtt atccattgtt ctttttttat 301 g.
    In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00070 (SEQ ID NO: 14598)   1 cagggtatct cataccctgg taaaatttta aagttgtgta ttttataaaa ttttcgtctg  61 acaacactag cgcgctcagt agctggaggc aggagcgtgc gggaggggat agtggcgtga 121 tcgcagtgtg gcacgggaca ccggcgagat attcgtgtgc aaacctgttt cgggtatgtt 181 ataccctgcc tcattgttga cgtatttttt ttatgtaatt tttccgatta ttaatttcaa 241 ctgttttatt ggtattttta tgttatccat tgttcttttt ttatg.
    In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00071 (SEQ ID NO: 14599)   1 cagggtatct cataccctgg taaaatttta aagttgtgta ttttataaaa ttttcgtctg  61 acaacactag cgcgctcagt agctggaggc aggagcgtgc gggaggggat agtggcgtga 121 tcgcagtgtg gcacgggaca ccggcgagat attcgtgtgc aaacctgttt cgggtatgtt 181 ataccctgcc tcattgttga cgtat.
    In certain embodiments, the left end of the piggyBac or piggyBac-like transposon comprises a sequence of SEQ ID NO: 14577, SEQ ID NO: 14595, or SEQ ID NOs: 14597-14599. In certain embodiments, the left end of the piggyBac or piggyBac-like transposon is preceded by a left target sequence.
    In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00072 (SEQ ID NO: 14600)   1 tcatattttt agtttaaaaa aataattata tgttttataa tgaaaagaat ctcattatct  61 ttcagtatta ggttgattta tattccaaag aataatattt ttgttaaatt gttgattttt 121 gtaaacctct aaatgtttgt tgctaaaatt actgtgttta agaaaaagat taataaataa 181 taataatttc ataattaaaa acttctttca ttgaatgcca ttaaataaac cattatttta 241 caaaataaga tcaacataat tgagtaaata ataataagaa caatattata gtacaacaaa 301 atatgggtat gtcataccct gccacattct tgatgtaact ttttttcacc tcatgctcgc 361 cggg.
    In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00073 (SEQ ID NO: 14601)   1 tttaagaaaa agattaataa ataataataa tttcataatt aaaaacttct ttcattgaat  61 gccattaaat aaaccattat tttacaaaat aagatcaaca taattgagta aataataata 121 agaacaatat tatagtacaa caaaatatgg gtatgtcata ccctgccaca ttcttgatgt 181 aacttttttt ca.
    In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00074 (SEQ ID NO: 14602)   1 cccggcgagc atgaggcagg gtatctcata ccctggtaaa attttaaagt tgtgtatttt  61 ataaaatttt cgtctgacaa cactagcgcg ctcagtagct ggaggcagga gcgtgcggga 121 ggggatagtg gcgtgatcgc agtgtggcac gggacaccgg cgagatattc gtgtgcaaac 181 ctgtttcggg tatgttatac cctgcctcat tgttgacgta ttttttttat gtaatttttc 241 cgattattaa tttcaactgt tttattggta tttttatgtt atccattgtt ctttttttat 301 gatttactgt atcggttgtc tttcgttcct ttagttgagt ttttttttat tattttcagt 361 ttttgatcaa a.

    [0300] In certain embodiments, the right end of the piggyBac or piggyBac-like transposon comprises a sequence of SEQ ID NO: 14578, SEQ ID NO: 14596, or SEQ ID NOs: 14600-14601. In certain embodiments, the right end of the piggyBac or piggyBac-like transposon is followed by a right target sequence. In certain embodiments, the transposon is transposed by the transposase of SEQ ID NO: 14505. In certain embodiments, the left and right ends of the piggyBac or piggyBac-like transposon share a 16 bp repeat sequence of SEQ ID NO: 14510 in inverted orientation and immediately adjacent to the target sequence. In certain embodiments, the left transposon end begins with SEQ ID NO: 14510, and the right transposon end ends with the reverse complement of SEQ ID NO: 14510, 5′-CCTCATGCTCGCCGGG-3′ (SEQ ID NO: 14603). In certain embodiments, the piggyBac or piggyBac-like transposon comprises an ITR with at least 93%, at least 87%, or at least 81% or any percentage in between identity to SEQ ID NO: 14510 or SEQ ID NO: 14603. In certain embodiments, the piggyBac or piggyBac-like transposon comprises a target sequence followed by a left transposon end comprising a sequence selected from SEQ ID NOs: 88, 105 or 107 and a right transposon end comprising SEQ ID NO: 14578 or 106 followed by a target sequence. in certain embodiments, the piggyBac or piggyBac like transposon comprises one end that comprises a sequence that is at least 90%, at least 95% or at least 99% or any percentage in between identical to SEQ ID NO: 14577 and one end that comprises a sequence that is at least 90%, at least 95% or at least 99% or any percentage in between identical to SEQ ID NO: 14578. In certain embodiments, one transposon end comprises at least 14, at least 16, at least 18 or at least 20 contiguous bases from SEQ ID NO: 14577 and one transposon end comprises at least 14, at least 16, at least 18 or at least 20 contiguous bases from SEQ ID NO: 14578.

    [0301] In certain embodiments, the piggyBac or piggyBac-like transposon comprises two transposon ends wherein each transposon ends comprises a sequence that is at least 81% identical, at least 87% identical or at least 93% identical or any percentage in between identical to SEQ ID NO: 14510 in inverted orientation in the two transposon ends. One end may further comprise at least 14, at least 16, at least 18 or at least 20 contiguous bases from SEQ ID NO: 14599, and the other end may further comprise at least 14, at least 16, at least 18 or at least 20 contiguous bases from SEQ ID NO: 14601. The piggyBac or piggyBac-like transposon may be transposed by the transposase of SEQ ID NO: 14505, and the transposase may optionally be fused to a nuclear localization signal.

    [0302] In certain embodiments, the piggyBac or piggyBac-like transposon comprises SEQ ID NO: 14595 and SEQ ID NO: 14596 and the piggyBac or piggyBac-like transposase comprises SEQ ID NO: 14504 or SEQ ID NO: 14505. In certain embodiments, the piggyBac or piggyBac-like transposon comprises SEQ ID NO: 14597 and SEQ ID NO: 14596 and the piggyBac or piggyBac-like transposase comprises SEQ ID NO: 14504 or SEQ ID NO: 14505. In certain embodiments, the piggyBac or piggyBac-like transposon comprises SEQ ID NO: 14595 and SEQ ID NO: 14578 and the piggyBac or piggyBac-like transposase comprises SEQ ID NO: 14504 or SEQ ID NO: 14505. In certain embodiments, the piggyBac or piggyBac-like transposon comprises SEQ ID NO: 14602 and SEQ ID NO: 14600 and the piggyBac or piggyBac-like transposase comprises SEQ ID NO: 14504 or SEQ ID NO: 14505.

    [0303] In certain embodiments, the piggyBac or piggyBac-like transposon comprises a left end comprising 1, 2, 3, 4, 5, 6, or 7 sequences selected from ATGAGGCAGGGTAT (SEQ ID NO: 14614), ATACCCTGCCTCAT (SEQ ID NO: 14615), GGCAGGGTAT (SEQ ID NO: 14616), ATACCCTGCC (SEQ ID NO: 14617), TAAAATTTTA (SEQ ID NO: 14618), ATTTTATAAAAT (SEQ ID NO: 14619), TCATACCCTG (SEQ ID NO: 14620) and TAAATAATAATAA (SEQ ID NO: 14621). In certain embodiments, the piggyBac or piggyBac-like transposon comprises a right end comprising 1, 2 or 3 sequences selected from SEQ ID NO: 14617, SEQ ID NO: 14620 and SEQ ID NO: 14621.

    [0304] In certain embodiments of the methods of the disclosure, the transposase enzyme is a piggyBac or piggyBac-like transposase enzyme. In certain embodiments, the piggyBac or piggyBac-like transposase enzyme is isolated or derived from Xenopus tropicalis. The piggyBac or piggyBac-like transposase enzyme may comprise or consist of an amino acid sequence at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:

    TABLE-US-00075 (SEQ ID NO: 14517)   1 MAKRFYSAEE AAAHCMASSS EEFSGSDSEY VPPASESDSS TEESWCSSST VSALEEPMEV  61 DEDVDDLEDQ EAGDRADAAA GGEPAWGPPC NFPPEIPPFT TVPGVKVDTS NFEPINFFQL 121 FMTEAILQDM VLYTNVYAEQ YLTQNPLPRY ARAHAWHPTD IAEMKRFVGL TLAMGLIKAN 181 SLESYWDTTT VLSIPVFSAT MSRNRYQLLL RFLHFNNNAT AVPPDQPGHD RLHKLRPLID 241 SLSERFAAVY TPCQNICIDE SLLLFKGRLQ FRQYIPSKRA RYGIKFYKLC ESSSGYTSYF 301 LIYEGKDSKL DPPGCPPDLT VSGKIVWELI SPLLGQGFHL YVDNFYSSIP LFTALYCLDT 361 PACGTINRNR KGLPRALLDK KLNRGETYAL RKNELLAIKF FDKKNVFMLT SIHDESVIRE 421 QRVGRPPKNK PLCSKEYSKY MGGVDRTDQL QHYYNATRKT RAWYKKVGIY LIQMALRNSY 481 IVYKAAVPGP KLSYYKYQLQ ILPALLFGGV EEQTVPEMPP SDNVARLIGK HFIDTLPPTP 541 GKQRPQKGCK VCRKRGIRRD TRYYCPKCPR NPGLCFKPCF EIYHTQLHY.

    [0305] In some embodiments, the piggyBac or piggyBac-like transposase is a hyperactive variant of SEQ ID NO: 14517. In certain embodiments, the piggyBac or piggyBac-like transposase is an integration defective variant of SEQ ID NO: 14517. The piggyBac or piggyBac-like transposase enzyme may comprise or consist of an amino acid sequence at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:

    TABLE-US-00076 (SEQ ID NO: 14518)   1 MAKRFYSAEE AAAHCMAPSS EEFSGSDSEY VPPASESDSS TEESWCSSST VSALEEPMEV  61 DEDVDDLEDQ EAGDRADAAA GGEPAWGPPC NFPPEIPPFT TVPGVKVDTS NFEPINFFQL 121 FMTEAILQDM VLYTNVYAEQ YLTQNPLPRY ARAHAWHPTD IAEMKRFVGL TLAMGLIKAN 181 SLESYWNTTT VLSIPVFSAT MSRNRYQLLL RFLHFNNNAT AVPPDQPDHD RLHKLRPLID 241 SLSERFAAVY TPCQNICIDE SLLLFKGRLR FRQYIPSKRA RYGIKFYKLC ESSSGYTSYF 301 LIYEGKDSKL DPPGCPPDLT VSGKIVWELI SPLLGQGFHL YVDNFYSSIP LFTALYCLDT 361 PACGTINRTR KGLPRALLDK KLNRGETYAL RKNELLAIKF FDKKNVFMLT SIHDESVIRE 421 QRVGRPPKNK PLCSKEYSKY MGGVDRTDQL QHYYNATRKT SAWYKKVGIY LIQMALRNSY 481 IVYKAAVPGP KLSYYKYQLQ ILPALLFGGV EEQTVPEMLP SDNVARLIGK HFIDTLPPTP 541 GKQRPQKGCK VCRKRGIRRD TRYYCPKCPR NPGLCFKPCF EIYHTQLHY.

    [0306] In certain embodiments, the piggyBac or piggyBac-like transposase is isolated or derived from Xenopus tropicalis. In certain embodiments, the piggyBac or piggyBac-like transposase is a hyperactive piggyBac or piggyBac-like transposase. In certain embodiments, the hyperactive piggyBac or piggyBac-like transposase comprises a sequence at least 90% identical to:

    TABLE-US-00077 (SEQ ID NO: 14572)   1 MAKRFYSAEE AAAHCSASSS EEFSGSDSEY VPPASESDSS TEESWCSSST VSALEEPMEV  61 DEDVDDLEDQ EAGDRADAAA GGEPAWGPPC NFPPEIPPFT TVPGVKVDTS NFEPINFFQL 121 FMTEAILQDM VLYTNVYAEQ YLTQNPLTRG ARAHAWHPTD IAEMKRFVGL TLAMGLIKAN 181 SIESYWDTTT VLSIPVFGAT MSRNRYQLLL RFLHFNNNAT AVPPDQPGHD RLHKLRPLID 241 SLSERFANVY TPCQNICIDE SLMLFKGRLQ FRQYIPSKRA RYGIKFYKLC ESSTGYTSYF 301 LIYEGKDSKL DPPGCPPDLT VSGKIVWELI SPLLGQGFHL YVDNFYSSIP LFTALYCLNT 361 PACGTINRNR KGLPRALLDK KLNRGETYAL RKNELLAIKF FDKKNVFMLT SIHDESVIRE 421 QRVGRPPKNK PLCSKEYSKY MGGVDRTDQL QHYYNATRKT RHWYKKVGIY LIQMALRNSY 481 IVYKAAVPGP KLSYYKYQLQ ILPALLFGGV EEQTVPEMPD SDNVARLIGK HFIDTLPPTP 541 GKQRPQKGCK VCRKRGIRRD TRYYCPKCPR NPGLCRKPCF EIYHTQLHY.

    [0307] In certain embodiments, piggyBac or piggyBac-like transposase is a hyperactive piggyBac or piggyBac-like transposase. A hyperactive piggyBac or piggyBac-like transposase is a transposase that is more active than the naturally occurring variant from which it is derived. In certain embodiments, a hyperactive piggyBac or piggyBac-like transposase is more active than the transposase of SEQ ID NO: 14517. In certain embodiments, the hyperactive piggyBac or piggyBac-like transposase comprises a sequence of:

    TABLE-US-00078 (SEQ ID NO: 14572)   1 MAKRFYSAEE AAAHCSASSS EEFSGSDSEY VPPASESDSS TEESWCSSST VSALEEPMEV  61 DEDVDDLEDQ EAGDRADAAA GGEPAWGPPC NFPPEIPPFT TVPGVKVDTS NFEPINFFQL 121 FMTEAILQDM VLYTNVYAEQ YLTQNPLTRG ARAHAWHPTD IAEMKRFVGL TLAMGLIKAN 181 SIESYWDTTT VLSIPVFGAT MSRNRYQLLL RFLHFNNNAT AVPPDQPGHD RLHKLRPLID 241 SLSERFANVY TPCQNICIDE SLMLFKGRLQ FRQYIPSKRA RYGIKFYKLC ESSTGYTSYF 301 LIYEGKDSKL DPPGCPPDLT VSGKIVWELI SPLLGQGFHL YVDNFYSSIP LFTALYCLNT 361 PACGTINRNR KGLPRALLDK KLNRGETYAL RKNELLAIKF FDKKNVFMLT SIHDESVIRE 421 QRVGRPPKNK PLCSKEYSKY MGGVDRTDQL QHYYNATRKT RHWYKKVGIY LIQMALRNSY 481 IVYKAAVPGP KLSYYKYQLQ ILPALLFGGV EEQTVPEMPD SDNVARLIGK HFIDTLPPTP 541 GKQRPQKGCK VCRKRGIRRD TRYYCPKCPR NPGLCRKPCF EIYHTQLHY.

    [0308] In certain embodiments, the hyperactive piggyBac or piggyBac-like transposase comprises a sequence of:

    TABLE-US-00079 (SEQ ID NO: 14624)   1 MAKRFYSAEE AAAHCMASSS EEFSGSDSEY VPPASESDSS TEESWCSSST VSALEEPMEV  61 DEDVDDLEDQ EAGDRADAAA GGEPAWGPPC NFPPEIPPFT TVPGVKVDTS NFEPINFFQL 121 FMTEAILQDM VLYTNVYAEQ YLTQNPLTRY ARAHAWHPTD IAEMKRFVGL TLAMGLIKAN 181 SLESYWDTTT VLSIPVFSAT MSRNRYQLLL RFLHFNNNAT AVPPDQPGHD RLHKLRPLID 241 SLSERFAAVY TPCQNICIDE SLLLFKGRLQ FRQYIPSKRA RYGIKFYKLC ESSSGYTSYF 301 LIYEGKDSKL DPPGCPPDLT VSGKIVWELI SPLLGQGFHL YVDNFYSSIP LFTALYCLNT 361 PACGTINRNR KGLPRALLDK KLNRGETYAL RKNELLAIKF FDKKNVFMLT SIHDESVIRE 421 QRVGRPPKNK PLCSKEYSKY MGGVDRTDQL QHYYNATRKT RHWYKKVGIY LIQMALRNSY 481 IVYKAAVPGP KLSYYKYQLQ ILPALLFGGV EEQTVPEMPP SDNVARLIGK HFIDTLPPTP 541 GKQRPQKGCK VCRKRGIRRD TRYYCPKCPR NPGLCRKPCF EIYHTQLHY.

    [0309] In certain embodiments, the hyperactive piggyBac or piggyBac-like transposase comprises a sequence of:

    TABLE-US-00080 (SEQ ID NO: 14625)   1 MAKRFYSAEE AAAHCMASSS EEFSGSDSEY VPPASESDSS TEESWCSSST VSALEEPMEV  61 DEDVDDLEDQ EAGDRADAAA GGEPAWGPPC NFPPEIPPFT TVPGVKVDTS NFEPINFFQL 121 FMTEAILQDM VLYTNVYAEQ YLTQNPLPRY ARAHAWHPTD IAEMKRFVGL TLAMGLIKAN 181 SLESYWDTTT VLKIPVFSAT MSRNRYQLLL RFLHFNNNAT AVPPDQPGHD RLHKLRPLID 241 SLSERFAAVY TPCQNICIDE SLLLFKGRLQ FRQYIPSKRA RYGIKFYKLC ESSSGYTSYF 301 LIYEGKDSKL DPPGCPPDLT VSGKIVWELI SPLLGQGFHL YVDNFYSSIP LFTALYCLNT 361 PACGTINRNR KGLPRALLDK KLNRGETYAL RKNELLAIKF FDKKNVFMLT SIHDESVIRE 421 QRVGRPPKNK PLCSKEYSKY MGGVDRTDQL QHYYNATRKT RHWYKKVGIY LIQMALRNSY 481 IVYKAAVPGP KLSYYKYQLQ ILPALLFGGV EEQTVPEMPP SDNVARLIGK HFIDTLPPTP 541 GKQRPQKGCK VCRKRGIRRD TRYYCPKCPR NPGLCFKPCF EIYHTQLHY.

    [0310] In certain embodiments, the hyperactive piggyBac or piggyBac-like transposase comprises a sequence of:

    TABLE-US-00081 (SEQ ID NO: 14627)   1 MAKRFYSAEE AAAHCMASSS EQTSGSDSEY VPPASESDSS TEESWCSSST VSALEEPMEV  61 DEDVDDLEDQ EAGDRADAAA GGEPAWGPPC NFPPEIPPFT TVPGVKVDTS NFEPINFFQL 121 FMTEAILQDM VLYTNVYAEQ YLTQNPLTRY ARAHAWHPTD IAEMKRFVGL TLAMGLIKAN 181 SIESYWDTTT VLSIPVFGAT MSRNRYQLLL RFLHFNNNAT AVPPDQPGHD RLHKLRPLID 241 SLSERFANVY TPCQNICIDE SLLLFKGRLQ FRQYIPSKRA RYGIKFYKLC ESSSGYTSYF 301 LIYEGKDSKL DPPGCPPDLT VSGKIVWELI SPLLGQGFHL YVDNFYSSIP LFTALYCLNT 361 PACGTINRNR KGLPRALLDK KLNRGETYAL RKNELLAIKF FDKKNVFMLT SIHDESVIRE 421 QRVGRKPKNK PLCSKEYSKY MGGVDRTDQL QHYYNATRKT RHWYKKVGIY LIQMALRNSY 481 IVYKAAVPGP KLSYYKYQLQ ILPALLFGGV EEQTVPEMPP SDNVARLIGK HFIDTLPPTP 541 GKQRPQKGCK VCRKRGIRRD TRYYCPKCPR NPGLCRKPCF EIYHTQLHY.

    [0311] In certain embodiments, the hyperactive piggyBac or piggyBac-like transposase comprises a sequence of:

    TABLE-US-00082 (SEQ ID NO: 14628)   1 MAKRFYSAEE AAAHCSASSS EEFSGSDSEY VPPASESDSS TEESWCSSST VSALEEPMEV  61 DEDVDDLEDQ EAGDRADAAA GGEPAWGPPC NFPPEIPPFT TVPGVKVDTS NFEPINFFQL 121 FMTEAILQDM VLYTNVYAEQ YLTQNPLTRG ARAHAWHPTD IAEMKRFVGL TLAMGLIKAN 181 SLESYWDTTT VLSIPVFGAT MSRNRYQLLL RFLHFNNNAT AVPPDQPGHD RLHKLRPLID 241 SLSERFANVY TPCQNICIDE SLMLFKGRLQ FRQYIPSKRA RYGIKFYKLC ESSTGYTSYF 301 LIYEGKDSKL DPPGCPPDLT VSGKIVWELI SPLLGQGFHL YVDNFYSSIP LFTALYCLNT 361 PACGTINRNR KGLPRALLDK KLNRGETYAL RKNELLAIKF FDKKNVFMLT SIHDESVIRE 421 QRVGRPPKNK PLCSKEYSKY MGGVDRTDQL QHYYNATRKT RHWYKKVGIY LIQMALRNSY 481 IVYKAAVPGP KLSYYKYQLQ ILPALLFGGV EEQTVPEMPP SDNVARLIGK HFIDTLPPTP 541 GKQRPQKGCK VCRKRGIRRD TRYYCPKCPR NPGLCRKPCF EIYHTQLHY.

    [0312] In certain embodiments, the hyperactive piggyBac or piggyBac-like transposase comprises a sequence of:

    TABLE-US-00083 (SEQ ID NO: 149)   1 MAKRFYSAEE AAAHCMASSS EEFSGSDSEY VPPASESDSS TEESWCSSST VSALEEPMEV  61 DEDVDDLEDQ EAGDRADAAA GGEPAWGPPC NFPPEIPPFT TVPGVKVDTS NFEPINFFQL 121 FMTEAILQDM VLYTNVYAEQ YLTQNPLTRY ARAHAWHPTD IAEMKRFVGL TLAMGLIKAN 181 SLESYWDTTT VLSIPVFGAT MSRNRYQLLL RFLHFNNNAT AVPPDQPGHD RLHKLRPLID 241 SLSERFANVY TPCQNICIDE SLLLFKGRLQ FRQYIPSKRA RYGIKFYKLC ESSSGYTSYF 301 LIYEGKDSKL DPPGCPPDLT VSGKIVWELI SPLLGQGFHL YVDNFYSSIP LFTALYCLNT 361 PACGTINRNR KGLPRALLDK KLNRGETYAL RKNELLAIKF FDKKNVFMLT SIHDESVIRE 421 QRVGRPPKNK PLCSKEYSKY MGGVDRTDQL QHYYNATRKT RHWYKKVGIY LIQMALRNSY 481 IVYKAAVPGP KLSYYKYQLQ ILPALLFGGV EEQTVPEMPP SDNVARLIGK HFIDTLPPTP 541 GKQRPQKGCK VCRKRGIRRD TRYYCPKCPR NPGLCRKPCF EIYHTQLHY.

    [0313] In certain embodiments, the hyperactive piggyBac or piggyBac-like transposase comprises an amino acid substitution at a position selected from amino acid 6, 7, 16, 19, 20, 21, 22, 23, 24, 26, 28, 31, 34, 67, 73, 76, 77, 88, 91, 141, 145, 146, 148, 150, 157, 162, 179, 182, 189, 192, 193, 196, 198, 200, 210, 212, 218, 248, 263, 270, 294, 297, 308, 310, 333, 336, 354, 357, 358, 359, 377, 423, 426, 428, 438, 447, 450, 462, 469, 472, 498, 502, 517, 520, 523, 533, 534, 576, 577, 582, 583 or 587 (relative to SEQ ID NO: 14517). In certain embodiments, the hyperactive piggyBac or piggyBac-like transposase comprises an amino acid substitution of Y6C, S7G, M165, S19G, 520Q, 520G, 520D, E21D, E22Q, F23T, F23P, S24Y, S26V, S28Q, V31K, A34E, L67A, G73H, A76V, D77N, P88A, N91D, Y141Q, Y141A, N145E, N145V, P146T, P146V, P146K, P148T, P148H, Y150G, Y1505, Y150C, H157Y, A162C, A179K, L182I, L182V, T189G, L192H, S193N, S193K, V196I, S198G, T200W, L210H, F212N, N218E, A248N, L263M, Q270L, S294T, T297M, 5308R, L310R, L333M, Q336M, A354H, C357V, L358F, D359N, L377I, V423H, P426K, K428R, S438A, T447G, T447A, L450V, A462H, A462Q, I469V, I472L, Q498M, L502V, E5171, P520D, P520G, N523S, 1533E, D534A, F576R, F576E, K5771, I582R, Y583F, L587Y or L587W, or any combination thereof including at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or all of these mutations (relative to SEQ ID NO: 14517).

    [0314] In certain embodiments, the hyperactive piggyBac or piggyBac-like transposase comprises one or more substitutions of an amino acid that is not wild type, wherein the one or more substitutions a for wild type amino acid comprises a substitution of A2X, K3X, R4X, FSX, Y6X, S7X, A11X, A13X, C15X, M16X, A17X, 518X, 519X, 520X, E21X, E22X, F23X, S24X, G25X, 26X, D27X, S28X, E29X, E42X, E43X, S44X, C46X, S47X, S48X, S49X, T50X, V51X, S52X, A53X, L54X, E55X, E56X, P57X, M58X, E59X, E62X, D63X, V64X, D65X, D66X, L67X, E68X, D69X, Q70X, E71X, A72X, G73X, D74X, R75X, A76X, D77X, A78X, A79X, A80X, G81X, G82X, E83X, P84X, A85X, W86X, G87X, P88X, P89X, C90X, N91X, F92X, P93X, E95X, I96X, P97X, P98X, F99X, T100X, T101X, P103X, G104X, V105X, K106X, V107X, D108X, T109X, N111X, P114X, Il 15X, N116X, F117X, F118X, Q119X, M122X, T123X, E124X, A125X, I126X, L127X, Q128X, D129X, M130X, L132X, Y133X, V126X, Y127X, A138X, E139X, Q140X, Y141X, L142X, Q144X, N145X, P146X, L147X, P148X, Y150X, A151X, A155X, H157X, P158X, I161X, A162X, V168X, T171X, L172X, A173X, M174X, I177X, A179X, L182X, D187X, T188X, T189X, T190X, L192X, S193X, I194X, P195X, V196X, S198X, A199X, T200X, S202X, L208X, L209X, L210X, R211X, F212X, F215X, N217X, N218X, A219X, T220X, A221X, V222X, P224X, D225X, Q226X, P227X, H229X, R231X, H233X, L235X, P237X, I239X, D240X, L242X, S243X, E244X, R244X, F246X, A247X, A248X, V249X, Y250X, T251X, P252X, C253X, Q254X, I256X, C257X, I258X, D259X, E260X, S261X, L262X, L263X, L264X, F265X, K266X, G267X, R268X, L269X, Q270X, F271X, R272X, Q273X, Y274X, I275X, P276X, S277X, K278X, R279X, A280X, R281X, Y282X, G283X, I284X, K285X, F286X, Y287X, K288X, L289X, C290X, E291X, S292X, S293XS294X, G295X, Y296X, T297X, S298X, Y299X, F300X, E304X, L310X, P313X, G314X, P316X, P317X, D318X, L319X, T320X, V321X, K324X, E328X, I330X, S331X, P332X, L333X, L334X, G335X, Q336X, F338X, L340X, D343X, N344X, F345X, Y346X, S347X, L351X, F352X, A354X, L355X, Y356X, C357X, L358X, D359X, T360X, R422X, Y423X, G424X, P426X, K428X, N429X, K430X, P431X, L432X, S434X, K435X, E436X, S438X, K439X, Y440X, G443X, R446X, T447X, L450X, Q451X, N455X, T460X, R461X, A462X, K465X, V467X, G468X, I469X, Y470X, L471X, I472X, M474X, A475X, L476X, R477X, S479X, Y480X, V482XY483X, K484X, A485X, A486X, V487X, P488X, P490X, K491X, S493X, Y494X, Y495X, K496X, Y497T, Q498X, L499X, Q500X, I501X, L502X, P503X, A504X, L505X, L506X, F507X, G508X, G509X, V510X, E511X, E512X, Q513X, T514X, V515X, E517X, M518X, P519X, P520X, S521X, D522X, N523X, V524X, A525X, L527X, I528X, K530X, H531X, F532X, I533X, D534X, T535X, L536X, T539X, P540X, Q546X, K550X, R553X, K554X, R555X, G556X, I557X, R558X, R559X, D560X, T561X, Y564X, P566X, K567X, P569X, R570X, N571X, L574X, C575X, F576X, K577X, P578X, F580X, E581X, I582X, Y583X, T585X, Q586X, L587X, H588X or Y589X (relative to SEQ ID NO: 14517). A list of hyperactive amino acid substitutions can be found in U.S. Pat. No. 10,041,077, the contents of which are incorporated by reference in their entirety.

    [0315] In certain embodiments, the piggyBac or piggyBac-like transposase is integration deficient. In certain embodiments, an integration deficient piggyBac or piggyBac-like transposase is a transposase that can excise its corresponding transposon, but that integrates the excised transposon at a lower frequency than a corresponding naturally occurring transposase. In certain embodiments, the piggyBac or piggyBac-like transposase is an integration deficient variant of SEQ ID NO: 14517. In certain embodiments, the integration deficient piggyBac or piggyBac-like transposase is deficient relative to SEQ ID NO: 14517.

    [0316] In certain embodiments, the piggyBac or piggyBac-like transposase is active for excision but deficient in integration. In certain embodiments, the integration deficient piggyBac or piggyBac-like transposase comprises a sequence that is at least 90% identical to a sequence of:

    TABLE-US-00084 (SEQ ID NO: 14605)   1 MAKRFYSAEE AAAHCMASSS EEFSGSDSEY VPPASESDSS TEESWCSSST VSALEEPMEV  61 DEDVDDLEDQ EAGDRVDAAA GGEPAWGPPC NFPPEIPPFT TVPGVKVDTS NFEPINFFQL 121 FMTEAILQDM VLYTNVYAEQ YLTQNPLPRY ARAHAWHPTD IAEMKRFVGL TLAMGLIKAN 181 SLESYWDTTT VLSIPVFSAT MSRNRYQLLL KFLHFNNEAT AVPPDQPGHD RLHKLRPLID 241 SLSERFAAVY TPCQNICIDE SLLLFKGRLQ FRQYIPSKRA RYGIKFYKLC ESSSGYTSYF 301 LIYEGKDSKL DPPGCPPDLT VSGKIVWELI SPLLGQGFHL YVDNFYSSIP LFTALYCLDT 361 PACGTINRNR KGLPRALLDK KLNRGETYAL RKNELLAIKF FDKKNVFMLT SIHDESVIRE 421 QRVGRPPKNK PLCSKEYSKY MGGVDRTDQL QHYYNATRKT RAWYKKVGIY LIQMALRNSY 481 IVYKAAVPGP KLSYYKYQLQ ILPALLFGGV EEQTVPEMPP SDNVARLIGK HFIDTLPPTP 541 GKQRPQKGCK VCRKRGIRRD TRYYCPKCPR NPGLCFKPCF EIYHTQLHYG RR.

    [0317] In certain embodiments, the integration deficient piggyBac or piggyBac-like transposase comprises a sequence that is at least 90% identical to a sequence of:

    TABLE-US-00085 (SEQ ID NO: 14604)   1 MAKRFYSAEE AAAHCMASSS EEFSGSDSEY VPPASESDSS TEESWCSSST VSALEEPMEV  61 DEDVDDLEDQ EAGDRADAAA GGEPAWGPPC NFPPEIPPFT TVPGVKVDTS NFEPINFFQL 121 FMTEAILQDM VLYTNVYAEQ YLTQVPLPRY ARAHAWHPTD IAEMKRFVGL TLAMGLIKAN 181 SLESYWDTTT VLNIPVFSAT MSRNRYQLLL RFLEFNNEAT AVPPDQPGHD RLHKLRPLID 241 SLSERFAAVY TPCQNICIDE SLLLFKGRLQ FRQYIPSKRA RYGIKFYKLC ESSSGYTSYF 301 LIYEGKDSKL DPPGCPPDLT VSGKIVWELI SPLLGQGFHL YVDNFYSSIP LFTALYCLDT 361 PACGTINRNR KGLPRALLDK KLNRGETYAL RKNELLAIKF FDKKNVFMLT SIHDESVIRE 421 QRVGRPPKNK PLCSKEYSKY MGGVDRTDQL QHYYNATRKT RAWYKKVGIY LIQMALRNSY 481 IVYKAAVPGP KLSYYKYQLQ ILPALLFGGV EEQTVPEMPP SDNVARLIGK HFIDTLPPTP 541 GKQRPQKGCK VCRKRGIRRD TRYYCPKCPR NPGLCFKPCF EIYHTQLHY.

    [0318] In certain embodiments, the integration deficient piggyBac or piggyBac-like transposase comprises a sequence that is at least 90% identical to a sequence of:

    TABLE-US-00086 (SEQ ID NO: 14611)   1 MAKRFYSAEE AAAHCMASSS EEFSGSDSEY VPPASESDSS TEESWCSSST VSALEEPMEV  61 DEDVDDLEDQ EAGDRADAAA GGEPAWGPPC NFPPEIPPFT TVPGVKVDTS NFEPINFFQL 121 FMTEAILQDM VLYTNVYAEQ YLTQNVLPRY ARAHAWHPTD IAEMKRFVGL TLAMGLIKAN 181 SLESYWDTTT VLSIPVFSAT MSRNRYQLLL RFLHFNNDAT AVPPDQPGHD RLHKLRPLID 241 SLTERFAAVY TPCQNICIDE SLLLFKGRLQ FRQYIPSKRA RYGIKFYKLC ESSSGYTSYF 301 LIYEGKDSKL DPPGCPPDLT VSGKIVWELI SPLLGQGFHL YVDNFYSSIP LFTALYCLDT 361 PACGTINRNR KGLPRALLDK KLNRGETYAL RKNELLAIKF FDKKNVFMLT SIHDESVIRE 421 QRVGRPPKNK PLCSKEYSKY MGGVDRTDQL QHYYNATRKT RAWYKKVGIY LIQMALRNSY 481 IVYKAAVPGP KLSYYKYQLQ ILPALLFGGV EEQTVPEMPP SDNVARLIGK HFIDTLPPTP 541 GKQRPQKGCK VCRKRGIRRD TRYYCPKCPR NPGLCFKPCF EIYHTQLHYG RR.

    [0319] In certain embodiments, the integration deficient piggyBac or piggyBac-like transposase comprises SEQ ID NO: 14611. In certain embodiments, the integration deficient piggyBac or piggyBac-like transposase comprises a sequence that is at least 90% identical to a sequence of:

    TABLE-US-00087 (SEQ ID NO: 14612)   1 MAKRFYSAEE AAAHCMASSS EEFSGSDSEY VPPASESDSS TEESWCSSST VSALEEPMEV  61 DEDVDDLEDQ EAGDRADAAP GGEPAWGPPC NFPPEIPPFT TVPGVKVDTS NFEPINFFQL 121 FMTEAILQDM VLYTNVYAEQ YLTQVPLPRY ARAHAWHPTD IAEMKRFVGL TLAMGLIKAN 181 SLESYWDTTT VLSIPVFSAT MSRNRYQLLL RFLHFNNEAT AVPPDQPGHD RLHKLRPLID 241 SLSERFAAVY TPCQNICIDE SLLLFKGRLQ FRQYIPSKRA RYGIKFYKLC ESSSGYTSYF 301 LIYEGKDSKL DPPGCPPDLT VSGKIVWELI SPLLGQGFHL YVDNFYSSIP LFTALYCLDT 361 PACGTINRNR KGLPRALLDK KLNRGETYAL RKNELLAIKF FDKKNVFMLT SIHDESVIRE 421 QRVGRPPKNK PLCSKEYSKY MGGVDRTDQL QHYYNATRKT RAWYKKVGIY LIQMALRNSY 481 IVYKAAVPGP KLSYYKYQLQ ILPALLFGGV EEQTVPEMPP SDNVARLIGK HFIDTLPPTP 541 GKQRPQKGCK VCRKRGIRRD TRYYCPKCPR NPGLCFKPCF EIYHTQLHYG RR.

    [0320] In certain embodiments, the integration deficient piggyBac or piggyBac-like transposase comprises SEQ ID NO: 14612. In certain embodiments, the integration deficient piggyBac or piggyBac-like transposase comprises a sequence that is at least 90% identical to a sequence of:

    TABLE-US-00088 (SEQ ID NO: 14613)   1 MAKRFYSAEE AAAHCMASSS EEFSGSDSEY VPPASESDSS TEESWCSSST VSALEEPMEV  61 DEDVDDLEDQ EAGDRADAAA GGEPAWGPPC NFPPEIPPFT TVPGVKVDTS NFEPINFFQL 121 FMTEAILQDM VLYTNVYAEQ YLTQVPLPRY ARAHAWHPTD IAEMKRFVGL TLAMGLIKAN 181 SLESYWDTTT VLNIPVFSAT MSRNRYQLLL RFLEFNNNAT AVPPDQPGHD RLHKLRPLID 241 SLSERFAAVY TPCQNICIDE SLLLFKGRLQ FRQYIPSKRA RYGIKFYKLC ESSSGYTSYF 301 LIYEGKDSKL DPPGCPPDLT VSGKIVWELI SPLLGQGFHL YVDNFYSSIP LFTALYCLDT 361 PACGTINRNR KGLPRALLDK KLNRGETYAL RKNELLAIKF FDKKNVFMLT SIHDESVIRE 421 QRVGRPPKNK PLCSKEYSKY MGGVDRTDQL QHYYNATRKT RAWYKKVGIY LIQMALRNSY 481 IVYKAAVPGP KLSYYKYQLQ ILPALLFGGV EEQTVPEMPP SDNVARLIGK HFIDTLPPTP 541 GKQRPQKGCK VCRKRGIRRD TRYYCPKCPR NPGLCFKPCF EIYHTQLHYG RR.

    [0321] In certain embodiments, the integration deficient piggyBac or piggyBac-like transposase comprises SEQ ID NO: 14613. In certain embodiments, the integration deficient piggyBac or piggyBac-like transposase comprises an amino acid substitution wherein the Asn at position 218 is replaced by a Glu or an Asp (N218D or N218E) (relative to SEQ ID NO: 14517).

    [0322] In certain embodiments, the excision competent, integration deficient piggyBac or piggyBac-like transposase comprises one or more substitutions of an amino acid that is not wild type, wherein the one or more substitutions a for wild type amino acid comprises a substitution of A2X, K3X, R4X, FSX, Y6X, S7X, ABX, E9X, E10X, A11X, A12X, A13X, H14X, C15X, M16X, A17X, 518X, 519X, 520X, E21X, E22X, F23X, S24X, G25X, 26X, D27X, S28X, E29X, V31X, P32X, P33X, A34X, 535X, E36X, S37X, D38X, S39X, 540X, T41X, E42X, E43X, S44X, W45X, C46X, S47X, S48X, S49X, T50X, V51X, S52X, A53X, L54X, E55X, E56X, P57X, M58X, E59X, V60X, M122X, T123X, E124X, A125X, L127X, Q128X, D129X, L132X, Y133X, V126X, Y127X, E139X, Q140X, Y141X, L142X, T143X, Q144X, N145X, P146X, L147X, P148X, R149X, Y150X, A151X, H154X, H157X, P158X, T159X, D160X, I161X, A162X, E163X, M164X, K165X, R166X, F167X, V168X, G169X, L170X, T171X, L172X, A173X, M174X, G175X, L176X, I177X, K178X, A179X, N180X, 5181X, L182X, 5184X, Y185X, D187X, T188X, T189X, T190X, V191X, L192X, 5193X, I194X, P195X, V196X, F197X, 5198X, A199X, T200X, M201X, 5202X, R203X, N204X, R205X, Y206X, Q207X, L208X, L209X, L210X, R211X, F212X, L213X, H241X, F215X, N216X, N217X, N218X, A219X, T220X, A221X, V222X, P223X, P224X, D225X, Q226X, P227X, G228X, H229X, D230X, R231X, H233X, K234X, L235X, R236X, L238X, I239X, D240X, L242X, S243X, E244X, R244X, F246X, A247X, A248X, V249X, Y250X, T251X, P252X, C253X, Q254X, N255X, I256X, C257X, I258X, D259X, E260X, S261X, L262X, L263X, L264X, F265X, K266X, G267X, R268X, L269X, Q270X, F271X, R272X, Q273X, Y274X, I275X, P276X, S277X, K278X, R279X, A280X, R281X, Y282X, G283X, I284X, K285X, F286X, Y287X, K288X, L289X, C290X, E291X, S292X, S293X, S294X, G295X, Y296X, T297X, S298X, Y299X, F300X, I302X, E304X, G305X, K306X, D307X, S308X, K309X, L310X, D311X, P312X, P313X, G314X, C315X, P316X, P317X, D318X, L319X, T320X, V321X, S322X, G323X, K324X, I325X, V326X, W327X, E328X, L329X, 1330X, S331X, P332X, L333X, L334X, G335X, Q336X, F338X, H339X, L340X, V342X, N344X, F345X, Y346X, S347X, S348X, I349X, L351X, T353X, A354X, Y356X, C357X, L358X, D359X, T360X, P361X, A362X, C363X, G364X, I366X, N367X, R368X, D369X, K371X, G372X, L373X, R375X, A376X, L377X, L378X, D379X, K380X, K381X, L382X, N383X, R384XG385X, T387X, Y388X, A389X, L390X, K392X, N393X, E394X, A397X, K399X, F400X, F401X, D402X, N405X, L406X, L409X, R422X, Y423X, G424X, E425X, P426X, K428X, N429X, K430X, P431X, L432X, S434X, K435X, E436X, S438X, K439X, Y440X, G442X, G443X, V444X, R446X, T447X, L450X, Q451X, H452X, N455X, T457X, R458X, T460X, R461X, A462X, Y464X, K465X, V467X, G468X, I469X, L471X, I472X, Q473X, M474X, L476X, R477X, N478X, S479X, Y480X, V482XY483X, K484X, A485X, A486X, V487X, P488X, G489X, P490X, K491X, L492X, S493X, Y494X, Y495X, K496X, Q498X, L499X, Q500X, I501X, L502X, P503X, A504X, L505X, L506X, F507X, G508X, G509X, V510X, E511X, E512X, Q513X, T514X, V515X, E517X, M518X, P519X, P520X, S521X, D522X, N523X, V524X, A525X, L527X, I528X, G529X, K530X, F532X, I533X, D534X, T535X, L536X, P537X, P538X, T539X, P540X, G541X, F542X, Q543X, R544X, P545X, Q546X, K547X, G548X, C549X, K550X, V551X, C552X, R553X, K554X, R555X, G556X, I557X, R558X, R559X, D560X, T561X, R562X, Y563X, Y564X, C565X, P566X, K567X, C568X, P569X, R570X, N571X, P572X, G573X, L574X, C575X, F576X, K577X, P578X, C579X, F580X, E581X, I582X, Y583X, H584X, T585X, Q586X, L587X, H588X or Y589X (relative to SEQ ID NO: 14517). A list of excision competent, integration deficient amino acid substitutions can be found in U.S. Pat. No. 10,041,077, the contents of which are incorporated by reference in their entirety.

    [0323] In certain embodiments, the piggyBac or piggyBac-like transposase is fused to a nuclear localization signal. In certain embodiments, SEQ ID NO: 14517 or SEQ ID NO: 14518 is fused to a nuclear localization signal. In certain embodiments, the amino acid sequence of the piggyBac or piggyBac like transposase fused to a nuclear localization signal is encoded by a polynucleotide sequence comprising:

    TABLE-US-00089 (SEQ ID NO: 14626)    1 atggcaccca aaaagaaacg taaagtgatg gccaaaagat tttacagcgc cgaagaagca   61 gcagcacatt gcatggcatc gtcatccgaa gaattctcgg ggagcgattc cgaatatgtc  121 ccaccggcct cggaaagcga ttcgagcact gaggagtcgt ggtgttcctc ctcaactgtc  181 tcggctcttg aggagccgat ggaagtggat gaggatgtgg acgacttgga ggaccaggaa  241 gccggagaca gggccgacgc tgccgcggga ggggagccgg cgtggggacc tccatgcaat  301 tttcctcccg aaatcccacc gttcactact gtgccgggag tgaaggtcga cacgtccaac  361 ttcgaaccga tcaatttctt tcaactcttc atgactgaag cgatcctgca agatatggtg  421 ctctacacta atgtgtacgc cgagcagtac ctgactcaaa acccgctgcc tcgctacgcg  481 agagcgcatg cgtggcaccc gaccgatatc gcggagatga agcggttcgt gggactgacc  541 ctcgcaatgg gcctgatcaa ggccaacagc ctcgagtcat actgggatac cacgactgtg  601 cttagcattc cggtgttctc cgctaccatg tcccgtaacc gctaccaact cctgctgcgg  661 ttcctccact tcaacaacaa tgcgaccgct gtgccacctg accagccagg acacgacaga  721 ctccacaagc tgcggccatt gatcgactcg ctgagcgagc gattcgccgc ggtgtacacc  781 ccttgccaaa acatttgcat cgacgagtcg cttctgctgt ttaaaggccg gcttcagttc  841 cgccagtaca tcccatcgaa gcgcgctcgc tatggtatca aattctacaa actctgcgag  901 tcgtccagcg gctacacgtc atacttcttg atctacgagg ggaaggactc taagctggac  961 ccaccggggt gtccaccgga tcttactgtc tccggaaaaa tcgtgtggga actcatctca 1021 cctctcctcg gacaaggctt tcatctctac gtcgacaatt tctactcatc gatccctctg 1081 ttcaccgccc tctactgcct ggatactcca gcctgtggga ccattaacag aaaccggaag 1141 ggtctgccga gagcactgct ggataagaag ttgaacaggg gagagactta cgcgctgaga 1201 aagaacgaac tcctcgccat caaattcttc gacaagaaaa atgtgtttat gctcacctcc 1261 atccacgacg aatccgtcat ccgggagcag cgcgtgggca ggccgccgaa aaacaagccg 1321 ctgtgctcta aggaatactc caagtacatg gggggtgtcg accggaccga tcagctgcag 1381 cattactaca acgccactag aaagacccgg gcctggtaca agaaagtcgg catctacctg 1441 atccaaatgg cactgaggaa ttcgtatatt gtctacaagg ctgccgttcc gggcccgaaa 1501 ctgtcatact acaagtacca gcttcaaatc ctgccggcgc tgctgttcgg tggagtggaa 1561 gaacagactg tgcccgagat gccgccatcc gacaacgtgg cccggttgat cggaaagcac 1621 ttcattgata ccctgcctcc gacgcctgga aagcagcggc cacagaaggg atgcaaagtt 1681 tgccgcaagc gcggaatacg gcgcgatacc cgctactatt gcccgaagtg cccccgcaat 1741 cccggactgt gtttcaagcc ctgttttgaa atctaccaca cccagttgca ttac.

    [0324] In certain embodiments, the piggyBac or piggyBac-like transposon is isolated or derived from Xenopus tropicalis. In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00090 (SEQ ID NO: 14519)   1 ttaacctttt tactgccaat gacgcatggg atacgtcgtg gcagtaaaag ggcttaaatg  61 ccaacgacgc gtcccatacg ttgttggcat tttaagtctt ctctctgcag cggcagcatg 121 tgccgccgct gcagagagtt tctagcgatg acagcccctc tgggcaacga gccggggggg 181 ctgtc.

    [0325] In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00091 (SEQ ID NO: 14520)   1 tttgcatttt tagacattta gaagcctata tcttgttaca gaattggaat tacacaaaaa  61 ttctaccata ttttgaaagc ttaggttgtt ctgaaaaaaa caatatattg ttttcctggg 121 taaactaaaa gtcccctcga ggaaaggccc ctaaagtgaa acagtgcaaa acgttcaaaa 181 actgtctggc aatacaagtt ccactttgac caaaacggct ggcagtaaaa gggttaa.

    [0326] In certain embodiments, the piggyBac or piggyBac-like transposon comprises SEQ ID NO: 14519 and SEQ ID NO: 14520. In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00092 (SEQ ID NO: 14521)   1 ttaacccttt gcctgccaat cacgcatggg atacgtcgtg gcagtaaaag ggcttaaatg  61 ccaacgacgc gtcccatacg ttgttggcat tttaagtctt ctctctgcag cggcagcatg 121 tgccgccgct gcagagagtt tctagcgatg acagcccctc tgggcaacga gccggggggg 181 ctgtc.

    [0327] In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00093 (SEQ ID NO: 14522)   1 tttgcatttt tagacattta gaagcctata tcttgttaca gaattggaat tacacaaaaa  61 ttctaccata ttttgaaagc ttaggttgtt ctgaaaaaaa caatatattg ttttcctggg 121 taaactaaaa gtcccctcga ggaaaggccc ctaaagtgaa acagtgcaaa acgttcaaaa 181 actgtctggc aatacaagtt ccactttggg acaaatcggc tggcagtgaa agggttaa.

    [0328] In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00094 (SEQ ID NO: 14523)   1 ttaacctttt tactgccaat gacgcatggg atacgtcgtg gcagtaaaag ggcttaaatg  61 ccaacgacgc gtcccatacg ttgttggcat tttaattctt ctctctgcag cggcagcatg 121 tgccgccgct gcagagagtt tctagcgatg acagcccctc tgggcaacga gccggggggg 181 ctgtc.

    [0329] In certain embodiments, the piggyBac or piggyBac-like transposon comprises SEQ ID NO: 14520 and SEQ ID NO: 14519, SEQ ID NO: 14521 or SEQ ID NO: 14523. In certain embodiments, the piggyBac or piggyBac-like transposon comprises SEQ ID NO: 14522 and SEQ ID NO: 14519, SEQ ID NO: 14521 or SEQ ID NO: 14523. In certain embodiments, the piggyBac or piggyBac-like transposon comprises one end comprising at least 14, 16, 18, 20, 30 or 40 contiguous nucleotides from SEQ ID NO: 14519, SEQ ID NO: 14521 or SEQ ID NO: 14523. In certain embodiments, the piggyBac or piggyBac-like transposon comprises one end comprising at least 14, 16, 18, 20, 30 or 40 contiguous nucleotides from SEQ ID NO: 14520 or SEQ ID NO: 14522. In certain embodiments, the piggyBac or piggyBac-like transposon comprises one end with at least 90% identity to SEQ ID NO: 14519, SEQ ID NO: 14521 or SEQ ID NO: 14523. In certain embodiments, the piggyBac or piggyBac-like transposon comprises one end with at least 90% identity to SEQ ID NO: 14520 or SEQ ID NO: 14522. In one embodiment, one transposon end is at least 90% identical to SEQ ID NO: 14519 and the other transposon end is at least 90% identical to SEQ ID NO: 14520.

    [0330] In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of TTAACCTTTTTACTGCCA (SEQ ID NO: 14524). In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of TTAACCCTTTGCCTGCCA (SEQ ID NO: 14526). In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of TTAACCYTTTTACTGCCA (SEQ ID NO: 14527). In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of TGGCAGTAAAAGGGTTAA (SEQ ID NO: 14529). In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of TGGCAGTGAAAGGGTTAA (SEQ ID NO: 14531). In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of TTAACCYTTTKMCTGCCA (SEQ ID NO: 14533). In certain embodiments, one end of the piggyBac or piggyBac-like transposon comprises a sequence selected from SEQ ID NO: 14524, SEQ ID NO: 14526 and SEQ ID NO: 14527. In certain embodiments, one end of the piggyBac™ (PB) or piggyBac-like transposon comprises a sequence selected from SEQ ID NO: 14529 and SEQ ID NO: 14531. In certain embodiments, each inverted terminal repeat of the piggyBac or piggyBac-like transposon comprises a sequence of ITR sequence of CCYTTTKMCTGCCA (SEQ ID NO: 14563). In certain embodiments, each end of the piggyBac™ (PB) or piggyBac-like transposon comprises SEQ ID NO: 14563 in inverted orientations. In certain embodiments, one ITR of the piggyBac or piggyBac-like transposon comprises a sequence selected from SEQ ID NO: 14524, SEQ ID NO: 14526 and SEQ ID NO: 14527. In certain embodiments, one ITR of the piggyBac or piggyBac-like transposon comprises a sequence selected from SEQ ID NO: 14529 and SEQ ID NO: 14531. In certain embodiments, the piggyBac or piggyBac like transposon comprises SEQ ID NO: 14533 in inverted orientation in the two transposon ends.

    [0331] In certain embodiments, The piggyBac or piggyBac-like transposon may have ends comprising SEQ ID NO: 14519 and SEQ ID NO: 14520 or a variant of either or both of these having at least 90% sequence identity to SEQ ID NO: 14519 or SEQ ID NO: 14520, and the piggyBac or piggyBac-like transposase has the sequence of SEQ ID NO: 14517 or a variant showing at least %, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between sequence identity to SEQ ID NO: 14517 or SEQ ID NO: 14518. In certain embodiments, one piggyBac or piggyBac-like transposon end comprises at least 14 contiguous nucleotides from SEQ ID NO: 14519, SEQ ID NO: 14521 or SEQ ID NO: 14523, and the other transposon end comprises at least 14 contiguous nucleotides from SEQ ID NO: 14520 or SEQ ID NO: 14522. In certain embodiments, one transposon end comprises at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 22, at least 25, at least 30 contiguous nucleotides from SEQ ID NO: 14519, SEQ ID NO: 14521 or SEQ ID NO: 14523, and the other transposon end comprises at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 22, at least 25 or at least 30 contiguous nucleotides from SEQ ID NO: 14520 or SEQ ID NO: 14522.

    [0332] In certain embodiments, the piggyBac or piggyBac-like transposase recognizes a transposon end with a left sequence corresponding to SEQ ID NO: 14519, and a right sequence corresponding to SEQ ID NO: 14520. It will excise the transposon from one DNA molecule by cutting the DNA at the 5′-TTAA-3′ sequence at the left end of one transposon end to the 5′-TTAA-3′ at the right end of the second transposon end, including any heterologous DNA that is placed between them, and insert the excised sequence into a second DNA molecule. In certain embodiments, truncated and modified versions of the left and right transposon ends will also function as part of a transposon that can be transposed by the piggyBac or piggyBac-like transposase. For example, the left transposon end can be replaced by a sequence corresponding to SEQ ID NO: 14521 or SEQ ID NO: 14523, the right transposon end can be replaced by a shorter sequence corresponding to SEQ ID NO: 14522. In certain embodiments, the left and right transposon ends share an 18 bp almost perfectly repeated sequence at their ends (5′-TTAACCYTTTKMCTGCCA: SEQ ID NO: 14533) that includes the 5′-TTAA-3′ insertion site, which sequence is inverted in the orientation in the two ends. That is in SEQ ID NO: 14519 and SEQ ID NO: 14523 the left transposon end begins with the sequence 5′-TTAACCTTTTTACTGCCA-3′ (SEQ ID NO: 14524), or in SEQ ID NO: 14521 the left transposon end begins with the sequence 5′-TTAACCCTTTGCCTGCCA-3′ (SEQ ID NO: 14526); the right transposon ends with approximately the reverse complement of this sequence: in SEQ ID NO: 14520 it ends 5′ TGGCAGTAAAAGGGTTAA-3′ (SEQ ID NO: 14529), in SEQ ID NO: 14522 it ends 5′-TGGCAGTGAAAGGGTTAA-3′ (SEQ ID NO: 14531.) One embodiment of the invention is a transposon that comprises a heterologous polynucleotide inserted between two transposon ends each comprising SEQ ID NO: 14533 in inverted orientations in the two transposon ends. In certain embodiments, one transposon end comprises a sequence selected from SEQ ID NOS: 14524, SEQ ID NO: 14526 and SEQ ID NO: 14527. In some embodiments, one transposon end comprises a sequence selected from SEQ ID NO: 14529 and SEQ ID NO: 14531.

    [0333] In certain embodiments, the piggyBac™ (PB) or piggyBac-like transposon is isolated or derived from Xenopus tropicalis. In certain embodiments, the piggyBac or piggyBac-like transposon comprises at a sequence of:

    TABLE-US-00095 (SEQ ID NO: 14573)  1 ccctttgcct gccaatcacg catgggatac gtcgtggcag taaaagggct taaatgccaa 61 cgacgcgtcc catacgtt.

    [0334] In certain embodiments, the piggyBac or piggyBac-like transposon comprises at a sequence of:

    TABLE-US-00096 (SEQ ID NO: 14574)  1 cctgggtaaa ctaaaagtcc cctcgaggaa aggcccctaa agtgaaacag tgcaaaacgt 61 tcaaaaactg tctggcaata caagttccac tttgggacaa atcggctggc agtgaaaggg.

    [0335] In certain embodiments, the piggyBac or piggyBac-like transposon comprises at least 16 contiguous bases from SEQ ID NO: 14573 or SEQ ID NO: 14574, and inverted terminal repeat of CCYTTTBMCTGCCA (SEQ ID NO: 14575).

    [0336] In certain embodiments, the piggyBac or piggyBac-like transposon comprises at a sequence of:

    TABLE-US-00097 (SEQ ID NO: 14579)   1 ccctttgcct gccaatcacg catgggatac gtcgtggcag taaaagggct taaatgccaa  61 cgacgcgtcc catacgttgt tggcatttta agtcttctct ctgcagcggc agcatgtgcc 121 gccgctgcag agagtttcta gcgatgacag cccctctggg caacgagccg ggggggctgt 181 c.

    [0337] In certain embodiments, the piggyBac or piggyBac-like transposon comprises at a sequence of:

    TABLE-US-00098 (SEQ ID NO: 14580)   1 cctttttact gccaatgacg catgggatac gtcgtggcag taaaagggct taaatgccaa  61 cgacgcgtcc catacgttgt tggcatttta attcttctct ctgcagcggc agcatgtgcc 121 gccgctgcag agagtttcta gcgatgacag cccctctggg caacgagccg ggggggctgt 181 c.

    [0338] In certain embodiments, the piggyBac or piggyBac-like transposon comprises at a sequence of:

    TABLE-US-00099 (SEQ ID NO: 14581)   1 cctttttact gccaatgacg catgggatac gtcgtggcag taaaagggct taaatgccaa  61 cgacgcgtcc catacgttgt tggcatttta agtcttctct ctgcagcggc agcatgtgcc 121 gccgctgcag agagtttcta gcgatgacag cccctctggg caacgagccg ggggggctgt 181 c.

    [0339] In certain embodiments, the piggyBac or piggyBac-like transposon comprises at a sequence of:

    TABLE-US-00100 (SEQ ID NO: 14582)   1 cctttttact gccaatgacg catgggatac gtcgtggcag taaaagggct taaatgccaa  61 cgacgcgtcc catacgttgt tggcatttta agtcttctct ctgcagcggc agcatgtgcc 121 gccgctgcag agag.

    [0340] In certain embodiments, the piggyBac or piggyBac-like transposon comprises at a sequence of:

    TABLE-US-00101 (SEQ ID NO: 14583)  1 cctttttact gccaatgacg catgggatac gtcgtggcag taaaagggct taaatgccaa 61 cgacgcgtcc catacgttgt tggcatttta agtctt.

    [0341] In certain embodiments, the piggyBac or piggyBac-like transposon comprises at a sequence of:

    TABLE-US-00102 (SEQ ID NO: 14584)  1 ccctttgcct gccaatcacg catgggatac gtcgtggcag taaaagggct taaatgccaa 61 cgacgcgtcc catacgttgt tggcatttta agtctt .

    [0342] In certain embodiments, the piggyBac or piggyBac-like transposon comprises at a sequence of:

    TABLE-US-00103 (SEQ ID NO: 14585)   1 ttatcctttt tactgccaat gacgcatggg atacgtcgtg gcagtaaaag ggcttaaatg  61 ccaacgacgc gtcccatacg ttgttggcat tttaagtctt ctctctgcag cggcagcatg 121 tgccgccgct gcagagagtt tctagcgatg acagcccctc tgggcaacga gccggggggg 181 ctgtc.

    [0343] In certain embodiments, the piggyBac or piggyBac-like transposon comprises at a sequence of:

    TABLE-US-00104 (SEQ ID NO: 14586)   1 tttgcatttt tagacattta gaagcctata tcttgttaca gaattggaat tacacaaaaa  61 ttctaccata ttttgaaagc ttaggttgtt ctgaaaaaaa caatatattg ttttcctggg 121 taaactaaaa gtcccctcga ggaaaggccc ctaaagtgaa acagtgcaaa acgttcaaaa 181 actgtctggc aatacaagtt ccactttggg acaaatcggc tggcagtgaa aggg.

    [0344] In certain embodiments, the piggyBac or piggyBac-like transposon comprises a left transposon end sequence selected from SEQ ID NO: 14573 and SEQ ID NOs: 14579-14585. In certain embodiments, the left transposon end sequence is preceded by a left target sequence. In certain embodiments, the piggyBac or piggyBac-like transposon comprises at a sequence of:

    TABLE-US-00105 (SEQ ID NO: 14587)   1 tttgcatttt tagacattta gaagcctata tcttgttaca gaattggaat tacacaaaaa  61 ttctaccata ttttgaaagc ttaggttgtt ctgaaaaaaa caatatattg ttttcctggg 121 taaactaaaa gtcccctcga ggaaaggccc ctaaagtgaa acagtgcaaa acgttcaaaa 181 actgtctggc aatacaagtt ccactttgac caaaacggct ggcagtaaaa ggg.

    [0345] In certain embodiments, the piggyBac or piggyBac-like transposon comprises at a sequence of:

    TABLE-US-00106 (SEQ ID NO: 14588)   1 ttgttctgaa aaaaacaata tattgttttc ctgggtaaac taaaagtccc ctcgaggaaa  61 ggcccctaaa gtgaaacagt gcaaaacgtt caaaaactgt ctggcaatac aagttccact 121 ttgaccaaaa cggctggcag taaaaggg.

    [0346] In certain embodiments, the piggyBac or piggyBac-like transposon comprises at a sequence of:

    TABLE-US-00107 (SEQ ID NO: 14589)   1 tttgcatttt tagacattta gaagcctata tcttgttaca gaattggaat tacacaaaaa  61 ttctaccata ttttgaaagc ttaggttgtt ctgaaaaaaa caatatattg ttttcctggg 121 taaactaaaa gtcccctcga ggaaaggccc ctaaagtgaa acagtgcaaa acgttcaaaa 181 actgtctggc aatacaagtt ccactttgac caaaacggct ggcagtaaaa gggttat.

    [0347] In certain embodiments, the piggyBac or piggyBac-like transposon comprises at a sequence of:

    TABLE-US-00108 (SEQ ID NO: 14590)   1 ttgttctgaa aaaaacaata tattgttttc ctgggtaaac taaaagtccc ctcgaggaaa  61 ggcccctaaa gtgaaacagt gcaaaacgtt caaaaactgt ctggcaatac aagttccact 121 ttgggacaaa tcggctggca gtgaaaggg.

    [0348] In certain embodiments, the piggyBac or piggyBac-like transposon comprises a right transposon end sequence selected from SEQ ID NO: 14574 and SEQ ID NOs: 14587-14590. In certain embodiments, the right transposon end sequence is followed by a right target sequence. In certain embodiments, the left and right transposon ends share a 14 repeated sequence inverted in orientation in the two ends (SEQ ID NO: 14575) adjacent to the target sequence. In certain embodiments, the piggyBac or piggyBac-like transposon comprises a left transposon end comprising a target sequence and a sequence that is selected from SEQ ID NOs: 14582-14584 and 14573, and a right transposon end comprising a sequence selected from SEQ ID NOs: 14588-14590 and 14574 followed by a right target sequence.

    [0349] In certain embodiments, the left transposon end of the piggyBac or piggyBac-like transposon comprises

    TABLE-US-00109  1 atcacgcatg ggatacgtcg tggcagtaaa agggcttaaa tgccaacgac gcgtcccata 61 cgtt
    (SEQ ID NO: 14591), and an ITR. In certain embodiments, the left transposon end comprises

    TABLE-US-00110  1 atgacgcatg ggatacgtcg tggcagtaaa agggcttaaa tgccaacgac gcgtcccata 61 cgttgttggc attttaagtc tt
    (SEQ ID NO: 14592) and an ITR. In certain embodiments, the right transposon end of the piggyBac or piggyBac-like transposon comprises

    TABLE-US-00111  1 cctgggtaaa ctaaaagtcc cctcgaggaa aggcccctaa agtgaaacag tgcaaaacgt 61 tcaaaaactg tctggcaata caagttccac tttgggacaa atcggc
    (SEQ ID NO: 14593) and an ITR. In certain embodiments, the right transposon end comprises

    TABLE-US-00112   1 ttgttctgaa aaaaacaata tattgttttc ctgggtaaac taaaagtccc ctcgaggaaa  61 ggcccctaaa gtgaaacagt gcaaaacgtt caaaaactgt ctggcaatac aagttccact 121 ttgaccaaaa cggc

    (SEQ ID NO: 14594) and an ITR.

    [0350] In certain embodiments, one transposon end comprises a sequence that is at least 90%, at least 95%, at least 99% or any percentage in between identical to SEQ ID NO: 14573 and the other transposon end comprises a sequence that is at least 90%, at least 95%, at least 99% or any percentage in between identical to SEQ ID NO: 14574. In certain embodiments, one transposon end comprises at least 14, at least 16, at least 18, at least 20 or at least 25 contiguous nucleotides from SEQ ID NO: 14573 and one transposon end comprises at least 14, at least 16, at least 18, at least 20 or at least 25 contiguous nucleotides from SEQ ID NO: 14574. In certain embodiments, one transposon end comprises at least 14, at least 16, at least 18, at least 20 from SEQ ID NO: 14591, and the other end comprises at least 14, at least 16, at least 18, at least 20 from SEQ ID NO: 14593. In certain embodiments, each transposon end comprises SEQ ID NO: 14575 in inverted orientations.

    [0351] In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence selected from of SEQ ID NO: 14573, SEQ ID NO: 14579, SEQ ID NO: 14581, SEQ ID NO: 14582, SEQ ID NO: 14583, and SEQ ID NO: 14588, and a sequence selected from SEQ ID NO: 14587, SEQ ID NO: 14588, SEQ ID NO: 14589 and SEQ ID NO: 14586 and the piggyBac or piggyBac-like transposase comprises SEQ ID NO: 14517 or SEQ ID NO: 14518.

    [0352] In certain embodiments, the piggyBac or piggyBac-like transposon comprises ITRs of CCCTTTGCCTGCCA (SEQ ID NO: 14622) (left ITR) and TGGCAGTGAAAGGG (SEQ ID NO: 14623) (right ITR) adjacent to the target sequences.

    [0353] In certain embodiments of the methods of the disclosure, the transposase enzyme is a piggyBac or piggyBac-like transposase enzyme. In certain embodiments, the piggyBac or piggyBac-like transposase enzyme is isolated or derived from Helicoverpa armigera. The piggyBac or piggyBac-like transposase enzyme may comprise or consist of an amino acid sequence at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:

    TABLE-US-00113 (SEQ ID NO: 14525)   1 MASRQRLNHD EIATILENDD DYSPLDSESE KEDCVVEDDV WSDNEDAIVD FVEDTSAQED  61 PDNNIASRES PNLEVTSLTS HRIITLPQRS IRGKNNHVWS TTKGRTTGRT SAINIIRTNR 121 GPTRMCRNIV DPLLCFQLFI TDEIIHEIVK WTNVEIIVKR QNLKDISASY RDINTMEIWA 181 LVGILTLTAV MKDNHLSTDE LFDATFSGTR YVSVMSRERF EFLIRCIRMD DKTLRPTLRS 241 DDAFLPVRKI WEIFINQCRQ NHVPGSNLTV DEQLLGFRGR CPFRMYIPNK PDKYGIKFPM 301 MCAAATKYMI DAIPYLGKST KTNGLPLGEF YVKDLTKTVH GTNRNITCDN WFTSIPLAKN 361 MLQAPYNLTI VGTIRSNKRE MPEEIKNSRS RPVGSSMFCF DGPLTLVSYK PKPSKMVFLL 421 SSCDENAVIN ESNGKPDMIL FYNQTKGGVD SFDQMCKSMS ANRKTNRWPM AVFYGMLNMA 481 FVNSYIIYCH NKINKQEKPI SRKEFMKKLS IQLTTPWMQE RLQAPTLKRT LRDNITNVLK 541 NVVPASSENI SNEPEPKKRR YCGVCSYKKR RMTKAQCCKC KKAICGEHNI DVCQDCI.

    [0354] In certain embodiments, the piggyBac or piggyBac-like transposon is isolated or derived from Helicoverpa armigera. In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00114 (SEQ ID NO: 14570)   1 ttaaccctag aagcccaatc tacgtaaatt tgacgtatac cgcggcgaaa tatctctgtc  61 tctttcatgt ttaccgtcgg atcgccgcta acttctgaac caactcagta gccattggga 121 cctcgcagga cacagttgcg tcatctcggt aagtgccgcc attttgttgt actctctatt 181 acaacacacg tcacgtcacg tcgttgcacg tcattttgac gtataattgg gctttgtgta 241 acttttgaat ttgtttcaaa ttttttatgt ttgtgattta tttgagttaa tcgtattgtt 301 tcgttacatt tttcatataa taataatatt ttcaggttga gtacaaa.

    [0355] 14570). In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00115 (SEQ ID NO: 14528)   1 agactgtttt tttctaagag acttctaaaa tattattacg agttgattta attttatgaa  61 aacatttaaa actagttgat tttttttata attacataat tttaagaaaa agtgttagag 121 gcttgatttt tttgttgatt ttttctaaga tttgattaaa gtgccataat agtattaata 181 aagagtattt tttaacttaa aatgtatttt atttattaat taaaacttca attatgataa 241 ctcatgcaaa aatatagttc attaacagaa aaaaatagga aaactttgaa gttttgtttt 301 tacacgtcat ttttacgtat gattgggctt tatagctagt taaatatgat tgggcttcta 361 gggttaa .

    [0356] in certain embodiments of the methods of the disclosure, the transposase enzyme is a piggyBac or piggyBac-like transposase enzyme. In certain embodiments, the piggyBac or piggyBac-like transposase enzyme is isolated or derived from Pectinophora gossypiella. The piggyBac or piggyBac-like transposase enzyme may comprise or consist of an amino acid sequence at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:

    TABLE-US-00116 (SEQ ID NO: 14530)   1 MDLRKQDEKI RQWLEQDIEE DSKGESDNSS SETEDIVEME VHKNTSSESE VSSESDYEPV  61 CPSKRQRTQI IESEESDNSE SIRPSRRQTS RVIDSDETDE DVMSSTPQNI PRNPNVIQPS 121 SRFLYGKNKH KWSSAAKPSS VRTSRRNIIH FIPGPKERAR EVSEPIDIFS LFISEDMLQQ 181 VVTFTNAEML IRKNKYKTET FTVSPTNLEE IRALLGLLFN AAAMKSNHLP TRMLFNTHRS 241 GTIFKACMSA ERLNFLIKCL RFDDKLTRNV RQRDDRFAPI RDLWQALISN FQKWYTPGSY 301 ITVDEQLVGF RGRCSFRMYI PNKPNKYGIK LVMAADVNSK YIVNAIPYLG KGTDPQNQPL 361 ATFFIKEITS TLHGTNRNIT MDNWFTSVPL ANELLMAPYN LTLVGTLRSN KREIPEKLKN 421 SKSRAIGTSM FCYDGDKTLV SYKAKSNKVV FILSTIHDQP DINQETGKPE MIHFYNSTKG 481 AVDTVDQMCS SISTNRKTQR WPLCVFYNML NLSIINAYVV YVYNNVRNNK KPMSRRDFVI 541 KLGDQLMEPW LRQRLQTVTL RRDIKVMIQD ILGESSDLEA PVPSVSNVRK IYYLCPSKAR 601 RMTKHRCIKC KQAICGPHNI DICSRCIE.

    [0357] In certain embodiments, the piggyBac or piggyBac-like transposon is isolated or derived from Pectinophora gossypiella. In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00117 (SEQ ID NO: 14532)   1 ttaaccctag ataactaaac attcgtccgc tcgacgacgc gctatgccgc gaaattgaag  61 tttacctatt attccgcgtc ccccgccccc gccgcttttt ctagcttcct gatttgcaaa 121 atagtgcatc gcgtgacacg ctcgaggtca cacgacaatt aggtcgaaag ttacaggaat 181 ttcgtcgtcc gctcgacgaa agtttagtaa ttacgtaagt ttggcaaagg taagtgaatg 241 aagtattttt ttataattat tttttaattc tttatagtga taacgtaagg tttatttaaa 301 tttattactt ttatagttat ttagccaatt gttataaatt ccttgttatt gctgaaaaat 361 ttgcctgttt tagtcaaaat ttattaactt ttcgatcgtt ttttag.

    [0358] In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00118 (SEQ ID NO: 14571)   1 tttcactaag taattttgtt cctatttagt agataagtaa cacataatta ttgtgatatt  61 caaaacttaa gaggtttaat aaataataat aaaaaaaaaa tggtttttat ttcgtagtct 121 gctcgacgaa tgtttagtta ttacgtaacc gtgaatatag tttagtagtc tagggttaa.

    [0359] In certain embodiments of the methods of the disclosure, the transposase enzyme is a piggyBac or piggyBac-like transposase enzyme. In certain embodiments, the piggyBac or piggyBac-like transposase enzyme is isolated or derived from Ctenoplusia agnata. The piggyBac or piggyBac-like transposase enzyme may comprise or consist of an amino acid sequence at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:

    TABLE-US-00119 (SEQ ID NO: 14534)   1 MASRQHLYQD EIAAILENED DYSPHDTDSE MEDCVTQDDV RSDVEDEMVD NIGNGTSPAS  61 RHEDPETPDP SSEASNLEVT LSSHRIIILP QRSIREKNNH IWSTTKGQSS GRTAAINIVR 121 TNRGPTRMCR NIVDPLLCFQ LFIKEEIVEE IVKWTNVEMV QKRVNLKDIS ASYRDTNEME 181 IWAIISMLTL SAVMKDNHLS TDELFNVSYG TRYVSVMSRE RFEFLLRLLR MGDKLLRPNL 241 RQEDAFTPVR KIWEIFINQC RLNYVPGTNL TVDEQLLGFR GRCPFRMYIP NKPDKYGIKF 301 PMVCDAATKY MVDAIPYLGK STKTQGLPLG EFYVKELTQT VHGTNRNVTC DNWFTSVPLA 361 KSLLNSPYNL TLVGTIRSNK REIPEEVKNS RSRQVGSSMF CFDGPLTLVS YKPKPSKMVF 421 LLSSCNEDAV VNQSNGKPDM ILFYNQTKGG VDSFDQMCSS MSTNRKTNRW PMAVFYGMLN 481 MAFVNSYIIY CHNMLAKKEK PLSRKDFMKK LSTDLTTPSM QKRLEAPTLK RSLRDNITNV 541 LKIVPQAAID TSFDEPEPKK RRYCGFCSYK KKRMTKTQCF KCKKPVCGEH NIDVCQDCI.

    [0360] In certain embodiments, the piggyBac or piggyBac-like transposon is isolated or derived from Ctenoplusia agnata. In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00120 (SEQ ID NO: 14535)   1 ttaaccctag aagcccaatc tacgtcattc tgacgtgtat gtcgccgaaa atactctgtc  61 tctttctcct gcacgatcgg attgccgcga acgctcgatt caacccagtt ggcgccgaga 121 tctattggag gactgcggcg ttgattcggt aagtcccgcc attttgtcat agtaacagta 181 ttgcacgtca gcttgacgta tatttgggct ttgtgttatt tttgtaaatt ttcaacgtta 241 gtttattatt gcatcttttt gttacattac tggtttattt gcatgtatta ctcaaatatt 301 atttttattt tagcgtagaa aataca.

    [0361] In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00121 (SEQ ID NO: 14536)   1 agactgtttt ttttgtattt gcattatata     ttatattcta aagttgattt aattctaaga  61 aaaacattaa aataagtttc tttttgtaaa     atttaattaa ttataagaaa aagtttaagt 121 tgatctcatt ttttataaaa atttgcaatg     tttccaaagt tattattgta aaagaataaa 181 taaaagtaaa ctgagtttta attgatgttt     tattatatca ttatactata tattacttaa 241 ataaaacaat aactgaatgt atttctaaaa     ggaatcacta gaaaatatag tgatcaaaaa 301 tttacacgtc atttttgcgt atgattgggc     tttataggtt ctaaaaatat gattgggcct 361 ctagggttaa.

    [0362] In certain embodiments, the piggyBac or piggyBac-like transposon comprises an ITR sequence of CCCTAGAAGCCCAATC (SEQ ID NO: 14564).

    [0363] In certain embodiments of the methods of the disclosure, the transposase enzyme is a piggyBac or piggyBac-like transposase enzyme. In certain embodiments, the piggyBac or piggyBac-like transposase enzyme is isolated or derived from Agrotis ipsilon. The piggyBac (PB) or piggyBac-like transposase enzyme may comprise or consist of an amino acid sequence at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:

    TABLE-US-00122 (SEQ ID NO: 14537)   1 MESRQRLNQD EIATILENDD DYSPLDSDSE     AEDRVVEDDV WSDNEDAMID YVEDTSRQED  61 PDNNIASQES ANLEVTSLTS HRIISLPQRS     ICGKNNHVWS TTKGRTTGRT SAINIIRTNR 121 GPTRMCRNIV DPLLCFQLFI TDEIIHEIVK     WTNVEMIVKR QNLIDISASY RDTNTMEMWA 181 LVGILTLTAV MKDNHLSTDE LFDATFSGTR     YVSVMSRERF EFLIRCMRMD DKTLRPTLRS 241 DDAFIPVRKL WEIFINQCRL NYVPGGNLTV     DEQLLGFRGR CPFRMYIPNK PDKYGIRFPM 301 MCDAATKYMI DAIPYLGKST KTNGLPLGEF     YVKELTKTVH GTNRNVTCDN WFTSIPLAKN 361 MLQAPYNLTI VGTIRSNKRE IPEEIKNSRS     RPVGSSMFCF DGPLTLVSYK PKPSRMVFLL 421 SSCDENAVIN ESNGKPDMIL FYNQTKGGVD     SFDQMCKSMS ANRKTNRWPM AVFYGMLNMA 481 FVNSYIIYCH NKINKQKKPI NRKEFMKNLS     TDLTTPWMQE RLKAPTLKRT LRDNITNVLK 541 NVVPPSPANN SEEPGPKKRS YCGFCSYKKR     RMTKTQFYKC KKAICGEHNI DVCQDCV.

    [0364] In certain embodiments, the piggyBac or piggyBac-like transposon is isolated or derived from Agrotis ipsilon. In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00123 (SEQ ID NO: 14538)   1 ttaaccctag aagcccaatc tacgtaaatt     tgacgtatac cgcggcgaaa tatatctgtc  61 tctttcacgt ttaccgtcgg attcccgcta     acttcggaac caactcagta gccattgaga 121 actcccagga cacagttgcg tcatctcggt     aagtgccgcc attttgttgt aatagacagg 181 ttgcacgtca ttttgacgta taattgggct     ttgtgtaact tttgaaatta tttataattt 241 ttattgatgt gatttatttg agttaatcgt     attgtttcgt tacatttttc atatgatatt 301 aatattttca gattgaatat aaa.

    [0365] In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00124 (SEQ ID NO: 14539)   1 agactgtttt ttttaaaagg cttataaagt     attactattg cgtgatttaa ttttataaaa  61 atatttaaaa ccagttgatt tttttaataa     ttacctaatt ttaagaaaaa atgttagaag 121 cttgatattt ttgttgattt ttttctaaga     tttgattaaa aggccataat tgtattaata 181 aagagtattt ttaacttcaa atttatttta     tttattaatt aaaacttcaa ttatgataat 241 acatgcaaaa atatagttca tcaacagaaa     aatataggaa aactctaata gttttatttt 301 tacacgtcat ttttacgtat gattgggctt     tatagctagt caaatatgat tgggcttcta 361 gggttaa.

    [0366] In certain embodiments of the methods of the disclosure, the transposase enzyme is a piggyBac or piggyBac-like transposase enzyme. In certain embodiments, the piggyBac or piggyBac-like transposase enzyme is isolated or derived from Megachile rotundata. The piggyBac (PB) or piggyBac-like transposase enzyme may comprise or consist of an amino acid sequence at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:

    TABLE-US-00125 (SEQ ID NO: 14540)   1 MNGKDSLGEF YLDDLSDCLD CRSASSTDDE     SDSSNIAIRK RCPIPLIYSD SEDEDMNNNV  61 EDNNHFVKES NRYHYQIVEK YKITSKTKKW     KDVTVTEMKK FLGLIILMGQ VKKDVLYDYW 121 STDPSIETPF FSKVMSRNRF LQIMQSWHFY     NNNDISPNSH RLVKIQPVID YFKEKFNNVY 181 KSDQQLSLDE CLIPWRGRLS IKTYNPAKIT     KYGILVRVLS EARTGYVSNF CVYAADGKKI 241 EETVLSVIGP YKNMWHHVYQ DNYYNSVNIA     KIFLKNKLRV CGTIRKNRSL PQILQTVKLS 301 RGQHQFLRNG HTLLEVWNNG KRNVNMISTI     HSAQMAESRN RSRTSDCPIQ KPISIIDYNK 361 YMKGVDRADQ YLSYYSIFRK TKKWTKRVVM     FFINCALFNS FKVYTTLNGQ KITYKNFLHK 421 AALSLIEDCG TEEQGTDLPN SEPTTTRTTS     RVDHPGRLEN FGKHKLVNIV TSGQCKKPLR 481 QCRVCASKKK LSRTGFACKY CNVPLHKGDC     FERYHSLKKY.

    [0367] In certain embodiments, the piggyBac or piggyBac-like transposon is isolated or derived from Megachile rotundata. In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00126 (SEQ ID NO: 14541)   1 ttaaataatg cccactctag atgaacttaa     cactttaccg accggccgtc gattattcga  61 cgtttgctcc ccagcgctta ccgaccggcc     atcgattatt cgacgtttgc ttcccagcgc 121 ttaccgaccg gtcatcgact tttgatcttt     ccgttagatt tggttaggtc agattgacaa 181 gtagcaagca tttcgcattc tttattcaaa     taatcggtgc ttttttctaa gctttagccc 241 ttagaa.

    [0368] In certain embodiments, the the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00127 (SEQ ID NO: 14542)   1 acaacttctt ttttcaacaa atattgttat     atggattatt tatttattta tttatttatg  61 gtatatttta tgtttattta tttatggtta     ttatggtata ttttatgtaa ataataaact 121 gaaaacgatt gtaatagatg aaataaatat     tgttttaaca ctaatataat taaagtaaaa 181 gattttaata aatttcgtta ccctacaata     acacgaagcg tacaatttta ccagagttta 241 ttaa.

    [0369] In certain embodiments of the methods of the disclosure, the transposase enzyme is a piggyBac or piggyBac-like transposase enzyme. In certain embodiments, the piggyBac or piggyBac-like transposase enzyme is isolated or derived from Bombus impatiens. The piggyBac (PB) or piggyBac-like transposase enzyme may comprise or consist of an amino acid sequence at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:

    TABLE-US-00128 (SEQ ID NO: 14543)   1 MNEKNGIGEF YLDDLSDCPD SYSRSNSGDE     SDGSDTIIRK RGSVLPPRYS DSEDDEINNV  61 EDNANNVENN DDIWSTNDEA IILEPFEGSP     GLKIMPSSAE SVTDNVNLFF GDDFFEHLVR 121 ESNRYHYQVM EKYKIPSKAK KWTDITVPEM     KKFLGLIVLM GQIKKDVLYD YWSTDPSIET 181 PFFSQVMSRN RFVQIMQSWH FCNNDNIPHD     SHRLAKIQPV IDYFRRKFND VYKPCQQLSL 241 DESIIPWRGR LSIKTYNPAK ITKYGILVRV     LSEAVTGYVC NFDVYAADGK KLEDTAVIEP 301 YKNIWHQIYQ DNYYNSVKMA RILLKNKVRV     CGTIRKNRGL PRSLKTIQLS RGQYEFRRNH 361 QILLEVWNNG RRNVNMISTI HSAQLMESRS     KSKRSDVPIQ KPNSIIDYNK YMKGVDRADQ 421 YLAYYSIFRK TKKWTKRVVM FFINCALFNS     FRVYTILNGK NITYKNFLHK VAVSWIEDGE 481 TNCTEQDDNL PNSEPTRRAP RLDHPGRLSN     YGKHKLINIV TSGRSLKPQR QCRVCAVQKK 541 RSRTCFVCKF CNVPLHKGDC FERYHTLKKY.

    [0370] In certain embodiments, the piggyBac or piggyBac-like transposon is isolated or derived from Bombus impatiens. In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00129 (SEQ ID NO: 14544)   1 ttaatttttt aacattttac cgaccgatag     ccgattaatc gggtttttgc cgctgacgct  61 taccgaccga taacctatta atcggctttt     tgtcgtcgaa gcttaccaac ctatagccta 121 cctatagtta atcggttgcc atggcgataa     acaatctttc tcattatatg agcagtaatt 181 tgttatttag tactaaggta ccttgctcag     ttgcgtcagt tgcgttgctt tgtaagctcc 241 cacagtttta taccaattcg aaaaacttac     cgttcgcg.

    [0371] In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00130 (SEQ ID NO: 14545)   1 actatttcac atttgaacta aaaaccgttg     taatagataa aataaatata atttagtatt  61 aatattatgg aaacaaaaga ttttattcaa     tttaattatc ctatagtaac aaaaagcggc 121 caattttatc tgagcatacg aaaagcacag     atactcccgc ccgacagtct aaaccgaaac 181 agagccggcg ccagggagaa tctgcgcctg     agcagccggt cggacgtgcg tttgctgttg 241 aaccgctagt ggtcagtaaa ccagaaccag     tcagtaagcc agtaactgat cagttaacta 301 gattgtatag ttcaaattga acttaatcta     gtttttaagc gtttgaatgt tgtctaactt 361 cgttatatat tatattcttt ttaa.

    [0372] In certain embodiments of the methods of the disclosure, the transposase enzyme is a piggyBac or piggyBac-like transposase enzyme. In certain embodiments, the piggyBac or piggyBac-like transposase enzyme is isolated or derived from Mamestra brassicae. The piggyBac (PB) or piggyBac-like transposase enzyme may comprise or consist of an amino acid sequence at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:

    TABLE-US-00131 (SEQ ID NO: 14546)   1 MFSFVPNKEQ TRTVLIFCFH LKTTAAESHR     PLVEAFGEQV PTVKTCERWF QRFKSGDFDV  61 DDKEHGKPPK RYEDAELQAL LDEDDAQTQK     QLAEQLEVSQ QAVSNRLREG GKIQKVGRWV 121 PHELNERQRE RRKNTCEILL SRYKRKSFLH     RIVTGEEKWI FFVNPKRKKS YVDPGQPATS 181 TARPNRFGKK TRLCVWWDQS GVIYYELLKP     GETVNTARYQ QQLINLNRAL QRKRPEYQKR 241 QHRVIFLHDN APSHTARAVR DTLETLNWEV     LPHAAYSPDL APSDYHLFAS MGHALAEQRF 301 DSYESVEEWL DEWFAAKDDE FYWRGIHKLP     ERWDNCVASD GKYFE.

    [0373] In certain embodiments, the piggyBac or piggyBac-like transposon is isolated or derived from Mamestra brassicae. In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00132 (SEQ ID NO: 14547)   1 ttattgggtt gcccaaaaag taattgcgga     tttttcatat acctgtcttt taaacgtaca  61 tagggatcga actcagtaaa actttgacct     tgtgaaataa caaacttgac tgtccaacca 121 ccatagtttg gcgcgaattg agcgtcataa     ttgttttgac tttttgcagt caac.

    [0374] In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00133 (SEQ ID NO: 14548)  1 atgatttttt ctttttaaac caattttaat    tagttaattg atataaaaat ccgcaattac 61 tttttgggca acccaataa.

    [0375] In certain embodiments of the methods of the disclosure, the transposase enzyme is a piggyBac or piggyBac-like transposase enzyme. In certain embodiments, the piggyBac or piggyBac-like transposase enzyme is isolated or derived from Mayetiola destructor. The piggyBac (PB) or piggyBac-like transposase enzyme may comprise or consist of an amino acid sequence at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:

    TABLE-US-00134 (SEQ ID NO: 14549)   1 MENFENWRKR RHLREVLLGH FFAKKTAAES     HRLLVEVYGE HALAKTQCFE WFQRFKSGDF  61 DTEDKERPGQ PKKFEDEELE ALLDEDCCQT     QEELAKSLGV TQQAISKRLK AAGYIQKQGN 121 WVPHELKPRD VERRFCMSEM LLQRHKKKSF     LSRIITGDEK WIHYDNSKRK KSYVKRGGRA 181 KSTPKSNLHG AKVMLCIWWD QRGVLYYELL     EPGQTITGDL YRTQLIRLKQ ALAEKRPEYA 241 KRHGAVIFHH DNARPHVALP VKNYLENSGW     EVLPHPPYSP DLAPSDYHLF RSMQNDLAGK 301 RFTSEQGIRK WLDSFLAAKP AKFFEKGIHE     LSERWEKVIA SDGQYFE.

    [0376] In certain embodiments, the piggyBac or piggyBac-like transposon is isolated or derived from Mayetiola destructor. In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00135 (SEQ ID NO: 14550)   1 taagacttcc aaaatttcca cccgaacttt     accttccccg cgcattatgt ctctcttttc  61 accctctgat ccctggtatt gttgtcgagc     acgatttata ttgggtgtac aacttaaaaa 121 ccggaattgg acgctagatg tccacactaa     cgaatagtgt aaaagcacaa atttcatata 181 tacgtcattt tgaaggtaca tttgacagct     atcaaaatca gtcaataaaa ctattctatc 241 tgtgtgcatc atattttttt attaact.

    [0377] In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00136 (SEQ ID NO: 14551)   1 tgcattcatt cattttgtta tcgaaataaa gcattaattt tcactaaaaa attccggttt  61 ttaagttgta cacccaatat catccttagt gacaattttc aaatggcttt cccattgagc 121 tgaaaccgtg gctctagtaa gaaaaacgcc caacccgtca tcatatgcct tttttttctc 181 aacatccg.

    [0378] In certain embodiments of the methods of the disclosure, the transposase enzyme is a piggyBac or piggyBac-like transposase enzyme. In certain embodiments, the piggyBac or piggyBac-like transposase enzyme is isolated or derived from Apis mellifera. The piggyBac (PB) or piggyBac-like transposase enzyme may comprise or consist of an amino acid sequence at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:

    TABLE-US-00137 (SEQ ID NO: 14552)   1 MENQKEHYRH ILLFYFRKGK NASQAHKKLC AVYGDEALKE RQCQNWFDKF RSGDFSLKDE  61 KRSGRPVEVD DDLIKAIIDS DRHSTTREIA EKLHVSHTCI ENHLKQLGYV QKLDTWVPHE 121 LKEKHLTQRI NSCDLLKKRN ENDPFLKRLI TGDEKWVVYN NIKRKRSWSR PREPAQTTSK 181 AGIHRKKVLL SVWWDYKGIV YFELLPPNRT INSVVYIEQL TKLNNAVEEK RPELTNRKGV 241 VFHHDNARPH TSLVTRQKLL ELGWDVLPHP PYSPDLAPSD YFLFRSLQNS LNGKNFNNDD 301 DIKSYLIQFF ANKNQKFYER GIMMLPERWQ KVIDQNGQHI TE.

    [0379] In certain embodiments, the piggyBac or piggyBac-like transposon is isolated or derived from Apis mellifera. In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00138 (SEQ ID NO: 14553)   1 ttgggttggc aactaagtaa ttgcggattt cactcataga tggcttcagt tgaattttta  61 ggtttgctgg cgtagtccaa atgtaaaaca cattttgtta tttgatagtt ggcaattcag 121 ctgtcaatca gtaaaaaaag ttttttgatc ggttgcgtag ttttcgtttg gcgttcgttg 181 aaaa.

    [0380] In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00139 (SEQ ID NO: 14554)  1 agttatttag ttccatgaaa aaattgtctt tgattttcta aaaaaaatcc gcaattactt 61 agttgccaat ccaa.

    [0381] In certain embodiments of the methods of the disclosure, the transposase enzyme is a piggyBac or piggyBac-like transposase enzyme. In certain embodiments, the piggyBac or piggyBac-like transposase enzyme is isolated or derived from Messor bouvieri. The piggyBac (PB) or piggyBac-like transposase enzyme may comprise or consist of an amino acid sequence at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:

    TABLE-US-00140 (SEQ ID NO: 14555)   1 MSSFVPENVH LRHALLFLFH QKKRAAESHR LLVETYGEHA PTIRTCETWF RQFKCGDFNV  61 QDKERPGRPK TFEDAELQEL LDEDSTQTQK QLAEKLNVSR VAICERLQAM GKIQKMGRWV 121 PHELNDRQME NRKIVSEMLL QRYERKSFLH RIVTGDEKWI YFENPKRKKS WLSPGEAGPS 181 TARPNRFGRK TMLCVWWDQI GVVYYELLKP GETVNTDRYR QQMINLNCAL IEKRPQYAQR 241 HDKVILQHDN APSHTAKPVK EMLKSLGWEV LSHPPYSPDL APSDYHLFAS MGHALAEQHF 301 ADFEEVKKWL DEWFSSKEKL FFWNGIHKLS ERWTKCIESN GQYFE.

    [0382] In certain embodiments, the piggyBac or piggyBac-like transposon is isolated or derived from Messor bouvieri. In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00141 (SEQ ID NO: 14556)   1 agtcagaaat gacacctcga tcgacgacta atcgacgtct aatcgacgtc gattttatgt  61 caacatgtta ccaggtgtgt cggtaattcc tttccggttt ttccggcaga tgtcactagc 121 cataagtatg aaatgttatg atttgataca tatgtcattt tattctactg acattaacct 181 taaaactaca caagttacgt tccgccaaaa taacagcgtt atagatttat aattttttga 241 aa.

    [0383] In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00142 (SEQ ID NO: 14557)   1 ataaatttga actatccatt ctaagtaacg tgttttcttt aacgaaaaaa ccggaaaaga  61 attaccgaca ctcctggtat gtcaacatgt tattttcgac attgaatcgc gtcgattcga 121 agtcgatcga ggtgtcattt ctgact.

    [0384] In certain embodiments of the methods of the disclosure, the transposase enzyme is a piggyBac or piggyBac-like transposase enzyme. In certain embodiments, the piggyBac or piggyBac-like transposase enzyme is isolated or derived from Trichoplusia ni. The piggyBac (PB) or piggyBac-like transposase enzyme may comprise or consist of an amino acid sequence at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:

    TABLE-US-00143 (SEQ ID NO: 14558)   1 MGSSLDDEHI LSALLQSDDE LVGEDSDSEV SDHVSEDDVQ SDTEEAFIDE VHEVQPTSSG    61 SEILDEQNVI EQPGSSLASN RILTLPQRTI RGKNKHCWST SKSTRRSRVS ALNIVRSQRG 121 PTRMCRNIYD PLLCFKLFFT DEIISEIVKW TNAEISLKRR ESMTSATFRD TNEDEIYAFF 181 GILVMTAVRK DNHMSTDDLF DRSLSMVYVS VMSRDRFDFL IRCLRMDDKS IRPTLRENDV 241 FTPVRKIWDL FIHQCIQNYT PGAHLTIDEQ LLGFRGRCPF RVYIPNKPSK YGIKILMMCD 301 SGTKYMINGM PYLGRGTQTN GVPLGEYYVK ELSKPVHGSC RNITCDNWFT SIPLAKNLLQ 361 EPYKLTIVGT VRSNKREIPE VLKNSRSRPV GTSMFCFDGP LTLVSYKPKP AKMVYLLSSC 421 DEDASINEST GKPQMVMYYN QTKGGVDTLD QMCSVMTCSR KTNRWPMALL YGMINIACIN 481 SFIIYSHNVS SKGEKVQSRK KFMRNLYMSL TSSFMRKRLE APTLKRYLRD NISNILPKEV 541 PGTSDDSTEE PVMKKRTYCT YCPSKIRRKA NASCKKCKKV ICREHNIDMC QSCF.

    [0385] In certain embodiments, the piggyBac or piggyBac-like transposon is isolated or derived from Trichoplusia ni. In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00144 (SEQ ID NO: 14559)   1 ttaaccctag aaagatagtc tgcgtaaaat tgacgcatgc attcttgaaa tattgctctc  61 tctttctaaa tagcgcgaat ccgtcgctgt gcatttagga catctcagtc gccgcttgga 121 gctcccgtga ggcgtgcttg tcaatgcggt aagtgtcact gattttgaac tataacgacc 181 gcgtgagtca aaatgacgca tgattatctt ttacgtgact tttaagattt aactcatacg 241 ataattatat tgttatttca tgttctactt acgtgataac ttattatata tatattttct 301 tgttatagat atc.

    [0386] In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00145 (SEQ ID NO: 14560)   1 tttgttactt tatagaagaa attttgagtt tttgtttttt tttaataaat aaataaacat  61 aaataaattg tttgttgaat ttattattag tatgtaagtg taaatataat aaaacttaat 121 atctattcaa attaataaat aaacctcgat atacagaccg ataaaacaca tgcgtcaatt 181 ttacgcatga ttatctttaa cgtacgtcac aatatgatta tctttctagg gttaa.

    [0387] In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00146 (SEQ ID NO: 14561)   1 ccctagaaag atagtctgcg taaaattgac gcatgcattc ttgaaatatt gctctctctt  61 tctaaatagc gcgaatccgt cgctgtgcat ttaggacatc tcagtcgccg cttggagctc 121 ccgtgaggcg tgcttgtcaa tgcggtaagt gtcactgatt ttgaactata acgaccgcgt 181 gagtcaaaat gacgcatgat tatcttttac gtgactttta agatttaact catacgataa 241 ttatattgtt atttcatgtt ctacttacgt gataacttat tatatatata ttttcttgtt 301 atagatatc.

    [0388] In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00147 (SEQ ID NO: 14562)   1 tttgttactt tatagaagaa attttgagtt tttgtttttt tttaataaat aaataaacat  61 aaataaattg tttgttgaat ttattattag tatgtaagtg taaatataat aaaacttaat 121 atctattcaa attaataaat aaacctcgat atacagaccg ataaaacaca tgcgtcaatt 181 ttacgcatga ttatctttaa cgtacgtcac aatatgatta tctttctagg g.

    [0389] In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00148 (SEQ ID NO: 14609)   1 tctaaatagc gcgaatccgt cgctgtgcat ttaggacatc tcagtcgccg cttggagctc  61 ccgtgaggcg tgcttgtcaa tgcggtaagt gtcactgatt ttgaactata acgaccgcgt 121 gagtcaaaat gacgcatgat tatcttttac gtgactttta agatttaact catacgataa 181 ttatattgtt atttcatgtt ctacttacgt gataacttat tatatatata ttttcttgtt 241 atagatatc.

    [0390] In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:

    TABLE-US-00149 (SEQ ID NO: 14610)   1 tttgttactt tatagaagaa attttgagtt tttgtttttt tttaataaat aaataaacat  61 aaataaattg tttgttgaat ttattattag tatgtaagtg taaatataat aaaacttaat 121 atctattcaa attaataaat aaacctcgat atacagaccg ataaaacaca tgcgtcaatt 181 ttacgcatga ttatctttaa cgtacgtcac aatatgatta tctttctagg g.

    [0391] In certain embodiments, the piggyBac or piggyBac-like transposon comprises SEQ ID NO: 14561 and SEQ ID NO: 14562, and the piggyBac or piggyBac-like transposase comprises SEQ ID NO: 14558. In certain embodiments, the piggyBac or piggyBac-like transposon comprises SEQ ID NO: 14609 and SEQ ID NO: 14610, and the piggyBac or piggyBac-like transposase comprises SEQ ID NO: 14558.

    [0392] In certain embodiments, the piggyBac or piggyBac-like transposon is isolated or derived from Aphis gossypii. In certain embodiments, the piggyBac or piggyBac-like transposon comprises an ITR sequence of CCTTCCAGCGGGCGCGC (SEQ ID NO: 14565).

    [0393] In certain embodiments, the piggyBac or piggyBac-like transposon is isolated or derived from Chilo suppressalis. In certain embodiments, the piggyBac or piggyBac-like transposon comprises an ITR sequence of CCCAGATTAGCCT (SEQ ID NO: 14566).

    [0394] In certain embodiments, the piggyBac or piggyBac-like transposon is isolated or derived from Heliothis virescens. In certain embodiments, the piggyBac or piggyBac-like transposon comprises an ITR sequence of CCCTTAATTACTCGCG (SEQ ID NO: 14567).

    [0395] In certain embodiments, the piggyBac or piggyBac-like transposon is isolated or derived from Pectinophora gossypiella. In certain embodiments, the piggyBac or piggyBac-like transposon comprises an ITR sequence of CCCTAGATAACTAAAC (SEQ ID NO: 14568).

    [0396] In certain embodiments, the piggyBac or piggyBac-like transposon is isolated or derived from Anopheles stephensi. In certain embodiments, the piggyBac or piggyBac-like transposon comprises an ITR sequence of CCCTAGAAAGATA (SEQ ID NO: 14569).

    Gene Editing

    [0397] In various embodiments, nucleases that may be used as cutting enzymes include, but are not limited to, Cas9, transcription activator-like effector nucleases (TALENs) and zinc finger nucleases. In certain embodiments, the Cas9 is a catalytically inactive or “inactivated” Cas9 (dCas9). In certain embodiments, the Cas9 is a catalytically inactive or “inactivated” nuclease domain of Cas9. In certain embodiments, the dCas9 is encoded by a shorter sequence that is derived from a full length, catalytically inactivated, Cas9, referred to herein as a “small” dCas9 or dSaCas9.

    [0398] In certain embodiments, the inactivated, small, Cas9 (dSaCas9) operatively-linked to an active nuclease. In certain embodiments, the disclosure provides a fusion protein comprising, consisting essentially of or consisting of a DNA binding domain and molecule nuclease, wherein the nuclease comprises a small, inactivated Cas9 (dSaCas9). In certain embodiments, the dSaCas9 of the disclosure comprises the mutations D10A and N580A (underlined and bolded) which inactivate the catalytic site. In certain embodiments, the dSaCas9 (isolated or derived from Staphylococcus aureus) of the disclosure comprises the amino acid sequence of:

    TABLE-US-00150 (SEQ ID NO: 14497)    1 MKRNYILGLA IGITSVGYGI IDYETRDVID AGVRLFKEAN VENNEGRRSK RGARRLKRRR   61 RHRIQRVKKL LFDYNLLTDH SELSGINPYE ARVKGLSQKL SEEEFSAALL HLAKRRGVHN  121 VNEVEEDTGN ELSTKEQISR NSKALEEKYV AELQLERLKK DGEVRGSINR FKTSDYVKEA  181 KQLLKVQKAY HQLDQSFIDT YIDLLETRRT YYEGPGEGSP FGWKDIKEWY EMLMGHCTYF  241 PEELRSVKYA YNADLYNALN DLNNLVITRD ENEKLEYYEK FQIIENVFKQ KKKPTLKQIA  301 KEILVNEEDI KGYRVTSTGK PEFTNLKVYH DIKDITARKE IIENAELLDQ IAKILTIYQS  361 SEDIQEELTN LNSELTQEEI EQISNLKGYT GTHNLSLKAI NLILDELWHT NDNQIAIFNR  421 LKLVPKKVDL SQQKEIPTTL VDDFILSPVV KRSFIQSIKV INAIIKKYGL PNDIIIELAR  481 EKNSKDAQKM INEMQKRNRQ TNERIEEIIR TTGKENAKYL IEKIKLHDMQ EGKCLYSLEA  541 IPLEDLLNNP FNYEVDHIIP RSVSFDNSFN NKVLVKQEEA SKKGNRTPFQ YLSSSDSKIS  601 YETFKKHILN LAKGKGRISK TKKEYLLEER DINRFSVQKD FINRNLVDTR YATRGLMNLL  661 RSYFRVNNLD VKVKSINGGF TSFLRRKWKF KKERNKGYKH HAEDALIIAN ADFIFKEWKK  721 LDKAKKVMEN QMFEEKQAES MPEIETEQEY KEIFITPHQI KHIKDFKDYK YSHRVDKKPN  781 RELINDTLYS TRKDDKGNTL IVNNLNGLYD KDNDKLKKLI NKSPEKLLMY HHDPQTYQKL  841 KLIMEQYGDE KNPLYKYYEE TGNYLTKYSK KDNGPVIKKI KYYGNKLNAH LDITDDYPNS  901 RNKVVKLSLK PYRFDVYLDN GVYKFVTVKN LDVIKKENYY EVNSKCYEEA KKLKKISNQA  961 EFIASFYNND LIKINGELYR VIGVNNDLLN RIEVNMIDIT YREYLENMND KRPPRIIKTI 1021 ASKTQSIKKY STDILGNLYE VKSKKHPQII KKG.

    [0399] In certain embodiments of the gene editing systems of the disclosure, the dCas9 of the disclosure comprises a dCas9 isolated or derived from Streptococcus pyogenes. In certain embodiments, the dCas9 comprises a dCas9 with substitutions at positions 10 and 840 of the amino acid sequence of the dCas9 which inactivate the catalytic site. In certain embodiments, these substitutions are D10A and H840A. In certain embodiments, the amino acid sequence of the dCas9 (isolated or derived from Streptococcus pyogenes) comprises the sequence of:

    TABLE-US-00151 (SEQ ID NO: 14498)    1 XDKKYSIGLA IGTNSVGWAV ITDEYKVPSK KFKVLGNTDR HSIKKNLIGA LLFDSGETAE   61 ATRLKRTARR RYTRRKNRIC YLQEIFSNEM AKVDDSFFHR LEESFLVEED KKHERHPIFG  121 NIVDEVAYHE KYPTIYHLRK KLVDSTDKAD LRLIYLALAH MIKFRGHFLI EGDLNPDNSD  181 VDKLFIQLVQ TYNQLFEENP INASGVDAKA ILSARLSKSR RLENLIAQLP GEKKNGLFGN  241 LIALSLGLTP NFKSNFDLAE DAKLQLSKDT YDDDLDNLLA QIGDQYADLF LAAKNLSDAI  301 LLSDILRVNT EITKAPLSAS MIKRYDEHHQ DLTLLKALVR QQLPEKYKEI FFDQSKNGYA  361 GYIDGGASQE EFYKFIKPIL EKMDGTEELL VKLNREDLLR KQRTFDNGSI PHQIHLGELH  421 AILRRQEDFY PFLKDNREKI EKILTFRIPY YVGPLARGNS RFAWMTRKSE ETITPWNFEE  481 VVDKGASAQS FIERMTNFDK NLPNEKVLPK HSLLYEYFTV YNELTKVKYV TEGMRKPAFL  541 SGEQKKAIVD LLFKTNRKVT VKQLKEDYFK KIECFDSVEI SGVEDRFNAS LGTYHDLLKI  601 IKDKDFLDNE ENEDILEDIV LTLTLFEDRE MIEERLKTYA HLFDDKVMKQ LKRRRYTGWG  661 RLSRKLINGI RDKQSGKTIL DFLKSDGFAN RNFMQLIHDD SLTFKEDIQK AQVSGQGDSL  721 HEHIANLAGS PAIKKGILQT VKVVDELVKV MGRHKPENIV IEMARENQTT QKGQKNSRER  781 MKRIEEGIKE LGSQILKEHP VENTQLQNEK LYLYYLQNGR DMYVDQELDI NRLSDYDVDA  841 IVPQSFLKDD SIDNKVLTRS DKNRGKSDNV PSEEVVKKMK NYWRQLLNAK LITQRKFDNL  901 TKAERGGLSE LDKAGFIKRQ LVETRQITKH VAQILDSRMN TKYDENDKLI REVKVITLKS  961 KLVSDFRKDF QFYKVREINN YHHAHDAYLN AVVGTALIKK YPKLESEFVY GDYKVYDVRK 1021 MIAKSEQEIG KATAKYFFYS NIMNFFKTEI TLANGEIRKR PLIETNGETG EIVWDKGRDF 1081 ATVRKVLSMP QVNIVKKTEV QTGGFSKESI LPKRNSDKLI ARKKDWDPKK YGGFDSPTVA 1141 YSVLVVAKVE KGKSKKLKSV KELLGITIME RSSFEKNPID FLEAKGYKEV KKDLIIKLPK 1201 YSLFELENGR KRMLASAGEL QKGNELALPS KYVNFLYLAS HYEKLKGSPE DNEQKQLFVE 1261 QHKHYLDEII EQISEFSKRV ILADANLDKV LSAYNKHRDK PIREQAENII HLFTLTNLGA 1321 PAAFKYFDTT IDRKRYTSTK EVLDATLIHQ SITGLYETRI DLSQLGGD.

    [0400] In certain embodiments of the gene editing systems of the disclosure, the nuclease domain may comprise, consist essentially of or consist of a dCas9 or a dSaCas9 and a type IIS endonuclease. In certain embodiments of the disclosure, the nuclease domain may comprise, consist essentially of or consist of a dSaCas9 and a type IIS endonuclease, including, but not limited to, AciI, Mn1I, AlwI, BbvI, BccI, BceAI, BsmAI, BsmFI, BspCNI, BsrI, BtsCI, HgaI, HphI, HpyAV, MbolI, My1I, PleI, SfaNI, AcuI, BciVI, BfuAI, BmgBI, BmrI, BpmI, BpuEI, BsaI, BseRI, BsgI, BsmI, BspMI, BsrBI, BsrBI, BsrDI, BtgZI, BtsI, EarI, EciI, MmeI, NmeAIII, BbvCI, Bpu10I, BspQI, SapI, BaeI, BsaXI, CspCI, BfiI, MboII, Acc36I, FokI or Clo051. In certain embodiments of the disclosure, the nuclease domain may comprise, consist essentially of or consist of a dSaCas9 and Clo051. An exemplary Clo051 nuclease domain may comprise, consist essentially of or consist of, the amino acid sequence of:

    TABLE-US-00152 (SEQ ID NO: 14503) EGIKSNISLLKDELRGQISHISHEYLSLIDLAFDSKQNRLFEMKVLELLV NEYGFKGRHLGGSRKPDGIVYSTTLEDNFGIIVDTKAYSEGYSLPISQAD EMERYVRENSNRDEEVNPNKWWENFSEEVKKYYFVFISGSFKGKFEEQLR RLSMTTGVNGSAVNVVNLLLGAEKIRSGEMTIEELERAMFNNSEFILKY.

    [0401] An exemplary dCas9-Clo051 nuclease domain may comprise, consist essentially of or consist of, the amino acid sequence of (Clo051 sequence underlined, linker bold italics, dCas9 (Staphylococcus pyogenes) sequence in italics):

    TABLE-US-00153 (SEQ ID NO: 14654) MAPKKKRKVEGIKSNISLLKDELRGQISHISHEYLSLIDLAFDSKQNRLF EMKVLELLVNEYGFKGRHLGGSRKPDGIVYSTTLEDNFGIIVDTKAYSEG YSLPISQADEMERYVRENSNRDEEVNPNKWWENFSEEVKKYYFVFISGSF KGKFEEQLRRLSMTTGVNGSAVNVVNLLLGAEKIRSGEMTIEELERAMFN NSEFILKYcustom-character DKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNT DRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSN EIVIAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIY HLRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFI QLVQTYNQLFEENPINASGVDAICAILSARLSKSRRLENLIAQLPGEKKN GLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQ YADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLL KALVRQQLPEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEICMD GTEELLVKLNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLK DNREKIEKILTFRIPYYVGPLARGNSRFAWMTRKSEETITPWNFEEVVDK GASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGM RKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVE DRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREAKEE RLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLK SDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIK KGILQTVKVVDELVKVMGRHKPENIVIEIVIARENQTTQKGQKNSRERMI CRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDIN RLSDYDVDAIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKN YWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKHV AQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNY HHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRICAKAKSEQEIG KATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDF ATVRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWDPKK YGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGITIMERSSFEKNPID FLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNELALPS KYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEHEQISEFSKRVI LADANLDKVLSAYNKHRDKPIREQAENIHILFTLTNLGAPAAFKYFDTTI DRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGDGSPKKKRKVSS.

    [0402] Gene editing compositions of the disclosure may comprise a nuclease protein or a nuclease domain thereof. In certain embodiments, the gene editing composition comprises a sequence encoding a nuclease protein or a sequence encoding a nuclease domain thereof. In certain embodiments, the sequence encoding a nuclease protein or the sequence encoding a nuclease domain thereof comprises a DNA sequence, an RNA sequence, or a combination thereof. In certain embodiments, the nuclease or the nuclease domain thereof comprises one or more of a CRISPR/Cas protein, a Transcription Activator-Like Effector Nuclease (TALEN), a Zinc Finger Nuclease (ZFN), and an endonuclease. In certain embodiments, the nuclease or the nuclease domain thereof comprises one or more of a nuclease-inactivated Cas (dCas) protein, a Transcription Activator-Like Effector Nuclease (TALEN), a Zinc Finger Nuclease (ZFN), and an endonuclease. In certain embodiments, the nuclease or the nuclease domain thereof comprises a nuclease-inactivated Cas (dCas) protein and an endonuclease. In certain embodiments, the nuclease or the nuclease domain thereof comprises a nuclease-inactivated Cas9 (dCas9) protein and an endonuclease, wherein the endonuclease comprises a Clo051 nuclease or a nuclease domain thereof. In certain embodiments, the gene editing composition comprises a fusion protein. In certain embodiments, the fusion protein comprises a nuclease-inactivated Cas9 (dCas9) protein and a Clo051 nuclease or a Clo051 nuclease domain. In certain embodiments, the gene editing composition further comprises a guide sequence. In certain embodiments, the guide sequence comprises an RNA sequence.

    [0403] In certain embodiments, the gene editing composition comprises a fusion protein. In certain embodiments, the fusion protein comprises a nuclease-inactivated Cas9 (dCas9) protein and a Clo051 nuclease or a Clo051 nuclease domain. In certain embodiments, the gene editing composition further comprises a guide sequence. In certain embodiments, the guide sequence comprises an RNA sequence. In certain embodiments, the fusion protein comprises or consists of the amino acid sequence:

    TABLE-US-00154 (SEQ ID NO: 14654) MAPKKKRKVEGIKSNISLLKDELRGQISHISHEYLSLIDLAFDSKQNRLF EMKVLELLVNEYGFKGRHLGGSRKPDGIVYSTTLEDNEGIIVDTKAYSEG YSLPISQADEMERYVRENSNRDEEVNPNKWWENFSEEVKKYYFVFISGSF KGKFEEQLRRLSMTTGVNGSAVNVVNLLLGAEKIRSGEMTIEELERAMEN NSEFILKYGGGGSDKKYSIGLAIGTNSVGWAVITDEYKVPSKKEKVLGNT DRHSIKKNLIGALLEDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSN EMAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHL RKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQL VQTYNQLFEENPINASGVDAKAILSARLSKSRRLENLIAQLPGEKKNGLF GNLIALSLGLIPNEKSNEDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYAD LFLAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKAL VRQQLPEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEE LLVKLNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNRE KIEKILTERIPYYVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGASA QSFIERMTNEDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPA FLSGEQKKAIVDLLEKTNRKVIVKQLKEDYFKKIECEDSVEISGVEDRFN ASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKT YAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGF ANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGIL QTVKVVDELVKVMGRHKPENIVIEMARENQTTQKGQKNSRERMKRIEEGI KELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDV DAIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLN AKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSR MNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAY LNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFF YSNIMNFEKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLS MPQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPT VAYSVLVVAKVEKGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGYK EVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNELALPSKYVNFLYL ASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADANLD KVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTS TKEVLDATLIHQSITGLYETRIDLSQLGGDGSPKKKRKVSS.
    In certain embodiments, the fusion protein is encoded by a nucleic acid comprising or consisting of the sequence:

    TABLE-US-00155 (SEQ ID NO: 14655)    1 atggcaccaa agaagaaaag aaaagtggag ggcatcaagt caaacatcag cctgctgaaa   61 gacgaactgc ggggacagat tagtcacatc agtcacgagt acctgtcact gattgatctg  121 gccttcgaca gcaagcagaa tagactgttt gagatgaaag tgctggaact gctggtcaac  181 gagtatggct tcaagggcag acatctgggc gggtctagga aacctgacgg catcgtgtac  241 agtaccacac tggaagacaa cttcggaatc attgtcgata ccaaggctta ttccgagggc  301 tactctctgc caattagtca ggcagatgag atggaaaggt acgtgcgcga aaactcaaat  361 agggacgagg aagtcaaccc caataagtgg tgggagaatt tcagcgagga agtgaagaaa  421 tactacttcg tctttatctc aggcagcttc aaagggaagt ttgaggaaca gctgcggaga  481 ctgtccatga ctaccggggt gaacggatct gctgtcaacg tggtcaatct gctgctgggc  541 gcagaaaaga tcaggtccgg ggagatgaca attgaggaac tggaacgcgc catgttcaac  601 aattctgagt ttatcctgaa gtatggaggc gggggaagcg ataagaaata ctccatcgga  661 ctggccattg gcaccaattc cgtgggctgg gctgtcatca cagacgagta caaggtgcca  721 agcaagaagt tcaaggtcct ggggaacacc gatcgccaca gtatcaagaa aaatctgatt  781 ggagccctgc tgttcgactc aggcgagact gctgaagcaa cccgactgaa gcggactgct  841 aggcgccgat atacccggag aaaaaatcgg atctgctacc tgcaggaaat tttcagcaac  901 gagatggcca aggtggacga tagtttcttt caccgcctgg aggaatcatt cctggtggag  961 gaagataaga aacacgagcg gcatcccatc tttggcaaca ttgtggacga agtcgcttat 1021 cacgagaagt accctactat ctatcatctg aggaagaaac tggtggactc caccgataag 1081 gcagacctgc gcctgatcta tctggccctg gctcacatga tcaagttccg ggggcatttt 1141 ctgatcgagg gagatctgaa ccctgacaat tctgatgtgg acaagctgtt catccagctg 1201 gtccagacat acaatcagct gtttgaggaa aacccaatta atgcctcagg cgtggacgca 1261 aaggccatcc tgagcgccag actgtccaaa tctaggcgcc tggaaaacct gatcgctcag 1321 ctgccaggag agaagaaaaa cggcctgttt gggaatctga ttgcactgtc cctgggcctg 1381 acacccaact tcaagtctaa ttttgatctg gccgaggacg ctaagctgca gctgtccaaa 1441 gacacttatg acgatgacct ggataacctg ctggctcaga tcggcgatca gtacgcagac 1501 ctgttcctgg ccgctaagaa tctgagtgac gccatcctgc tgtcagatat tctgcgcgtg 1561 aacacagaga ttactaaggc cccactgagt gcttcaatga tcaaaagata tgacgagcac 1621 catcaggatc tgaccctgct gaaggctctg gtgaggcagc agctgcccga gaaatacaag 1681 gaaatcttct ttgatcagag caagaatgga tacgccggct atattgacgg cggggcttcc 1741 caggaggagt tctacaagtt catcaagccc attctggaaa agatggacgg caccgaggaa 1801 ctgctggtga agctgaatcg ggaggacctg ctgagaaaac agaggacatt tgataacgga 1861 agcatccctc accagattca tctgggcgaa ctgcacgcca tcctgcgacg gcaggaggac 1921 ttctacccat ttctgaagga taaccgcgag aaaatcgaaa agatcctgac cttcagaatc 1981 ccctactatg tggggcctct ggcacgggga aatagtagat ttgcctggat gacaagaaag 2041 tcagaggaaa ctatcacccc ctggaacttc gaggaagtgg tcgataaagg cgctagcgca 2101 cagtccttca ttgaaaggat gacaaatttt gacaagaacc tgccaaatga gaaggtgctg 2161 cccaaacaca gcctgctgta cgaatatttc acagtgtata acgagctgac taaagtgaag 2221 tacgtcaccg aagggatgcg caagcccgca ttcctgtccg gagagcagaa gaaagccatc 2281 gtggacctgc tgtttaagac aaatcggaaa gtgactgtca aacagctgaa ggaagactat 2341 ttcaagaaaa ttgagtgttt cgattcagtg gaaatcagcg gcgtcgagga caggtttaac 2401 gcctccctgg ggacctacca cgatctgctg aagatcatca aggataagga cttcctggac 2461 aacgaggaaa atgaggacat cctggaggac attgtgctga cactgactct gtttgaggat 2521 cgcgaaatga tcgaggaacg actgaagact tatgcccatc tgttcgatga caaagtgatg 2581 aagcagctga aaagaaggcg ctacaccgga tggggacgcc tgagccgaaa actgatcaat 2641 gggattagag acaagcagag cggaaaaact atcctggact ttctgaagtc cgatggcttc 2701 gccaacagga acttcatgca gctgattcac gatgactctc tgaccttcaa ggaggacatc 2761 cagaaagcac aggtgtctgg ccagggggac agtctgcacg agcatatcgc aaacctggcc 2821 ggcagccccg ccatcaagaa agggattctg cagaccgtga aggtggtgga cgaactggtc 2881 aaggtcatgg gacgacacaa acctgagaac atcgtgattg agatggcccg cgaaaatcag 2941 acaactcaga agggccagaa aaacagtcga gaacggatga agagaatcga ggaaggcatc 3001 aaggagctgg ggtcacagat cctgaaggag catcctgtgg aaaacactca gctgcagaat 3061 gagaaactgt atctgtacta tctgcagaat ggacgggata tgtacgtgga ccaggagctg 3121 gatattaaca gactgagtga ttatgacgtg gatgccatcg tccctcagag cttcctgaag 3181 gatgactcca ttgacaacaa ggtgctgacc aggtccgaca agaaccgcgg caaatcagat 3241 aatgtgccaa gcgaggaagt ggtcaagaaa atgaagaact actggaggca gctgctgaat 3301 gccaagctga tcacacagcg gaaatttgat aacctgacta aggcagaaag aggaggcctg 3361 tctgagctgg acaaggccgg cttcatcaag cggcagctgg tggagacaag acagatcact 3421 aagcacgtcg ctcagattct ggatagcaga atgaacacaa agtacgatga aaacgacaag 3481 ctgatcaggg aggtgaaagt cattactctg aaatccaagc tggtgtctga ctttagaaag 3541 gatttccagt tttataaagt cagggagatc aacaactacc accatgctca tgacgcatac 3601 ctgaacgcag tggtcgggac cgccctgatt aagaaatacc ccaagctgga gtccgagttc 3661 gtgtacggag actataaagt gtacgatgtc cggaagatga tcgccaaatc tgagcaggaa 3721 attggcaagg ccaccgctaa gtatttcttt tacagtaaca tcatgaattt ctttaagacc 3781 gaaatcacac tggcaaatgg ggagatcaga aaaaggcctc tgattgagac caacggggag 3841 acaggagaaa tcgtgtggga caagggaagg gattttgcta ccgtgcgcaa agtcctgtcc 3901 atgccccaag tgaatattgt caagaaaact gaagtgcaga ccgggggatt ctctaaggag 3961 agtattctgc ctaagcgaaa ctctgataaa ctgatcgccc ggaagaaaga ctgggacccc 4021 aagaagtatg gcgggttcga ctctccaaca gtggcttaca gtgtcctggt ggtcgcaaag 4081 gtggaaaagg ggaagtccaa gaaactgaag tctgtcaaag agctgctggg aatcactatt 4141 atggaacgca gctccttcga gaagaatcct atcgattttc tggaagccaa gggctataaa 4201 gaggtgaaga aagacctgat cattaagctg ccaaaatact cactgtttga gctggaaaac 4261 ggacgaaagc gaatgctggc aagcgccgga gaactgcaga agggcaatga gctggccctg 4321 ccctccaaat acgtgaactt cctgtatctg gctagccact acgagaaact gaaggggtcc 4381 cctgaggata acgaacagaa gcagctgttt gtggagcagc acaaacatta tctggacgag 4441 atcattgaac agatttcaga gttcagcaag agagtgatcc tggctgacgc aaatctggat 4501 aaagtcctga gcgcatacaa caagcaccga gacaaaccaa tccgggagca ggccgaaaat 4561 atcattcatc tgttcaccct gacaaacctg ggcgcccctg cagccttcaa gtattttgac 4621 accacaatcg atcggaagag atacacttct accaaagagg tgctggatgc taccctgatc 4681 caccagagta ttaccggcct gtatgagaca cgcatcgacc tgtcacagct gggaggcgat 4741 gggagcccca agaaaaagcg gaaggtgtct agttaa. 

    [0404] In certain embodiments, the gene editing composition comprises a fusion protein. In certain embodiments, the fusion protein comprises a nuclease-inactivated Cas9 (dCas9) protein and a Clo051 nuclease or a Clo051 nuclease domain. In certain embodiments, the gene editing composition further comprises a guide sequence. In certain embodiments, the guide sequence comprises an RNA sequence. In certain embodiments, the fusion protein comprises or consists of the amino acid sequence:

    TABLE-US-00156 (SEQ ID NO: 14656)    1 MPKKKRKVEG IKSNISLLKD ELRGQISHIS HEYLSLIDLA FDSKQNRLFE MKVLELLVNE   61 YGFKGRHLGG SRKPDGIVYS TTLEDNFGII VDTKAYSEGY SLPISQADEM ERYVRENSNR  121 DEEVNPNKWW ENFSEEVKKY YFVFISGSFK GKFEEQLRRL SMTTGVNGSA VNVVNLLLGA  181 EKIRSGEMTI EELERAMFNN SEFILKYGGG GSDKKYSIGL AIGTNSVGWA VITDEYKVPS  241 KKFKVLGNTD RHSIKKNLIG ALLFDSGETA EATRLKRTAR RRYTRRKNRI CYLQEIFSNE  301 MAKVDDSFFH RLEESFLVEE DKKHERHPIF GNIVDEVAYH EKYPTIYHLR KKLVDSTDKA  361 DLRLIYLALA HMIKFRGHFL IEGDLNPDNS DVDKLFIQLV QTYNQLFEEN PINASGVDAK  421 AILSARLSKS RRLENLIAQL PGEKKNGLFG NLIALSLGLT PNFKSNFDLA EDAKLQLSKD  481 TYDDDLDNLL AQIGDQYADL FLAAKNLSDA ILLSDILRVN TEITKAPLSA SMIKRYDEHH  541 QDLTLLKALV RQQLPEKYKE IFFDQSKNGY AGYIDGGASQ EEFYKFIKPI LEKMDGTEEL  601 LVKLNREDLL RKQRTFDNGS IPHQIHLGEL HAILRRQEDF YPFLKDNREK IEKILTFRIP  661 YYVGPLARGN SRFAWMTRKS EETITPWNFE EVVDKGASAQ SFIERMTNFD KNLPNEKVLP  721 KHSLLYEYFT VYNELTKVKY VTEGMRKPAF LSGEQKKAIV DLLFKTNRKV TVKQLKEDYF  781 KKIECFDSVE ISGVEDRFNA SLGTYHDLLK IIKDKDFLDN EENEDILEDI VLTLTLFEDR  841 EMIEERLKTY AHLFDDKVMK QLKRRRYTGW GRLSRKLING IRDKQSGKTI LDFLKSDGFA  901 NRNFMQLIHD DSLTFKEDIQ KAQVSGQGDS LHEHIANLAG SPAIKKGILQ TVKVVDELVK  961 VMGRHKPENI VIEMARENQT TQKGQKNSRE RMKRIEEGIK ELGSQILKEH PVENTQLQNE 1021 KLYLYYLQNG RDMYVDQELD INRLSDYDVD AIVPQSFLKD DSIDNKVLTR SDKNRGKSDN 1081 VPSEEVVKKM KNYWRQLLNA KLITQRKFDN LTKAERGGLS ELDKAGFIKR QLVETRQITK 1141 HVAQILDSRM NTKYDENDKL IREVKVITLK SKLVSDFRKD FQFYKVREIN NYHHAHDAYL 1201 NAVVGTALIK KYPKLESEFV YGDYKVYDVR KMIAKSEQEI GKATAKYFFY SNIMNFFKTE 1261 ITLANGEIRK RPLIETNGET GEIVWDKGRD FATVRKVLSM PQVNIVKKTE VQTGGFSKES 1321 ILPKRNSDKL IARKKDWDPK KYGGFDSPTV AYSVLVVAKV EKGKSKKLKS VKELLGITIM 1381 ERSSFEKNPI DFLEAKGYKE VKKDLIIKLP KYSLFELENG RKRMLASAGE LQKGNELALP 1441 SKYVNFLYLA SHYEKLKGSP EDNEQKQLFV EQHKHYLDEI IEQISEFSKR VILADANLDK 1501 VLSAYNKHRD KPIREQAENI IHLFTLINLG APAAFKYFDT TIDRKRYTST KEVLDATLIH 1561 QSITGLYETR IDLSQLGGDG SPKKKRKV.
    In certain embodiments, the fusion protein is encoded by a nucleic acid comprising or consisting of the sequence:

    TABLE-US-00157 (SEQ ID NO: 14657)    1 atgcctaaga agaagcggaa ggtggaaggc atcaaaagca acatctccct cctgaaagac   61 gaactccggg ggcagattag ccacattagt cacgaatacc tctccctcat cgacctggct  121 ttcgatagca agcagaacag gctctttgag atgaaagtgc tggaactgct cgtcaatgag  181 tacgggttca agggtcgaca cctcggcgga tctaggaaac cagacggcat cgtgtatagt  241 accacactgg aagacaactt tgggatcatt gtggatacca aggcatactc tgagggttat  301 agtctgccca tttcacaggc cgacgagatg gaacggtacg tgcgcgagaa ctcaaataga  361 gatgaggaag tcaaccctaa caagtggtgg gagaacttct ctgaggaagt gaagaaatac  421 tacttcgtct ttatcagcgg gtccttcaag ggtaaatttg aggaacagct caggagactg  481 agcatgacta ccggcgtgaa tggcagcgcc gtcaacgtgg tcaatctgct cctgggcgct  541 gaaaagattc ggagcggaga gatgaccatc gaagagctgg agagggcaat gtttaataat  601 agcgagttta tcctgaaata cggtggcggt ggatccgata aaaagtattc tattggttta  661 gccatcggca ctaattccgt tggatgggct gtcataaccg atgaatacaa agtaccttca  721 aagaaattta aggtgttggg gaacacagac cgtcattcga ttaaaaagaa tcttatcggt  781 gccctcctat tcgatagtgg cgaaacggca gaggcgactc gcctgaaacg aaccgctcgg  841 agaaggtata cacgtcgcaa gaaccgaata tgttacttac aagaaatttt tagcaatgag  901 atggccaaag ttgacgattc tttctttcac cgtttggaag agtccttcct tgtcgaagag  961 gacaagaaac atgaacggca ccccatcttt ggaaacatag tagatgaggt ggcatatcat 1021 gaaaagtacc caacgattta tcacctcaga aaaaagctag ttgactcaac tgataaagcg 1081 gacctgaggt taatctactt ggctcttgcc catatgataa agttccgtgg gcactttctc 1141 attgagggtg atctaaatcc ggacaactcg gatgtcgaca aactgttcat ccagttagta 1201 caaacctata atcagttgtt tgaagagaac cctataaatg caagtggcgt ggatgcgaag 1261 gctattctta gcgcccgcct ctctaaatcc cgacggctag aaaacctgat cgcacaatta 1321 cccggagaga agaaaaatgg gttgttcggt aaccttatag cgctctcact aggcctgaca 1381 ccaaatttta agtcgaactt cgacttagct gaagatgcca aattgcagct tagtaaggac 1441 acgtacgatg acgatctcga caatctactg gcacaaattg gagatcagta tgcggactta 1501 tttttggctg ccaaaaacct tagcgatgca atcctcctat ctgacatact gagagttaat 1561 actgagatta ccaaggcgcc gttatccgct tcaatgatca aaaggtacga tgaacatcac 1621 caagacttga cacttctcaa ggccctagtc cgtcagcaac tgcctgagaa atataaggaa 1681 atattctttg atcagtcgaa aaacgggtac gcaggttata ttgacggcgg agcgagtcaa 1741 gaggaattct acaagtttat caaacccata ttagagaaga tggatgggac ggaagagttg 1801 cttgtaaaac tcaatcgcga agatctactg cgaaagcagc ggactttcga caacggtagc 1861 attccacatc aaatccactt aggcgaattg catgctatac ttagaaggca ggaggatttt 1921 tatccgttcc tcaaagacaa tcgtgaaaag attgagaaaa tcctaacctt tcgcatacct 1981 tactatgtgg gacccctggc ccgagggaac tctcggttcg catggatgac aagaaagtcc 2041 gaagaaacga ttactccatg gaattttgag gaagttgtcg ataaaggtgc gtcagctcaa 2101 tcgttcatcg agaggatgac caactttgac aagaatttac cgaacgaaaa agtattgcct 2161 aagcacagtt tactttacga gtatttcaca gtgtacaatg aactcacgaa agttaagtat 2221 gtcactgagg gcatgcgtaa acccgccttt ctaagcggag aacagaagaa agcaatagta 2281 gatctgttat tcaagaccaa ccgcaaagtg acagttaagc aattgaaaga ggactacttt 2341 aagaaaattg aatgcttcga ttctgtcgag atctccgggg tagaagatcg atttaatgcg 2401 tcacttggta cgtatcatga cctcctaaag ataattaaag ataaggactt cctggataac 2461 gaagagaatg aagatatctt agaagatata gtgttgactc ttaccctctt tgaagatcgg 2521 gaaatgattg aggaaagact aaaaacatac gctcacctgt tcgacgataa ggttatgaaa 2581 cagttaaaga ggcgtcgcta tacgggctgg ggacgattgt cgcggaaact tatcaacggg 2641 ataagagaca agcaaagtgg taaaactatt ctcgattttc taaagagcga cggcttcgcc 2701 aataggaact ttatgcagct gatccatgat gactctttaa ccttcaaaga ggatatacaa 2761 aaggcacagg tttccggaca aggggactca ttgcacgaac atattgcgaa tcttgctggt 2821 tcgccagcca tcaaaaaggg catactccag acagtcaaag tagtggatga gctagttaag 2881 gtcatgggac gtcacaaacc ggaaaacatt gtaatcgaga tggcacgcga aaatcaaacg 2941 actcagaagg ggcaaaaaaa cagtcgagag cggatgaaga gaatagaaga gggtattaaa 3001 gaactgggca gccagatctt aaaggagcat cctgtggaaa atacccaatt gcagaacgag 3061 aaactttacc tctattacct acaaaatgga agggacatgt atgttgatca ggaactggac 3121 ataaaccgtt tatctgatta cgacgtcgat gccattgtac cccaatcctt tttgaaggac 3181 gattcaatcg acaataaagt gcttacacgc tcggataaga accgagggaa aagtgacaat 3241 gttccaagcg aggaagtcgt aaagaaaatg aagaactatt ggcggcagct cctaaatgcg 3301 aaactgataa cgcaaagaaa gttcgataac ttaactaaag ctgagagggg tggcttgtct 3361 gaacttgaca aggccggatt tattaaacgt cagctcgtgg aaacccgcca aatcacaaag 3421 catgttgcac agatactaga ttcccgaatg aatacgaaat acgacgagaa cgataagctg 3481 attcgggaag tcaaagtaat cactttaaag tcaaaattgg tgtcggactt cagaaaggat 3541 tttcaattct ataaagttag ggagataaat aactaccacc atgcgcacga cgcttatctt 3601 aatgccgtcg tagggaccgc actcattaag aaatacccga agctagaaag tgagtttgtg 3661 tatggtgatt acaaagttta tgacgtccgt aagatgatcg cgaaaagcga acaggagata 3721 ggcaaggcta cagccaaata cttcttttat tctaacatta tgaatttctt taagacggaa 3781 atcactctgg caaacggaga gatacgcaaa cgacctttaa ttgaaaccaa tggggagaca 3841 ggtgaaatcg tatgggataa gggccgggac ttcgcgacgg tgagaaaagt tttgtccatg 3901 ccccaagtca acatagtaaa gaaaactgag gtgcagaccg gagggttttc aaaggaatcg 3961 attcttccaa aaaggaatag tgataagctc atcgctcgta aaaaggactg ggacccgaaa 4021 aagtacggtg gcttcgatag ccctacagtt gcctattctg tcctagtagt ggcaaaagtt 4081 gagaagggaa aatccaagaa actgaagtca gtcaaagaat tattggggat aacgattatg 4141 gagcgctcgt cttttgaaaa gaaccccatc gacttccttg aggcgaaagg ttacaaggaa 4201 gtaaaaaagg atctcataat taaactacca aagtatagtc tgtttgagtt agaaaatggc 4261 cgaaaacgga tgttggctag cgccggagag cttcaaaagg ggaacgaact cgcactaccg 4321 tctaaatacg tgaatttcct gtatttagcg tcccattacg agaagttgaa aggttcacct 4381 gaagataacg aacagaagca actttttgtt gagcagcaca aacattatct cgacgaaatc 4441 atagagcaaa tttcggaatt cagtaagaga gtcatcctag ctgatgccaa tctggacaaa 4501 gtattaagcg catacaacaa gcacagggat aaacccatac gtgagcaggc ggaaaatatt 4561 atccatttgt ttactcttac caacctcggc gctccagccg cattcaagta ttttgacaca 4621 acgatagatc gcaaacgata cacttctacc aaggaggtgc tagacgcgac actgattcac 4681 caatccatca cgggattata tgaaactcgg atagatttgt cacagcttgg gggtgacgga 4741 tcccccaaga agaagaggaa agtctga.

    [0405] In certain embodiments, the dCas9 of the disclosure comprises a dCas9 isolated or derived from Staphyloccocus pyogenes. In certain embodiments, the dCas9 comprises a dCas9 with substitutions at positions 10 and 840 of the amino acid sequence of the dCas9, which inactivate the catalytic site. In certain embodiments, these substitutions are D10A and H840A. In certain embodiments, the “X” residue at position 1 of the dCas9 sequence is a methionine (M). In certain embodiments, the amino acid sequence of the dCas9 comprises the sequence of:

    TABLE-US-00158 (SEQ ID NO: 14498)    1 XDKKYSIGLA IGTNSVGWAV ITDEYKVPSK KFKVLGNTDR HSIKKNLIGA LLFDSGETAE   61 ATRLKRTARR RYTRRKNRIC YLQEIFSNEM AKVDDSFFHR LEESFLVEED KKHERHPIFG  121 NIVDEVAYHE KYPTIYHLRK KLVDSTDKAD LRLIYLALAH MIKFRGHFLI EGDLNPDNSD  181 VDKLFIQLVQ TYNQLFEENP INASGVDAKA ILSARLSKSR RLENLIAQLP GEKKNGLFGN  241 LIALSLGLTP NFKSNFDLAE DAKLQLSKDT YDDDLDNLLA QIGDQYADLF LAAKNLSDAI  301 LLSDILRVNT EITKAPLSAS MIKRYDEHHQ DLTLLKALVR QQLPEKYKEI FFDQSKNGYA  361 GYIDGGASQE EFYKFIKPIL EKMDGTEELL VKLNREDLLR KQRTFDNGSI PHQIHLGELH  421 AILRRQEDFY PFLKDNREKI EKILTFRIPY YVGPLARGNS RFAWMTRKSE ETITPWNFEE  481 VVDKGASAQS FIERMTNFDK NLPNEKVLPK HSLLYEYFTV YNELTKVKYV TEGMRKPAFL  541 SGEQKKAIVD LLFKTNRKVT VKQLKEDYFK KIECFDSVEI SGVEDRFNAS LGTYHDLLKI  601 IKDKDFLDNE ENEDILEDIV LTLTLFEDRE MIEERLKTYA HLFDDKVMKQ LKRRRYTGWG  661 RLSRKLINGI RDKQSGKTIL DFLKSDGFAN RNFMQLIHDD SLTFKEDIQK AQVSGQGDSL  721 HEHIANLAGS PAIKKGILQT VKVVDELVKV MGRHKPENIV IEMARENQTT QKGQKNSRER  781 MKRIEEGIKE LGSQILKEHP VENTQLQNEK LYLYYLQNGR DMYVDQELDI NRLSDYDVDA  841 IVPQSFLKDD SIDNKVLTRS DKNRGKSDNV PSEEVVKKMK NYWRQLLNAK LITQRKFDNL  901 TKAERGGLSE LDKAGFIKRQ LVETRQITKH VAQILDSRMN TKYDENDKLI REVKVITLKS  961 KLVSDFRKDF QFYKVREINN YHHAHDAYLN AVVGTALIKK YPKLESEFVY GDYKVYDVRK 1021 MIAKSEQEIG KATAKYFFYS NIMNFFKTEI TLANGEIRKR PLIETNGETG EIVWDKGRDF 1081 ATVRKVLSMP QVNIVKKTEV QTGGFSKESI LPKRNSDKLI ARKKDWDPKK YGGFDSPTVA 1141 YSVLVVAKVE KGKSKKLKSV KELLGITIME RSSFEKNPID FLEAKGYKEV KKDLIIKLPK 1201 YSLFELENGR KRMLASAGEL QKGNELALPS KYVNFLYLAS HYEKLKGSPE DNEQKQLFVE 1261 QHKHYLDEII EQISEFSKRV ILADANLDKV LSAYNKHRDK PIREQAENII HLFTLTNLGA 1321 PAAFKYFDTT IDRKRYTSTK EVLDATLIHQ SITGLYETRI DLSQLGGD.

    [0406] In certain embodiments, the dCas9 of the disclosure comprises a dCas9 isolated or derived from Staphylococcus aureus. In certain embodiments, the dCas9 comprises a dCas9 with substitutions at positions 10 and 580 of the amino acid sequence of the dCas9 which inactivate the catalytic site. In certain embodiments, these substitutions are D10A and N580A. In certain embodiments, the dCas9 is a small and inactive Cas9 (dSaCas9). In certain embodiments, the amino acid sequence of the dSaCas9 comprises the sequence of:

    TABLE-US-00159 (SEQ ID NO: 14658)    1 mkrnyilglA igitsvgygi idyetrdvid agvrlfkean vennegrrsk rgarrlkrrr   61 rhriqrvkkl lfdynlltdh selsginpye arvkglsqkl seeefsaall hlakrrgvhn  121 vneveedtgn elstkeqisr nskaleekyv aelqlerlkk dgevrgsinr fktsdyvkea  181 kqllkvqkay hqldqsfidt yidlletrrt yyegpgegsp fgwkdikewy emlmghctyf  241 peelrsvkya ynadlynaln dlnnlvitrd enekleyyek fqiienvfkq kkkptlkqia  301 keilvneedi kgyrvtstgk peftnlkvyh dikditarke iienaelldq iakiltiyqs  361 sediqeeltn lnseltqeei eqisnlkgyt gthnlslkai nlildelwht ndnqiaifnr  421 lklvpkkvd1 sqqkeipttl vddfilspvv krsfiqsikv inaiikkygl pndiiielar  481 eknskdaqkm inemqkrnrq tnerieeiir ttgkenakyl iekiklhdmq egkclyslea  541 ipledllnnp fnyevdhiip rsysfdnsfn nkvlvkqeeA skkgnrtpfq ylsssdskis  601 yetfkkhiln lakgkgrisk tkkeylleer dinrfsvqkd finrnlvdtr yatrglmnll  661 rsyfrvnnld vkvksinggf tsflrrkwkf kkernkgykh haedaliian adfifkewkk  721 ldkakkvmen qmfeekqaes mpeieteqey keifitphqi khikdfkdyk yshrvdkkpn  781 relindtlys trkddkgntl ivnnlnglyd kdndklkkli nkspekllmy hhdpqtyqkl  841 klimeqygde knplykyyee tgnyltkysk kdngpvikki kyygnklnah lditddypns  901 rnkvvklslk pyrfdvyldn gvykfvtvkn ldvikkenyy evnskcyeea kklkkisnqa  961 efiasfynnd likingelyr vigvnndlln rievnmidit yreylenmnd krppriikti 1021 asktqsikky stdilgnlye vkskkhpqii kkg.

    [0407] In certain embodiments of the gene editing systems described herein, the nuclease may comprise, consist essentially of or consist of, a homodimer or a heterodimer. Nuclease domains of the disclosure may comprise, consist essentially of or consist of a nuclease domain isolated, derived or recombined from a transcription-activator-like effector nuclease (TALEN). TALENs are transcription factors with programmable DNA binding domains that provide a means to create designer proteins that bind to pre-determined DNA sequences or individual nucleic acids. Modular DNA binding domains have been identified in transcriptional activator-like (TAL) proteins, or, more specifically, transcriptional activator-like effector nucleases (TALENs), thereby allowing for the de novo creation of synthetic transcription factors that bind to DNA sequences of interest and, if desirable, also allowing a second domain present on the protein or polypeptide to perform an activity related to DNA. TAL proteins have been derived from the organisms Xanthomonas and Ralstonia.

    [0408] In certain embodiments of the gene editing systems described herein, the nuclease domain may comprise, consist essentially of or consist of a nuclease domain isolated, derived or recombined from a TALEN and a type IIS endonuclease. In certain embodiments of the disclosure, the type IIS endonuclease may comprise, consist essentially of or consist of AciI, Mn1I, AlwI, BbvI, BccI, BceAI, BsmAI, BsmFI, BspCNI, BsrI, BtsCI, HgaI, HphI, HpyAV, MbolI, My1I, PleI, SfaNI, AcuI, BciVI, BfuAI, BmgBI, BmrI, BpmI, BpuEI, BsaI, BseRI, BsgI, BsmI, BspMI, BsrBI, BsrBI, BsrDI, BtgZI, BtsI, EarI, EciI, MmeI, NmeAIII, BbvCI, Bpu10I, BspQI, SapI, BaeI, BsaXI, CspCI, BfiI, MboII, Acc36I, FokI or Clo051. In certain embodiments of the disclosure, the type IIS endonuclease may comprise, consist essentially of or consist of Clo051 (SEQ ID NO: 14503).

    [0409] In certain embodiments of the gene editing systems described herein, the nuclease domain of may comprise, consist essentially of or consist of a nuclease domain isolated, derived or recombined from a zinc finger nuclease (ZFN) and a type IIS endonuclease. In certain embodiments of the disclosure, the type IIS endonuclease may comprise, consist essentially of or consist of AciI, Mn1I, AlwI, BbvI, BccI, BceAI, BsmAI, BsmFI, BspCNI, BsrI, BtsCI, HgaI, HphI, HpyAV, Mbo1I, My1I, PleI, SfaNI, AcuI, BciVI, BfuAI, BmgBI, BmrI, BpmI, BpuEI, BsaI, BseRI, BsgI, BsmI, BspMI, BsrBI, BsrBI, BsrDI, BtgZI, BtsI, EarI, EciI, MmeI, NmeAIII, BbvCI, Bpu10I, BspQI, SapI, BaeI, BsaXI, CspCI, BfiI, MboII, Acc36I, FokI or Clo051. In certain embodiments of the disclosure, the type IIS endonuclease may comprise, consist essentially of or consist of Clo051 (SEQ ID NO: 14503).

    [0410] In certain embodiments of the gene editing systems described herein, the DNA binding domain and the nuclease domain may be covalently linked. For example, a fusion protein may comprise the DNA binding domain and the nuclease domain. In certain embodiments of the genomic editing compositions or constructs of the disclosure, the DNA binding domain and the nuclease domain may be operably linked through a non-covalent linkage.

    Therapeutic Proteins

    [0411] In certain embodiments of the composition and methods of the disclosure, modified immune or immune precursor cells express therapeutic proteins. Therapeutic proteins of the disclosure include secreted proteins. Preferably, in a therapeutic context, the therapeutic protein is a human protein, including a secreted human protein. When expressed or secreted by immune or immune precursor cells of the disclosure, the combination comprising the immune or immune precursor cell and the therapeutic protein secreted therefrom may be considered a monotherapy. However, the immune or immune precursor cells of the disclosure may be administered as a combination therapy with a second agent. Human therapeutic proteins of the disclosure include, but are not limited to, those provided at Table 1.

    TABLE-US-00160 TABLE 1 Exemplary Human Secreted Proteins Gene Name Gene Description Protein SEQ ID NO A1BG Alpha-1-B glycoprotein SEQ ID NOS: 1-2 A2M Alpha-2-macroglobulin SEQ ID NOS: 3-6 A2ML1 Alpha-2-macroglobulin-like 1 SEQ ID NOS: 7-12 A4GNT Alpha-1,4-N-acetylglucosaminyltransferase SEQ ID NO: 13 AADACL2 Arylacetamide deacetylase-like 2 SEQ ID NOS: 14-15 AANAT Aralkylamine N-acetyltransferase SEQ ID NOS: 16-19 ABCG1 ATP-binding cassette, sub-family G (WHITE), SEQ ID NOS: 20-26 member 1 ABHD1 Abhydrolase domain containing 1 SEQ ID NOS: 27-31 ABHD10 Abhydrolase domain containing 10 SEQ ID NOS: 32-35 ABHD14A Abhydrolase domain containing 14A SEQ ID NOS: 36-40 ABHD15 Abhydrolase domain containing 15 SEQ ID NO: 41 ABI3BP ABI family, member 3 (NESH) binding protein SEQ ID NOS: 42-63 FAM175A Family with sequence similarity 175, member A SEQ ID NOS: 64-71 LA16c- SEQ ID NO: 72 380H5.3 AC008641.1 SEQ ID NO: 73 CTB- SEQ ID NOS: 74-75 601318.6 AC009133.22 SEQ ID NO: 76 AC009491.2 SEQ ID NO: 77 RP11- SEQ ID NOS: 78-80 977G19.10 CTD- SEQ ID NOS: 81-84 2370N5.3 RP11- SEQ ID NOS: 85-87 196G11.1 AC136352.5 SEQ ID NO: 88 RP11- SEQ ID NO: 89 812E19.9 AC145212.4 MaFF-interacting protein SEQ ID NO: 90 AC233755.1 SEQ ID NO: 91 AC011513.3 SEQ ID NOS: 92-93 ACACB Acetyl-CoA carboxylase beta SEQ ID NOS: 94-100 ACAN Aggrecan SEQ ID NOS: 101-108 ACE Angiotensin I converting enzyme SEQ ID NOS: 109-121 ACHE Acetylcholinesterase (Yt blood group) SEQ ID NOS: 122-134 ACP2 Acid phosphatase 2, lysosomal SEQ ID NOS: 135-142 ACP5 Acid phosphatase 5, tartrate resistant SEQ ID NOS: 143-151 ACP6 Acid phosphatase 6, lysophosphatidic SEQ ID NOS: 152-158 PAPL Iron/zinc purple acid phosphatase-like protein SEQ ID NOS: 159-162 ACPP Acid phosphatase, prostate SEQ ID NOS: 163-167 ACR Acrosin SEQ ID NOS: 168-169 ACRBP Acrosin binding protein SEQ ID NOS: 170-174 ACRV1 Acrosomal vesicle protein 1 SEQ ID NOS: 175-178 ACSF2 Acyl-CoA synthetase family member 2 SEQ ID NOS: 179-187 ACTL10 Actin-like 10 SEQ ID NO: 188 ACVR1 Activin A receptor, type I SEQ ID NOS: 189-197 ACVR1C Activin A receptor, type IC SEQ ID NOS: 198-201 ACVRL1 Activin A receptor type II-like 1 SEQ ID NOS: 202-207 ACYP1 Acylphosphatase 1, erythrocyte (common) type SEQ ID NOS: 208-213 ACYP2 Acylphosphatase 2, muscle type SEQ ID NOS: 214-221 CECR1 Cat eye syndrome chromosome region, candidate 1 SEQ ID NOS: 222-229 ADAM10 ADAM metallopeptidase domain 10 SEQ ID NOS: 230-237 ADAM12 ADAM metallopeptidase domain 12 SEQ ID NOS: 238-240 ADAM15 ADAM metallopeptidase domain 15 SEQ ID NOS: 241-252 ADAM17 ADAM metallopeptidase domain 17 SEQ ID NOS: 253-255 ADAM18 ADAM metallopeptidase domain 18 SEQ ID NOS: 256-260 ADAM22 ADAM metallopeptidase domain 22 SEQ ID NOS: 261-269 ADAM28 ADAM metallopeptidase domain 28 SEQ ID NOS: 270-275 ADAM29 ADAM metallopeptidase domain 29 SEQ ID NOS: 276-284 ADAM32 ADAM metallopeptidase domain 32 SEQ ID NOS: 285-291 ADAM33 ADAM metallopeptidase domain 33 SEQ ID NOS: 292-296 ADAM7 ADAM metallopeptidase domain 7 SEQ ID NOS: 297-300 ADAM8 ADAM metallopeptidase domain 8 SEQ ID NOS: 301-305 ADAM9 ADAM metallopeptidase domain 9 SEQ ID NOS: 306-311 ADAMDEC1 ADAM-like, decysin 1 SEQ ID NOS: 312-314 ADAMTS1 ADAM metallopeptidase with thrombospondin type SEQ ID NOS: 315-318 1 motif, 1 ADAMTS10 ADAM metallopeptidase with thrombospondin type SEQ ID NOS: 319-324 1 motif, 10 ADAMTS12 ADAM metallopeptidase with thrombospondin type SEQ ID NOS: 325-327 1 motif, 12 ADAMTS13 ADAM metallopeptidase with thrombospondin type SEQ ID NOS: 328-335 1 motif, 13 ADAMTS14 ADAM metallopeptidase with thrombospondin type SEQ ID NOS: 336-337 1 motif, 14 ADAMTS15 ADAM metallopeptidase with thrombospondin type SEQ ID NO: 338 1 motif, 15 ADAMTS16 ADAM metallopeptidase with thrombospondin type SEQ ID NOS: 339-340 1 motif, 16 ADAMTS17 ADAM metallopeptidase with thrombospondin type SEQ ID NOS: 341-344 1 motif, 17 ADAMTS18 ADAM metallopeptidase with thrombospondin type SEQ ID NOS: 345-348 1 motif, 18 ADAMTS19 ADAM metallopeptidase with thrombospondin type SEQ ID NOS: 349-352 1 motif, 19 ADAMTS2 ADAM metallopeptidase with thrombospondin type SEQ ID NOS: 353-355 1 motif, 2 ADAMTS20 ADAM metallopeptidase with thrombospondin type SEQ ID NOS: 356-359 1 motif, 20 ADAMTS3 ADAM metallopeptidase with thrombospondin type SEQ ID NOS: 360-361 1 motif, 3 ADAMTS5 ADAM metallopeptidase with thrombospondin type SEQ ID NO: 362 1 motif, 5 ADAMTS6 ADAM metallopeptidase with thrombospondin type SEQ ID NOS: 363-364 1 motif, 6 ADAMTS7 ADAM metallopeptidase with thrombospondin type SEQ ID NO: 365 1 motif, 7 ADAMTS8 ADAM metallopeptidase with thrombospondin type SEQ ID NO: 366 1 motif, 8 ADAMTS9 ADAM metallopeptidase with thrombospondin type SEQ ID NOS: 367-371 1 motif, 9 ADAMTSL1 ADAMTS-like 1 SEQ ID NOS: 372-382 ADAMTSL2 ADAMTS-like 2 SEQ ID NOS: 383-385 ADAMTSL3 ADAMTS-like 3 SEQ ID NOS: 386-387 ADAMTSL4 ADAMTS-like 4 SEQ ID NOS: 388-391 ADAMTSL5 ADAMTS-like 5 SEQ ID NOS: 392-397 ADCK1 AarF domain containing kinase 1 SEQ ID NOS: 398-402 ADCYAP1 Adenylate cyclase activating polypeptide 1 SEQ ID NOS: 403-404 (pituitary) ADCYAP1R1 Adenylate cyclase activating polypeptide 1 SEQ ID NOS: 405-411 (pituitary) receptor type I ADGRA3 Adhesion G protein-coupled receptor A3 SEQ ID NOS: 412-416 ADGRB2 Adhesion G protein-coupled receptor B2 SEQ ID NOS: 417-425 ADGRD1 Adhesion G protein-coupled receptor D1 SEQ ID NOS: 426-431 ADGRE3 Adhesion G protein-coupled receptor E3 SEQ ID NOS: 432-436 ADGRE5 Adhesion G protein-coupled receptor E5 SEQ ID NOS: 437-442 ADGRF1 Adhesion G protein-coupled receptor F1 SEQ ID NOS: 443-447 ADGRG1 Adhesion G protein-coupled receptor G1 SEQ ID NOS: 448-512 ADGRG5 Adhesion G protein-coupled receptor G5 SEQ ID NOS: 513-515 ADGRG6 Adhesion G protein-coupled receptor G6 SEQ ID NOS: 516-523 ADGRV1 Adhesion G protein-coupled receptor V1 SEQ ID NOS: 524-540 ADI1 Acireductone dioxygenase 1 SEQ ID NOS: 541-543 ADIG Adipogenin SEQ ID NOS: 544-547 ADIPOQ Adiponectin, C1Q and collagen domain containing SEQ ID NOS: 548-549 ADM Adrenomedullin SEQ ID NOS: 550-557 ADM2 Adrenomedullin 2 SEQ ID NOS: 558-559 ADM5 Adrenomedullin 5 (putative) SEQ ID NO: 560 ADPGK ADP-dependent glucokinase SEQ ID NOS: 561-570 ADPRHL2 ADP-ribosylhydrolase like 2 SEQ ID NO: 571 AEBP1 AE binding protein 1 SEQ ID NOS: 572-579 LACE1 Lactation elevated 1 SEQ ID NOS: 580-583 AFM Afamin SEQ ID NO: 584 AFP Alpha-fetoprotein SEQ ID NOS: 585-586 AGA Aspartylglucosaminidase SEQ ID NOS: 587-589 AGER Advanced glycosylation end product-specific SEQ ID NOS: 590-600 receptor AGK Acylglycerol kinase SEQ ID NOS: 601-606 AGPS Alkylglycerone phosphate synthase SEQ ID NOS: 607-610 AGR2 Anterior gradient 2, protein disulphide isomerase SEQ ID NOS: 611-614 family member AGR3 Anterior gradient 3, protein disulphide isomerase SEQ ID NOS: 615-617 family member AGRN Agrin SEQ ID NOS: 618-621 AGRP Agouti related neuropeptide SEQ ID NO: 622 AGT Angiotensinogen (serpin peptidase inhibitor, clade A, SEQ ID NO: 623 member 8) AGTPBP1 ATP/GTP binding protein 1 SEQ ID NOS: 624-627 AGTRAP Angiotensin 11 receptor-associated protein SEQ ID NOS: 628-635 AHCYL2 Adenosylhomocysteinase-like 2 SEQ ID NOS: 636-642 AHSG Alpha-2-HS-glycoprotein SEQ ID NOS: 643-644 AIG1 Androgen-induced 1 SEQ ID NOS: 645-653 AK4 Adenylate kinase 4 SEQ ID NOS: 654-657 AKAP10 A kinase (PRKA) anchor protein 10 SEQ ID NOS: 658-666 AKR1C1 Aldo-keto reductase family 1, member C1 SEQ ID NOS: 667-669 RP4- SEQ ID NOS: 670-672 576H24.4 SERPINA3 Serpin peptidase inhibitor, clade A (alpha-1 SEQ ID NO: 673 antiproteinase, antitrypsin), member 3 RP11-14J7.7 SEQ ID NOS: 674-675 RP11- SEQ ID NO: 676 903H12.5 AL356289.1 SEQ ID NO: 677 AL589743.1 SEQ ID NO: 678 XXbac- SEQ ID NOS: 679-680 BPG116M5.17 XXbac- SEQ ID NO: 681 BPG181M17.5 XXbac- SEQ ID NO: 682 BPG32J3.20 RP11- SEQ ID NO: 683 350O14.18 ALAS2 5′-aminolevulinate synthase 2 SEQ ID NOS: 684-691 ALB Albumin SEQ ID NOS: 692-701 ALDH9A1 Aldehyde dehydrogenase 9 family, member A1 SEQ ID NO: 702 ALDOA Aldolase A, fructose-bisphosphate SEQ ID NOS: 703-717 ALG1 ALG1, chitobiosyldiphosphodolichol beta- SEQ ID NOS: 718-723 mannosyltransferase ALG5 ALG5, dolichyl-phosphate beta-glucosyltransferase SEQ ID NOS: 724-725 ALG9 ALG9, alpha-1,2-mannosyltransferase SEQ ID NOS: 726-736 FAM150A Family with sequence similarity 150, member A SEQ ID NOS: 737-738 FAM150B Family with sequence similarity 150, member B SEQ ID NOS: 739-745 ALKBH1 AlkB homolog 1, histone H2A dioxygenase SEQ ID NOS: 746-748 ALKBH5 AlkB homolog 5, RNA demethylase SEQ ID NOS: 749-750 ALPI Alkaline phosphatase, intestinal SEQ ID NOS: 751-752 ALPL Alkaline phosphatase, liver/bone/kidney SEQ ID NOS: 753-757 ALPP Alkaline phosphatase, placental SEQ ID NO: 758 ALPPL2 Alkaline phosphatase, placental-like 2 SEQ ID NO: 759 AMBN Ameloblastin (enamel matrix protein) SEQ ID NOS: 760-762 AMBP Alpha-1-microglobulin/bikunin precursor SEQ ID NOS: 763-765 AMELX Amelogenin, X-linked SEQ ID NOS: 766-768 AMELY Amelogenin, Y-linked SEQ ID NOS: 769-770 AMH Anti-Mullerian hormone SEQ ID NO: 771 AMPD1 Adenosine monophosphate deaminase 1 SEQ ID NOS: 772-774 AMTN Amelotin SEQ ID NOS: 775-776 AMY1A Amylase, alpha 1A (salivary) SEQ ID NOS: 777-779 AMY1B Amylase, alpha 1B (salivary) SEQ ID NOS: 780-783 AMY1C Amylase, alpha 1C (salivary) SEQ ID NO: 784 AMY2A Amylase, alpha 2A (pancreatic) SEQ ID NOS: 785-787 AMY2B Amylase, alpha 2B (pancreatic) SEQ ID NOS: 788-792 ANG Angiogenin, ribonuclease, RNase A family, 5 SEQ ID NOS: 793-794 ANGEL1 Angel homolog 1 (Drosophila) SEQ ID NOS: 795-798 ANGPT1 Angiopoietin 1 SEQ ID NOS: 799-803 ANGPT2 Angiopoietin 2 SEQ ID NOS: 804-807 ANGPT4 Angiopoietin 4 SEQ ID NO: 808 ANGPTL1 Angiopoietin-like 1 SEQ ID NOS: 809-811 ANGPTL2 Angiopoietin-like 2 SEQ ID NOS: 812-813 ANGPTL3 Angiopoietin-like 3 SEQ ID NO: 814 ANGPTL4 Angiopoietin-like 4 SEQ ID NOS: 815-822 ANGPTL5 Angiopoietin-like 5 SEQ ID NOS: 823-824 ANGPTL6 Angiopoietin-like 6 SEQ ID NOS: 825-827 ANGPTL7 Angiopoietin-like 7 SEQ ID NO: 828 C19orf80 Chromosome 19 open reading frame 80 SEQ ID NOS: 829-832 ANK1 Ankyrin 1, erythrocytic SEQ ID NOS: 833-843 ANKDD1A Ankyrin repeat and death domain containing 1A SEQ ID NOS: 844-850 ANKRD54 Ankyrin repeat domain 54 SEQ ID NOS: 851-859 ANKRD60 Ankyrin repeat domain 60 SEQ ID NO: 860 ANO7 Anoctamin 7 SEQ ID NOS: 861-864 ANOS1 Anosmin 1 SEQ ID NO: 865 ANTXR1 Anthrax toxin receptor 1 SEQ ID NOS: 866-869 AOAH Acyloxyacyl hydrolase (neutrophil) SEQ ID NOS: 870-874 AOC1 Amine oxidase, copper containing 1 SEQ ID NOS: 875-880 AOC2 Amine oxidase, copper containing 2 (retina-specific) SEQ ID NOS: 881-882 AOC3 Amine oxidase, copper containing 3 SEQ ID NOS: 883-889 AP000721.4 SEQ ID NO: 890 APBB1 Amyloid beta (A4) precursor protein-binding, family SEQ ID NOS: 891-907 B, member 1 (Fe65) APCDD1 Adenomatosis polyposis coli down-regulated 1 SEQ ID NOS: 908-913 APCS Amyloid P component, serum SEQ ID NO: 914 APELA Apelin receptor early endogenous ligand SEQ ID NOS: 915-917 APLN Apelin SEQ ID NO: 918 APLP2 Amyloid beta (A4) precursor-like protein 2 SEQ ID NOS: 919-928 APOA1 Apolipoprotein A-I SEQ ID NOS: 929-933 APOA2 Apolipoprotein A-II SEQ ID NOS: 934-942 APOA4 Apolipoprotein A-IV SEQ ID NO: 943 APOA5 Apolipoprotein A-V SEQ ID NOS: 944-946 APOB Apolipoprotein B SEQ ID NOS: 947-948 APOC1 Apolipoprotein C-I SEQ ID NOS: 949-957 APOC2 Apolipoprotein C-II SEQ ID NOS: 958-962 APOC3 Apolipoprotein C-III SEQ ID NOS: 963-966 APOC4 Apolipoprotein C-IV SEQ ID NOS: 967-968 APOC4- APOC4-APOC2 readthrough (NMD candidate) SEQ ID NOS: 969-970 APOC2 APOD Apolipoprotein D SEQ ID NOS: 971-974 APOE Apolipoprotein E SEQ ID NOS: 975-978 APOF Apolipoprotein F SEQ ID NO: 979 APOH Apolipoprotein H (beta-2-glycoprotein I) SEQ ID NOS: 980-983 APOL1 Apolipoprotein L, 1 SEQ ID NOS: 984-994 APOL3 Apolipoprotein L, 3 SEQ ID NOS: 995-1009 APOM Apolipoprotein M SEQ ID NOS: 1010-1012 APOOL Apolipoprotein O-like SEQ ID NOS: 1013-1015 ARCN1 Archain 1 SEQ ID NOS: 1016-1020 ARFIP2 ADP-ribosylation factor interacting protein 2 SEQ ID NOS: 1021-1027 ARHGAP36 Rho GTPase activating protein 36 SEQ ID NOS: 1028-1033 HMHA1 Histocompatibility (minor) HA-1 SEQ ID NOS: 1034-1042 ARHGAP6 Rho GTPase activating protein 6 SEQ ID NOS: 1043-1048 ARHGEF4 Rho guanine nucleotide exchange factor (GEF) 4 SEQ ID NOS: 1049-1059 ARL16 ADP-ribosylation factor-like 16 SEQ ID NOS: 1060-1068 ARMC5 Armadillo repeat containing 5 SEQ ID NOS: 1069-1075 ARNTL Aryl hydrocarbon receptor nuclear translocator-like SEQ ID NOS: 1076-1090 ARSA Arylsulfatase A SEQ ID NOS: 1091-1096 ARSB Arylsulfatase B SEQ ID NOS: 1097-1100 ARSE Arylsulfatase E (chondrodysplasia punctata 1) SEQ ID NOS: 1101-1104 ARSG Arylsulfatase G SEQ ID NOS: 1105-1108 ARSI Arylsulfatase family, member I SEQ ID NOS: 1109-1111 ARSK Arylsulfatase family, member K SEQ ID NOS: 1112-1116 ART3 ADP-ribosyltransferase 3 SEQ ID NOS: 1117-1124 ART4 ADP-ribosyltransferase 4 (Dombrock blood group) SEQ ID NOS: 1125-1128 ART5 ADP-ribosyltransferase 5 SEQ ID NOS: 1129-1133 ARTN Artemin SEQ ID NOS: 1134-1144 ASAH1 N-acylsphingosine amidohydrolase (acid SEQ ID NOS: 1145-1195 ceramidase) 1 ASAH2 N-acylsphingosine amidohydrolase (non-lysosomal SEQ ID NOS: 1196-1201 ceramidase) 2 ASCL1 Achaete-scute family bHLH transcription factor 1 SEQ ID NO: 1202 ASIP Agouti signaling protein SEQ ID NOS: 1203-1204 ASPN Asporin SEQ ID NOS: 1205-1206 ASTL Astacin-like metallo-endopeptidase (M12 family) SEQ ID NO: 1207 ATAD5 ATPase family, AAA domain containing 5 SEQ ID NOS: 1208-1209 ATAT1 Alpha tubulin acetyltransferase 1 SEQ ID NOS: 1210-1215 ATG2A Autophagy related 2A SEQ ID NOS: 1216-1218 ATG5 Autophagy related 5 SEQ ID NOS: 1219-1227 ATMIN ATM interactor SEQ ID NOS: 1228-1231 ATP13A1 ATPase type 13A1 SEQ ID NOS: 1232-1234 ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo SEQ ID NOS: 1235-1236 complex, subunit B1 ATP6AP1 ATPase, H+ transporting, lysosomal accessory SEQ ID NOS: 1237-1244 protein 1 ATP6AP2 ATPase, H+ transporting, lysosomal accessory SEQ ID NOS: 1245-1267 protein 2 ATPAF1 ATP synthase mitochondrial F1 complex assembly SEQ ID NOS: 1268-1278 factor 1 AUH AU RNA binding protein/enoyl-CoA hydratase SEQ ID NOS: 1279-1280 AVP Arginine vasopressin SEQ ID NO: 1281 AXIN2 Axin 2 SEQ ID NOS: 1282-1289 AZGP1 Alpha-2-glycoprotein 1, zinc-binding SEQ ID NOS: 1290-1292 AZU1 Azurocidin 1 SEQ ID NOS: 1293-1294 B2M Beta-2-microglobulin SEQ ID NOS: 1295-1301 B3GALNT1 Beta-1,3-N-acetylgalactosaminyltransferase 1 SEQ ID NOS: 1302-1314 (globoside blood group) B3GALNT2 Beta-1,3-N-acetylgalactosaminyltransferase 2 SEQ ID NOS: 1315-1317 B3GALT1 UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, SEQ ID NO: 1318 polypeptide 1 B3GALT4 UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, SEQ ID NO: 1319 polypeptide 4 B3GALT5 UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, SEQ ID NOS: 1320-1324 polypeptide 5 B3GALT6 UDP-Gal:betaGal beta 1,3-galactosyltransferase SEQ ID NO: 1325 polypeptide 6 B3GAT3 Beta-1,3-glucuronyltransferase 3 SEQ ID NOS: 1326-1330 B3GLCT Beta 3-glucosyltransferase SEQ ID NO: 1331 B3GNT3 UDP-GlcNAc:betaGal beta-1,3-N- SEQ ID NOS: 1332-1335 acetylglucosaminyltransferase 3 B3GNT4 UDP-GlcNAc:betaGal beta-1,3-N- SEQ ID NOS: 1336-1339 acetylglucosaminyltransferase 4 B3GNT6 UDP-GlcNAc:betaGal beta-1,3-N- SEQ ID NOS: 1340-1341 acetylglucosaminyltransferase 6 B3GNT7 UDP-GlcNAc:betaGal beta-1,3-N- SEQ ID NO: 1342 acetylglucosaminyltransferase 7 B3GNT8 UDP-GlcNAc:betaGal beta-1,3-N- SEQ ID NO: 1343 acetylglucosaminyltransferase 8 B3GNT9 UDP-GlcNAc:betaGal beta-1,3-N- SEQ ID NO: 1344 acetylglucosaminyltransferase 9 B4GALNT1 Beta-1,4-N-acetyl-galactosaminyl transferase 1 SEQ ID NOS: 1345-1356 B4GALNT3 Beta-1,4-N-acetyl-galactosaminyl transferase 3 SEQ ID NOS: 1357-1358 B4GALNT4 Beta-1,4-N-acetyl-galactosaminyl transferase 4 SEQ ID NOS: 1359-1361 B4GALT4 UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, SEQ ID NOS: 1362-1375 polypeptide 4 B4GALT5 UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, SEQ ID NO: 1376 polypeptide 5 B4GALT6 UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, SEQ ID NOS: 1377-1380 polypeptide 6 B4GAT1 Beta-1,4-glucuronyltransferase 1 SEQ ID NO: 1381 B9D1 B9 protein domain 1 SEQ ID NOS: 1382-1398 BACE2 Beta-site APP-cleaving enzyme 2 SEQ ID NOS: 1399-1401 BAGE5 B melanoma antigen family, member 5 SEQ ID NO: 1402 BCAM Basal cell adhesion molecule (Lutheran blood group) SEQ ID NOS: 1403-1406 BCAN Brevican SEQ ID NOS: 1407-1413 BCAP29 B-cell receptor-associated protein 29 SEQ ID NOS: 1414-1426 BCAR1 Breast cancer anti-estrogen resistance 1 SEQ ID NOS: 1427-1444 BCHE Butyrylcholinesterase SEQ ID NOS: 1445-1449 BCKDHB Branched chain keto acid dehydrogenase E1, beta SEQ ID NOS: 1450-1452 polypeptide BDNF Brain-derived neurotrophic factor SEQ ID NOS: 1453-1470 BGLAP Bone gamma-carboxyglutamate (gla) protein SEQ ID NO: 1471 BGN Biglycan SEQ ID NOS: 1472-1473 BLVRB Biliverdin reductase B SEQ ID NOS: 1474-1478 BMP1 Bone morphogenetic protein 1 SEQ ID NOS: 1479-1490 BMP10 Bone morphogenetic protein 10 SEQ ID NO: 1491 BMP15 Bone morphogenetic protein 15 SEQ ID NO: 1492 BMP2 Bone morphogenetic protein 2 SEQ ID NO: 1493 BMP3 Bone morphogenetic protein 3 SEQ ID NO: 1494 BMP4 Bone morphogenetic protein 4 SEQ ID NOS: 1495-1502 BMP6 Bone morphogenetic protein 6 SEQ ID NO: 1503 BMP7 Bone morphogenetic protein 7 SEQ ID NOS: 1504-1507 BMP8A Bone morphogenetic protein 8a SEQ ID NO: 1508 BMP8B Bone morphogenetic protein 8b SEQ ID NO: 1509 BMPER BMP binding endothelial regulator SEQ ID NOS: 1510-1513 BNC1 Basonuclin 1 SEQ ID NOS: 1514-1515 BOC BOC cell adhesion associated, oncogene regulated SEQ ID NOS: 1516-1526 BOD1 Biorientation of chromosomes in cell division 1 SEQ ID NOS: 1527-1531 BOLA1 BolA family member 1 SEQ ID NOS: 1532-1534 BPI Bactericidal/permeability-increasing protein SEQ ID NOS: 1535-1538 BPIFA1 BPI fold containing family A, member 1 SEQ ID NOS: 1539-1542 BPIFA2 BPI fold containing family A, member 2 SEQ ID NOS: 1543-1544 BPIFA3 BPI fold containing family A, member 3 SEQ ID NOS: 1545-1546 BPIFB1 BPI fold containing family B, member 1 SEQ ID NOS: 1547-1548 BPIFB2 BPI fold containing family B, member 2 SEQ ID NO: 1549 BPIFB3 BPI fold containing family B, member 3 SEQ ID NO: 1550 BPIFB4 BPI fold containing family B, member 4 SEQ ID NOS: 1551-1552 BPIFB6 BPI fold containing family B, member 6 SEQ ID NOS: 1553-1554 BPIFC BPI fold containing family C SEQ ID NOS: 1555-1558 BRF1 BRF1, RNA polymerase III transcription initiation SEQ ID NOS: 1559-1574 factor 90 kDa subunit BRINP1 Bone morphogenetic protein/retinoic acid inducible SEQ ID NOS: 1575-1576 neural-specific 1 BRINP2 Bone morphogenetic protein/retinoic acid inducible SEQ ID NO: 1577 neural-specific 2 BRINP3 Bone morphogenetic protein/retinoic acid inducible SEQ ID NOS: 1578-1580 neural-specific 3 BSG Basigin (Ok blood group) SEQ ID NOS: 1581-1591 BSPH1 Binder of sperm protein homolog 1 SEQ ID NO: 1592 BST1 Bone marrow stromal cell antigen 1 SEQ ID NOS: 1593-1597 BTBD17 BTB (POZ) domain containing 17 SEQ ID NO: 1598 BTD Biotinidase SEQ ID NOS: 1599-1608 BTN2A2 Butyrophilin, subfamily 2, member A2 SEQ ID NOS: 1609-1622 BTN3A1 Butyrophilin, subfamily 3, member A1 SEQ ID NOS: 1623-1629 BTN3A2 Butyrophilin, subfamily 3, member A2 SEQ ID NOS: 1630-1640 BTN3A3 Butyrophilin, subfamily 3, member A3 SEQ ID NOS: 1641-1649 RP4- Complement factor H-related protein 2 SEQ ID NO: 1650 608O15.3 C10orf99 Chromosome 10 open reading frame 99 SEQ ID NO: 1651 C11orf1 Chromosome 11 open reading frame 1 SEQ ID NOS: 1652-1656 C11orf24 Chromosome 11 open reading frame 24 SEQ ID NOS: 1657-1659 C11orf45 Chromosome 11 open reading frame 45 SEQ ID NOS: 1660-1661 C11orf94 Chromosome 11 open reading frame 94 SEQ ID NO: 1662 C12orf10 Chromosome 12 open reading frame 10 SEQ ID NOS: 1663-1666 C12orf49 Chromosome 12 open reading frame 49 SEQ ID NOS: 1667-1670 C12orf73 Chromosome 12 open reading frame 73 SEQ ID NOS: 1671-1680 C12orf76 Chromosome 12 open reading frame 76 SEQ ID NOS: 1681-1688 C14orf93 Chromosome 14 open reading frame 93 SEQ ID NOS: 1689-1704 C16orf89 Chromosome 16 open reading frame 89 SEQ ID NOS: 1705-1707 C16orf90 Chromosome 16 open reading frame 90 SEQ ID NOS: 1708-1709 C17orf67 Chromosome 17 open reading frame 67 SEQ ID NO: 1710 C17orf75 Chromosome 17 open reading frame 75 SEQ ID NOS: 1711-1719 C17orf99 Chromosome 17 open reading frame 99 SEQ ID NOS: 1720-1722 C18orf54 Chromosome 18 open reading frame 54 SEQ ID NOS: 1723-1727 C19orf47 Chromosome 19 open reading frame 47 SEQ ID NOS: 1728-1735 C19orf70 Chromosome 19 open reading frame 70 SEQ ID NOS: 1736-1739 C1GALT1 Core 1 synthase, glycoprotein-N- SEQ ID NOS: 1740-1744 acetylgalactosamine 3-beta-galactosyltransferase 1 C1orf127 Chromosome 1 open reading frame 127 SEQ ID NOS: 1745-1748 C1orf159 Chromosome 1 open reading frame 159 SEQ ID NOS: 1749-1761 C1orf198 Chromosome 1 open reading frame 198 SEQ ID NOS: 1762-1766 C1orf54 Chromosome 1 open reading frame 54 SEQ ID NOS: 1767-1769 C1orf56 Chromosome 1 open reading frame 56 SEQ ID NO: 1770 C1QA Complement component 1, q subcomponent, A SEQ ID NOS: 1771-1773 chain C1QB Complement component 1, q subcomponent, B SEQ ID NOS: 1774-1777 chain C1QC Complement component 1, q subcomponent, C SEQ ID NOS: 1778-1780 chain C1QL1 Complement component 1, q subcomponent-like 1 SEQ ID NO: 1781 C1QL2 Complement component 1, q subcomponent-like 2 SEQ ID NO: 1782 C1QL3 Complement component 1, q subcomponent-like 3 SEQ ID NOS: 1783-1784 C1QL4 Complement component 1, q subcomponent-like 4 SEQ ID NO: 1785 C1QTNF1 C1q and tumor necrosis factor related protein 1 SEQ ID NOS: 1786-1795 FAM132A Family with sequence similarity 132, member A SEQ ID NO: 1796 C1QTNF2 C1q and tumor necrosis factor related protein 2 SEQ ID NO: 1797 C1QTNF3 C1q and tumor necrosis factor related protein 3 SEQ ID NOS: 1798-1799 C1QTNF4 C1q and tumor necrosis factor related protein 4 SEQ ID NOS: 1800-1801 C1QTNF5 C1q and tumor necrosis factor related protein 5 SEQ ID NOS: 1802-1804 C1QTNF7 C1q and tumor necrosis factor related protein 7 SEQ ID NOS: 1805-1809 C1QTNF8 C1q and tumor necrosis factor related protein 8 SEQ ID NOS: 1810-1811 C1QTNF9 C1q and tumor necrosis factor related protein 9 SEQ ID NOS: 1812-1813 C1QTNF9B C1q and tumor necrosis factor related protein 9B SEQ ID NOS: 1814-1816 C1R Complement component 1, r subcomponent SEQ ID NOS: 1817-1825 C1RL Complement component 1, r subcomponent-like SEQ ID NOS: 1826-1834 C1S Complement component 1, s subcomponent SEQ ID NOS: 1835-1844 C2 Complement component 2 SEQ ID NOS: 1845-1859 C21orf33 Chromosome 21 open reading frame 33 SEQ ID NOS: 1860-1868 C21orf62 Chromosome 21 open reading frame 62 SEQ ID NOS: 1869-1872 C22orf15 Chromosome 22 open reading frame 15 SEQ ID NOS: 1873-1875 C22orf46 Chromosome 22 open reading frame 46 SEQ ID NO: 1876 C2CD2 C2 calcium-dependent domain containing 2 SEQ ID NOS: 1877-1879 C2orf40 Chromosome 2 open reading frame 40 SEQ ID NOS: 1880-1882 C2orf66 Chromosome 2 open reading frame 66 SEQ ID NO: 1883 C2orf69 Chromosome 2 open reading frame 69 SEQ ID NO: 1884 C2orf78 Chromosome 2 open reading frame 78 SEQ ID NO: 1885 C3 Complement component 3 SEQ ID NOS: 1886-1890 C3orf33 Chromosome 3 open reading frame 33 SEQ ID NOS: 1891-1895 C3orf58 Chromosome 3 open reading frame 58 SEQ ID NOS: 1896-1899 C4A Complement component 4A (Rodgers blood group) SEQ ID NOS: 1900-1901 C4B Complement component 4B (Chido blood group) SEQ ID NOS: 1902-1903 C4BPA Complement component 4 binding protein, alpha SEQ ID NOS: 1904-1906 C4BPB Complement component 4 binding protein, beta SEQ ID NOS: 1907-1911 C4orf48 Chromosome 4 open reading frame 48 SEQ ID NOS: 1912-1913 C5 Complement component 5 SEQ ID NO: 1914 C5orf46 Chromosome 5 open reading frame 46 SEQ ID NOS: 1915-1916 C6 Complement component 6 SEQ ID NOS: 1917-1920 C6orf120 Chromosome 6 open reading frame 120 SEQ ID NO: 1921 C6orf15 Chromosome 6 open reading frame 15 SEQ ID NO: 1922 C6orf58 Chromosome 6 open reading frame 58 SEQ ID NO: 1923 C7 Complement component 7 SEQ ID NO: 1924 C7orf57 Chromosome 7 open reading frame 57 SEQ ID NOS: 1925-1929 C8A Complement component 8, alpha polypeptide SEQ ID NO: 1930 C8B Complement component 8, beta polypeptide SEQ ID NOS: 1931-1933 C8G Complement component 8, gamma polypeptide SEQ ID NOS: 1934-1935 C9 Complement component 9 SEQ ID NO: 1936 C9orf47 Chromosome 9 open reading frame 47 SEQ ID NOS: 1937-1939 CA10 Carbonic anhydrase X SEQ ID NOS: 1940-1946 CA11 Carbonic anhydrase XI SEQ ID NOS: 1947-1948 CA6 Carbonic anhydrase VI SEQ ID NOS: 1949-1953 CA9 Carbonic anhydrase IX SEQ ID NOS: 1954-1955 CABLES1 Cdk5 and Abl enzyme substrate 1 SEQ ID NOS: 1956-1961 CABP1 Calcium binding protein 1 SEQ ID NOS: 1962-1965 CACNA2D1 Calcium channel, voltage-dependent, alpha 2/delta SEQ ID NOS: 1966-1969 subunit 1 CACNA2D4 Calcium channel, voltage-dependent, alpha 2/delta SEQ ID NOS: 1970-1983 subunit 4 CADM3 Cell adhesion molecule 3 SEQ ID NOS: 1984-1986 CALCA Calcitonin-related polypeptide alpha SEQ ID NOS: 1987-1991 CALCB Calcitonin-related polypeptide beta SEQ ID NOS: 1992-1994 CALCR Calcitonin receptor SEQ ID NOS: 1995-2001 CALCRL Calcitonin receptor-like SEQ ID NOS: 2002-2006 FAM26D Family with sequence similarity 26, member D SEQ ID NOS: 2007-2011 CALR Calreticulin SEQ ID NOS: 2012-2015 CALR3 Calreticulin 3 SEQ ID NOS: 2016-2017 CALU Calumenin SEQ ID NOS: 2018-2023 CAMK2D Calcium/calmodulin-dependent protein kinase II SEQ ID NOS: 2024-2035 delta CAMP Cathelicidin antimicrobial peptide SEQ ID NO: 2036 CANX Calnexin SEQ ID NOS: 2037-2051 CARM1 Coactivator-associated arginine methyltransferase 1 SEQ ID NOS: 2052-2059 CARNS1 Carnosine synthase 1 SEQ ID NOS: 2060-2062 CARTPT CART prepropeptide SEQ ID NO: 2063 CASQ1 Calsequestrin 1 (fast-twitch, skeletal muscle) SEQ ID NOS: 2064-2065 CASQ2 Calsequestrin 2 (cardiac muscle) SEQ ID NO: 2066 CATSPERG Catsper channel auxiliary subunit gamma SEQ ID NOS: 2067-2074 CBLN1 Cerebellin 1 precursor SEQ ID NOS: 2075-2077 CBLN2 Cerebellin 2 precursor SEQ ID NOS: 2078-2081 CBLN3 Cerebellin 3 precursor SEQ ID NOS: 2082-2083 CBLN4 Cerebellin 4 precursor SEQ ID NO: 2084 CCBE1 Collagen and calcium binding EGF domains 1 SEQ ID NOS: 2085-2087 CCDC112 Coiled-coil domain containing 112 SEQ ID NOS: 2088-2091 CCDC129 Coiled-coil domain containing 129 SEQ ID NOS: 2092-2099 CCDC134 Coiled-coil domain containing 134 SEQ ID NOS: 2100-2101 CCDC149 Coiled-coil domain containing 149 SEQ ID NOS: 2102-2105 CCDC3 Coiled-coil domain containing 3 SEQ ID NOS: 2106-2107 CCDC80 Coiled-coil domain containing 80 SEQ ID NOS: 2108-2111 CCDC85A Coiled-coil domain containing 85A SEQ ID NO: 2112 CCDC88B Coiled-coil domain containing 88B SEQ ID NOS: 2113-2115 CCER2 Coiled-coil glutamate-rich protein 2 SEQ ID NOS: 2116-2117 CCK Cholecystokinin SEQ ID NOS: 2118-2120 CCL1 Chemokine (C-C motif) ligand 1 SEQ ID NO: 2121 CCL11 Chemokine (C-C motif) ligand 11 SEQ ID NO: 2122 CCL13 Chemokine (C-C motif) ligand 13 SEQ ID NOS: 2123-2124 CCL14 Chemokine (C-C motif) ligand 14 SEQ ID NOS: 2125-2128 CCL15 Chemokine (C-C motif) ligand 15 SEQ ID NOS: 2129-2130 CCL16 Chemokine (C-C motif) ligand 16 SEQ ID NOS: 2131-2133 CCL17 Chemokine (C-C motif) ligand 17 SEQ ID NOS: 2134-2135 CCL18 Chemokine (C-C motif) ligand 18 (pulmonary and SEQ ID NO: 2136 activation-regulated) CCL19 Chemokine (C-C motif) ligand 19 SEQ ID NOS: 2137-2138 CCL2 Chemokine (C-C motif) ligand 2 SEQ ID NOS: 2139-2140 CCL20 Chemokine (C-C motif) ligand 20 SEQ ID NOS: 2141-2143 CCL21 Chemokine (C-C motif) ligand 21 SEQ ID NOS: 2144-2145 CCL22 Chemokine (C-C motif) ligand 22 SEQ ID NO: 2146 CCL23 Chemokine (C-C motif) ligand 23 SEQ ID NOS: 2147-2149 CCL24 Chemokine (C-C motif) ligand 24 SEQ ID NOS: 2150-2151 CCL25 Chemokine (C-C motif) ligand 25 SEQ ID NOS: 2152-2155 CCL26 Chemokine (C-C motif) ligand 26 SEQ ID NOS: 2156-2157 CCL27 Chemokine (C-C motif) ligand 27 SEQ ID NO: 2158 CCL28 Chemokine (C-C motif) ligand 28 SEQ ID NOS: 2159-2161 CCL3 Chemokine (C-C motif) ligand 3 SEQ ID NO: 2162 CCL3L3 Chemokine (C-C motif) ligand 3-like 3 SEQ ID NO: 2163 CCL4 Chemokine (C-C motif) ligand 4 SEQ ID NOS: 2164-2165 CCL4L2 Chemokine (C-C motif) ligand 4-like 2 SEQ ID NOS: 2166-2175 CCL5 Chemokine (C-C motif) ligand 5 SEQ ID NOS: 2176-2178 CCL7 Chemokine (C-C motif) ligand 7 SEQ ID NOS: 2179-2181 CCL8 Chemokine (C-C motif) ligand 8 SEQ ID NO: 2182 CCNB1IP1 Cyclin B1 interacting protein 1, E3 ubiquitin protein SEQ ID NOS: 2183-2194 ligase CCNL1 Cyclin L1 SEQ ID NOS: 2195-2203 CCNL2 Cyclin L2 SEQ ID NOS: 2204-2211 CD14 CD14 molecule SEQ ID NOS: 2212-2216 CD160 CD160 molecule SEQ ID NOS: 2217-2221 CD164 CD164 molecule, sialomucin SEQ ID NOS: 2222-2227 CD177 CD177 molecule SEQ ID NOS: 2228-2230 CD1E CD1e molecule SEQ ID NOS: 2231-2244 CD2 CD2 molecule SEQ ID NOS: 2245-2246 CD200 CD200 molecule SEQ ID NOS: 2247-2253 CD200R1 CD200 receptor 1 SEQ ID NOS: 2254-2258 CD22 CD22 molecule SEQ ID NOS: 2259-2276 CD226 CD226 molecule SEQ ID NOS: 2277-2284 CD24 CD24 molecule SEQ ID NOS: 2285-2291 CD276 CD276 molecule SEQ ID NOS: 2292-2307 CD300A CD300a molecule SEQ ID NOS: 2308-2312 CD300LB CD300 molecule-like family member b SEQ ID NOS: 2313-2314 CD300LF CD300 molecule-like family member f SEQ ID NOS: 2315-2323 CD300LG CD300 molecule-like family member g SEQ ID NOS: 2324-2329 CD3D CD3d molecule, delta (CD3-TCR complex) SEQ ID NOS: 2330-2333 CD4 CD4 molecule SEQ ID NOS: 2334-2336 CD40 CD40 molecule, TNF receptor superfamily member 5 SEQ ID NOS: 2337-2340 CD44 CD44 molecule (Indian blood group) SEQ ID NOS: 2341-2367 CD48 CD48 molecule SEQ ID NOS: 2368-2370 CD5 CD5 molecule SEQ ID NOS: 2371-2372 CD55 CD55 molecule, decay accelerating factor for SEQ ID NOS: 2373-2383 complement (Cromer blood group) CD59 CD59 molecule, complement regulatory protein SEQ ID NOS: 2384-2394 CD5L CD5 molecule-like SEQ ID NO: 2395 CD6 CD6 molecule SEQ ID NOS: 2396-2403 CD68 CD68 molecule SEQ ID NOS: 2404-2407 CD7 CD7 molecule SEQ ID NOS: 2408-2413 CD79A CD79a molecule, immunoglobulin-associated alpha SEQ ID NOS: 2414-2416 CD80 CD80 molecule SEQ ID NOS: 2417-2419 CD86 CD86 molecule SEQ ID NOS: 2420-2426 CD8A CD8a molecule SEQ ID NOS: 2427-2430 CD8B CD8b molecule SEQ ID NOS: 2431-2436 CD99 CD99 molecule SEQ ID NOS: 2437-2445 CDC23 Cell division cycle 23 SEQ ID NOS: 2446-2450 CDC40 Cell division cycle 40 SEQ ID NOS: 2451-2453 CDC45 Cell division cycle 45 SEQ ID NOS: 2454-2460 CDCP1 CUB domain containing protein 1 SEQ ID NOS: 2461-2462 CDCP2 CUB domain containing protein 2 SEQ ID NOS: 2463-2464 CDH1 Cadherin 1, type 1 SEQ ID NOS: 2465-2472 CDH11 Cadherin 11, type 2, OB-cadherin (osteoblast) SEQ ID NOS: 2473-2482 CDH13 Cadherin 13 SEQ ID NOS: 2483-2492 CDH17 Cadherin 17, LI cadherin (liver-intestine) SEQ ID NOS: 2493-2497 CDH18 Cadherin 18, type 2 SEQ ID NOS: 2498-2504 CDH19 Cadherin 19, type 2 SEQ ID NOS: 2505-2509 CDH23 Cadherin-related 23 SEQ ID NOS: 2510-2525 CDH5 Cadherin 5, type 2 (vascular endothelium) SEQ ID NOS: 2526-2533 CDHR1 Cadherin-related family member 1 SEQ ID NOS: 2534-2539 CDHR4 Cadherin-related family member 4 SEQ ID NOS: 2540-2544 CDHR5 Cadherin-related family member 5 SEQ ID NOS: 2545-2551 CDKN2A Cyclin-dependent kinase inhibitor 2A SEQ ID NOS: 2552-2562 CDNF Cerebral dopamine neurotrophic factor SEQ ID NOS: 2563-2564 CDON Cell adhesion associated, oncogene regulated SEQ ID NOS: 2565-2572 CDSN Corneodesmosin SEQ ID NO: 2573 CEACAM16 Carcinoembryonic antigen-related cell adhesion SEQ ID NOS: 2574-2575 molecule 16 CEACAM18 Carcinoembryonic antigen-related cell adhesion SEQ ID NO: 2576 molecule 18 CEACAM19 Carcinoembryonic antigen-related cell adhesion SEQ ID NOS: 2577-2583 molecule 19 CEACAM5 Carcinoembryonic antigen-related cell adhesion SEQ ID NOS: 2584-2591 molecule 5 CEACAM7 Carcinoembryonic antigen-related cell adhesion SEQ ID NOS: 2592-2594 molecule 7 CEACAM8 Carcinoembryonic antigen-related cell adhesion SEQ ID NOS: 2595-2596 molecule 8 CEL Carboxyl ester lipase SEQ ID NO: 2597 CELA2A Chymotrypsin-like elastase family, member 2A SEQ ID NO: 2598 CELA2B Chymotrypsin-like elastase family, member 2B SEQ ID NOS: 2599-2600 CELA3A Chymotrypsin-like elastase family, member 3A SEQ ID NOS: 2601-2603 CELA3B Chymotrypsin-like elastase family, member 3B SEQ ID NOS: 2604-2606 CEMIP Cell migration inducing protein, hyaluronan binding SEQ ID NOS: 2607-2611 CEP89 Centrosomal protein 89 kDa SEQ ID NOS: 2612-2617 CER1 Cerberus 1, DAN family BMP antagonist SEQ ID NO: 2618 CERCAM Cerebral endothelial cell adhesion molecule SEQ ID NOS: 2619-2626 CERS1 Ceramide synthase 1 SEQ ID NOS: 2627-2631 CES1 Carboxylesterase 1 SEQ ID NOS: 2632-2637 CES3 Carboxylesterase 3 SEQ ID NOS: 2638-2642 CES4A Carboxylesterase 4A SEQ ID NOS: 2643-2648 CES5A Carboxylesterase 5A SEQ ID NOS: 2649-2656 CETP Cholesteryl ester transfer protein, plasma SEQ ID NOS: 2657-2659 CCDC108 Coiled-coil domain containing 108 SEQ ID NOS: 2660-2669 CFB Complement factor B SEQ ID NOS: 2670-2674 CFC1 Cripto, FRL-1, cryptic family 1 SEQ ID NOS: 2675-2677 CFC1B Cripto, FRL-1, cryptic family 1B SEQ ID NOS: 2678-2680 CFD Complement factor D (adipsin) SEQ ID NOS: 2681-2682 CFDP1 Craniofacial development protein 1 SEQ ID NOS: 2683-2686 CFH Complement factor H SEQ ID NOS: 2687-2689 CFHR1 Complement factor H-related 1 SEQ ID NOS: 2690-2691 CFHR2 Complement factor H-related 2 SEQ ID NOS: 2692-2693 CFHR3 Complement factor H-related 3 SEQ ID NOS: 2694-2698 CFHR4 Complement factor H-related 4 SEQ ID NOS: 2699-2702 CFHR5 Complement factor H-related 5 SEQ ID NO: 2703 CFI Complement factor I SEQ ID NOS: 2704-2708 CFP Complement factor properdin SEQ ID NOS: 2709-2712 CGA Glycoprotein hormones, alpha polypeptide SEQ ID NOS: 2713-2717 CGB1 Chorionic gonadotropin, beta polypeptide 1 SEQ ID NOS: 2718-2719 CGB2 Chorionic gonadotropin, beta polypeptide 2 SEQ ID NOS: 2720-2721 CGB Chorionic gonadotropin, beta polypeptide SEQ ID NO: 2722 CGB5 Chorionic gonadotropin, beta polypeptide 5 SEQ ID NO: 2723 CGB7 Chorionic gonadotropin, beta polypeptide 7 SEQ ID NOS: 2724-2726 CGB8 Chorionic gonadotropin, beta polypeptide 8 SEQ ID NO: 2727 CGREF1 Cell growth regulator with EF-hand domain 1 SEQ ID NOS: 2728-2735 CHAD Chondroadherin SEQ ID NOS: 2736-2738 CHADL Chondroadherin-like SEQ ID NOS: 2739-2741 CHEK2 Checkpoint kinase 2 SEQ ID NOS: 2742-2763 CHGA Chromogranin A SEQ ID NOS: 2764-2766 CHGB Chromogranin B SEQ ID NOS: 2767-2768 CHI3L1 Chitinase 3-like 1 (cartilage glycoprotein-39) SEQ ID NOS: 2769-2770 CHI3L2 Chitinase 3-like 2 SEQ ID NOS: 2771-2784 CHIA Chitinase, acidic SEQ ID NOS: 2785-2793 CHID1 Chitinase domain containing 1 SEQ ID NOS: 2794-2812 CHIT1 Chitinase 1 (chitotriosidase) SEQ ID NOS: 2813-2816 CHL1 Cell adhesion molecule L1-like SEQ ID NOS: 2817-2825 CHN1 Chimerin 1 SEQ ID NOS: 2826-2836 CHPF Chondroitin polymerizing factor SEQ ID NOS: 2837-2839 CHPF2 Chondroitin polymerizing factor 2 SEQ ID NOS: 2840-2843 CHRD Chordin SEQ ID NOS: 2844-2849 CHRDL1 Chordin-like 1 SEQ ID NOS: 2850-2854 CHRDL2 Chordin-like 2 SEQ ID NOS: 2855-2863 CHRNA2 Cholinergic receptor, nicotinic, alpha 2 (neuronal) SEQ ID NOS: 2864-2872 CHRNA5 Cholinergic receptor, nicotinic, alpha 5 (neuronal) SEQ ID NOS: 2873-2876 CHRNB1 Cholinergic receptor, nicotinic, beta 1 (muscle) SEQ ID NOS: 2877-2882 CHRND Cholinergic receptor, nicotinic, delta (muscle) SEQ ID NOS: 2883-2888 CHST1 Carbohydrate (keratan sulfate Gal-6) SEQ ID NO: 2889 sulfotransferase 1 CHST10 Carbohydrate sulfotransferase 10 SEQ ID NOS: 2890-2897 CHST11 Carbohydrate (chondroitin 4) sulfotransferase 11 SEQ ID NOS: 2898-2902 CHST13 Carbohydrate (chondroitin 4) sulfotransferase 13 SEQ ID NOS: 2903-2904 CHST4 Carbohydrate (N-acetylglucosamine 6-O) SEQ ID NOS: 2905-2906 sulfotransferase 4 CHST5 Carbohydrate (N-acetylglucosamine 6-O) SEQ ID NOS: 2907-2908 sulfotransferase 5 CHST6 Carbohydrate (N-acetylglucosamine 6-O) SEQ ID NOS: 2909-2910 sulfotransferase 6 CHST7 Carbohydrate (N-acetylglucosamine 6-O) SEQ ID NO: 2911 sulfotransferase 7 CHST8 Carbohydrate (N-acetylgalactosamine 4-0) SEQ ID NOS: 2912-2915 sulfotransferase 8 CHSY1 Chondroitin sulfate synthase 1 SEQ ID NOS: 2916-2917 CHSY3 Chondroitin sulfate synthase 3 SEQ ID NO: 2918 CHTF8 Chromosome transmission fidelity factor 8 SEQ ID NOS: 2919-2929 CILP Cartilage intermediate layer protein, nucleotide SEQ ID NO: 2930 pyrophosphohydrolase CILP2 Cartilage intermediate layer protein 2 SEQ ID NOS: 2931-2932 CKLF Chemokine-like factor SEQ ID NOS: 2933-2938 CKMT1A Creatine kinase, mitochondrial 1A SEQ ID NOS: 2939-2944 CKMT1B Creatine kinase, mitochondrial 1B SEQ ID NOS: 2945-2954 CLCA1 Chloride channel accessory 1 SEQ ID NOS: 2955-2956 CLCF1 Cardiotrophin-like cytokine factor 1 SEQ ID NOS: 2957-2958 CLDN15 Claudin 15 SEQ ID NOS: 2959-2964 CLDN7 Claudin 7 SEQ ID NOS: 2965-2971 CLDND1 Claudin domain containing 1 SEQ ID NOS: 2972-2997 CLEC11A C-type lectin domain family 11, member A SEQ ID NOS: 2998-3000 CLEC16A C-type lectin domain family 16, member A SEQ ID NOS: 3001-3006 CLEC18A C-type lectin domain family 18, member A SEQ ID NOS: 3007-3012 CLEC18B C-type lectin domain family 18, member B SEQ ID NOS: 3013-3016 CLEC18C C-type lectin domain family 18, member C SEQ ID NOS: 3017-3023 CLEC19A C-type lectin domain family 19, member A SEQ ID NOS: 3024-3027 CLEC2B C-type lectin domain family 2, member B SEQ ID NOS: 3028-3029 CLEC3A C-type lectin domain family 3, member A SEQ ID NOS: 3030-3031 CLEC3B C-type lectin domain family 3, member B SEQ ID NOS: 3032-3033 CLGN Calmegin SEQ ID NOS: 3034-3036 CLN5 Ceroid-lipofuscinosis, neuronal 5 SEQ ID NOS: 3037-3048 CLPS Colipase, pancreatic SEQ ID NOS: 3049-3051 CLPSL1 Colipase-like 1 SEQ ID NOS: 3052-3053 CLPSL2 Colipase-like 2 SEQ ID NOS: 3054-3055 CLPX Caseinolytic mitochondrial matrix peptidase SEQ ID NOS: 3056-3058 chaperone subunit CLSTN3 Calsyntenin 3 SEQ ID NOS: 3059-3065 CLU Clusterin SEQ ID NOS: 3066-3079 CLUL1 Clusterin-like 1 (retinal) SEQ ID NOS: 3080-3087 CMA1 Chymase 1, mast cell SEQ ID NOS: 3088-3089 CMPK1 Cytidine monophosphate (UMP-CMP) kinase 1, SEQ ID NOS: 3090-3093 cytosolic CNBD1 Cyclic nucleotide binding domain containing 1 SEQ ID NOS: 3094-3097 CNDP1 Carnosine dipeptidase 1 (metallopeptidase M20 SEQ ID NOS: 3098-3100 family) RQCD1 RCD1 required for cell differentiation1 homolog (S. SEQ ID NOS: 3101-3107 pombe) CNPY2 Canopy FGF signaling regulator 2 SEQ ID NOS: 3108-3112 CNPY3 Canopy FGF signaling regulator 3 SEQ ID NOS: 3113-3114 CNPY4 Canopy FGF signaling regulator 4 SEQ ID NOS: 3115-3117 CNTFR Ciliary neurotrophic factor receptor SEQ ID NOS: 3118-3121 CNTN1 Contactin 1 SEQ ID NOS: 3122-3131 CNTN2 Contactin 2 (axonal) SEQ ID NOS: 3132-3143 CNTN3 Contactin 3 (plasmacytoma associated) SEQ ID NO: 3144 CNTN4 Contactin 4 SEQ ID NOS: 3145-3153 CNTN5 Contactin 5 SEQ ID NOS: 3154-3159 CNTNAP2 Contactin associated protein-like 2 SEQ ID NOS: 3160-3163 CNTNAP3 Contactin associated protein-like 3 SEQ ID NOS: 3164-3168 CNTNAP3B Contactin associated protein-like 3B SEQ ID NOS: 3169-3177 COASY CoA synthase SEQ ID NOS: 3178-3187 COCH Cochlin SEQ ID NOS: 3188-3199 COG3 Component of oligomeric golgi complex 3 SEQ ID NOS: 3200-3203 COL10A1 Collagen, type X, alpha 1 SEQ ID NOS: 3204-3207 COL11A1 Collagen, type XI, alpha 1 SEQ ID NOS: 3208-3218 COL11A2 Collagen, type XI, alpha 2 SEQ ID NOS: 3219-3223 COL12A1 Collagen, type XII, alpha 1 SEQ ID NOS: 3224-3231 COL14A1 Collagen, type XIV, alpha 1 SEQ ID NOS: 3232-3239 COL15A1 Collagen, type XV, alpha 1 SEQ ID NOS: 3240-3241 COL16A1 Collagen, type XVI, alpha 1 SEQ ID NOS: 3242-3246 COL18A1 Collagen, type XVIII, alpha 1 SEQ ID NOS: 3247-3251 COL19A1 Collagen, type XIX, alpha 1 SEQ ID NOS: 3252-3254 COL1A1 Collagen, type I, alpha 1 SEQ ID NOS: 3255-3256 COL1A2 Collagen, type I, alpha 2 SEQ ID NOS: 3257-3258 COL20A1 Collagen, type XX, alpha 1 SEQ ID NOS: 3259-3262 COL21A1 Collagen, type XXI, alpha 1 SEQ ID NOS: 3263-3268 COL22A1 Collagen, type XXII, alpha 1 SEQ ID NOS: 3269-3271 COL24A1 Collagen, type XXIV, alpha 1 SEQ ID NOS: 3272-3275 COL26A1 Collagen, type XXVI, alpha 1 SEQ ID NOS: 3276-3277 COL27A1 Collagen, type XXVII, alpha 1 SEQ ID NOS: 3278-3280 COL28A1 Collagen, type XXVIII, alpha 1 SEQ ID NOS: 3281-3285 COL2A1 Collagen, type II, alpha 1 SEQ ID NOS: 3286-3287 COL3A1 Collagen, type III, alpha 1 SEQ ID NOS: 3288-3290 COL4A1 Collagen, type IV, alpha 1 SEQ ID NOS: 3291-3293 COL4A2 Collagen, type IV, alpha 2 SEQ ID NOS: 3294-3296 COL4A3 Collagen, type IV, alpha 3 (Goodpasture antigen) SEQ ID NOS: 3297-3300 COL4A4 Collagen, type IV, alpha 4 SEQ ID NOS: 3301-3302 COL4A5 Collagen, type IV, alpha 5 SEQ ID NOS: 3303-3309 COL4A6 Collagen, type IV, alpha 6 SEQ ID NOS: 3310-3315 COL5A1 Collagen, type V, alpha 1 SEQ ID NOS: 3316-3318 COL5A2 Collagen, type V, alpha 2 SEQ ID NOS: 3319-3320 COL5A3 Collagen, type V, alpha 3 SEQ ID NO: 3321 COL6A1 Collagen, type VI, alpha 1 SEQ ID NOS: 3322-3323 COL6A2 Collagen, type VI, alpha 2 SEQ ID NOS: 3324-3329 COL6A3 Collagen, type VI, alpha 3 SEQ ID NOS: 3330-3338 COL6A5 Collagen, type VI, alpha 5 SEQ ID NOS: 3339-3343 COL6A6 Collagen, type VI, alpha 6 SEQ ID NOS: 3344-3346 COL7A1 Collagen, type VII, alpha 1 SEQ ID NOS: 3347-3348 COL8A1 Collagen, type VIII, alpha 1 SEQ ID NOS: 3349-3352 COL8A2 Collagen, type VIII, alpha 2 SEQ ID NOS: 3353-3355 COL9A1 Collagen, type IX, alpha 1 SEQ ID NOS: 3356-3359 COL9A2 Collagen, type IX, alpha 2 SEQ ID NOS: 3360-3363 COL9A3 Collagen, type IX, alpha 3 SEQ ID NOS: 3364-3365 COLEC10 Collectin sub-family member 10 (C-type lectin) SEQ ID NO: 3366 COLEC11 Collectin sub-family member 11 SEQ ID NOS: 3367-3376 COLGALT1 Collagen beta(1-O)galactosyltransferase 1 SEQ ID NOS: 3377-3379 COLGALT2 Collagen beta(1-O)galactosyltransferase 2 SEQ ID NOS: 3380-3382 COLQ Collagen-like tail subunit (single strand of SEQ ID NOS: 3383-3387 homotrimer) of asymmetric acetylcholinesterase COMP Cartilage oligomeric matrix protein SEQ ID NOS: 3388-3390 COPS6 COP9 signalosome subunit 6 SEQ ID NOS: 3391-3394 COQ6 Coenzyme Q6 monooxygenase SEQ ID NOS: 3395-3402 CORT Cortistatin SEQ ID NO: 3403 CP Ceruloplasmin (ferroxidase) SEQ ID NOS: 3404-3408 CPA1 Carboxypeptidase A1 (pancreatic) SEQ ID NOS: 3409-3413 CPA2 Carboxypeptidase A2 (pancreatic) SEQ ID NOS: 3414-3415 CPA3 Carboxypeptidase A3 (mast cell) SEQ ID NO: 3416 CPA4 Carboxypeptidase A4 SEQ ID NOS: 3417-3422 CPA6 Carboxypeptidase A6 SEQ ID NOS: 3423-3425 CPAMD8 C3 and PZP-like, alpha-2-macroglobulin domain SEQ ID NOS: 3426-3431 containing 8 CPB1 Carboxypeptidase B1 (tissue) SEQ ID NOS: 3432-3436 CPB2 Carboxypeptidase B2 (plasma) SEQ ID NOS: 3437-3439 CPE Carboxypeptidase E SEQ ID NOS: 3440-3444 CPM Carboxypeptidase M SEQ ID NOS: 3445-3454 CPN1 Carboxypeptidase N, polypeptide 1 SEQ ID NOS: 3455-3456 CPN2 Carboxypeptidase N, polypeptide 2 SEQ ID NOS: 3457-3458 CPO Carboxypeptidase O SEQ ID NO: 3459 CPQ Carboxypeptidase Q SEQ ID NOS: 3460-3465 CPVL Carboxypeptidase, vitellogenic-like SEQ ID NOS: 3466-3476 CPXM1 Carboxypeptidase X (M14 family), member 1 SEQ ID NO: 3477 CPXM2 Carboxypeptidase X (M14 family), member 2 SEQ ID NOS: 3478-3479 CPZ Carboxypeptidase Z SEQ ID NOS: 3480-3483 CR1L Complement component (3b/4b) receptor 1-like SEQ ID NOS: 3484-3485 CRB2 Crumbs family member 2 SEQ ID NOS: 3486-3488 CREG1 Cellular repressor of E1A-stimulated genes 1 SEQ ID NO: 3489 CREG2 Cellular repressor of E1A-stimulated genes 2 SEQ ID NO: 3490 CRELD1 Cysteine-rich with EGF-like domains 1 SEQ ID NOS: 3491-3496 CRELD2 Cysteine-rich with EGF-like domains 2 SEQ ID NOS: 3497-3501 CRH Corticotropin releasing hormone SEQ ID NO: 3502 CRHBP Corticotropin releasing hormone binding protein SEQ ID NOS: 3503-3504 CRHR1 Corticotropin releasing hormone receptor 1 SEQ ID NOS: 3505-3516 CRHR2 Corticotropin releasing hormone receptor 2 SEQ ID NOS: 3517-3523 CRISP1 Cysteine-rich secretory protein 1 SEQ ID NOS: 3524-3527 CRISP2 Cysteine-rich secretory protein 2 SEQ ID NOS: 3528-3530 CRISP3 Cysteine-rich secretory protein 3 SEQ ID NOS: 3531-3534 CRISPLD2 Cysteine-rich secretory protein LCCL domain SEQ ID NOS: 3535-3542 containing 2 CRLF1 Cytokine receptor-like factor 1 SEQ ID NOS: 3543-3544 CRP C-reactive protein, pentraxin-related SEQ ID NOS: 3545-3549 CRTAC1 Cartilage acidic protein 1 SEQ ID NOS: 3550-3554 CRTAP Cartilage associated protein SEQ ID NOS: 3555-3556 CRY2 Cryptochrome circadian clock 2 SEQ ID NOS: 3557-3560 CSAD Cysteine sulfinic acid decarboxylase SEQ ID NOS: 3561-3573 CSF1 Colony stimulating factor 1 (macrophage) SEQ ID NOS: 3574-3581 CSF1R Colony stimulating factor 1 receptor SEQ ID NOS: 3582-3586 CSF2 Colony stimulating factor 2 (granulocyte- SEQ ID NO: 3587 macrophage) CSF2RA Colony stimulating factor 2 receptor, alpha, low- SEQ ID NOS: 3588-3599 affinity (granulocyte-macrophage) CSF3 Colony stimulating factor 3 (granulocyte) SEQ ID NOS: 3600-3606 CSGALNACT Chondroitin sulfate N- SEQ ID NOS: 3607-3615 1 acetylgalactosaminyltransferase 1 CSH1 Chorionic somatomammotropin hormone 1 SEQ ID NOS: 3616-3619 (placental lactogen) CSH2 Chorionic somatomammotropin hormone 2 SEQ ID NOS: 3620-3624 CSHL1 Chorionic somatomammotropin hormone-like 1 SEQ ID NOS: 3625-3631 CSN1S1 Casein alpha s1 SEQ ID NOS: 3632-3637 CSN2 Casein beta SEQ ID NO: 3638 CSN3 Casein kappa SEQ ID NO: 3639 CST1 Cystatin SN SEQ ID NOS: 3640-3641 CST11 Cystatin 11 SEQ ID NOS: 3642-3643 CST2 Cystatin SA SEQ ID NO: 3644 CST3 Cystatin C SEQ ID NOS: 3645-3647 CST4 Cystatin S SEQ ID NO: 3648 CST5 Cystatin D SEQ ID NO: 3649 CST6 Cystatin E/M SEQ ID NO: 3650 CST7 Cystatin F (leukocystatin) SEQ ID NO: 3651 CST8 Cystatin 8 (cystatin-related epididymal specific) SEQ ID NOS: 3652-3653 CST9 Cystatin 9 (testatin) SEQ ID NO: 3654 CST9L Cystatin 9-like SEQ ID NO: 3655 CSTL1 Cystatin-like 1 SEQ ID NOS: 3656-3658 CT55 Cancer/testis antigen 55 SEQ ID NOS: 3659-3660 CTBS Chitobiase, di-N-acetyl- SEQ ID NOS: 3661-3663 CTGF Connective tissue growth factor SEQ ID NO: 3664 CTHRC1 Collagen triple helix repeat containing 1 SEQ ID NOS: 3665-3668 CTLA4 Cytotoxic T-lymphocyte-associated protein 4 SEQ ID NOS: 3669-3672 CTNS Cystinosin, lysosomal cystine transporter SEQ ID NOS: 3673-3680 CTRB1 Chymotrypsinogen B1 SEQ ID NOS: 3681-3683 CTRB2 Chymotrypsinogen B2 SEQ ID NOS: 3684-3687 CTRC Chymotrypsin C (caldecrin) SEQ ID NOS: 3688-3689 CTRL Chymotrypsin-like SEQ ID NOS: 3690-3692 CTSA Cathepsin A SEQ ID NOS: 3693-3701 CTSB Cathepsin B SEQ ID NOS: 3702-3726 CTSC Cathepsin C SEQ ID NOS: 3727-3731 CTSD Cathepsin D SEQ ID NOS: 3732-3742 CTSE Cathepsin E SEQ ID NOS: 3743-3744 CTSF Cathepsin F SEQ ID NOS: 3745-3748 CTSG Cathepsin G SEQ ID NO: 3749 CTSH Cathepsin H SEQ ID NOS: 3750-3755 CTSK Cathepsin K SEQ ID NOS: 3756-3757 CTSL Cathepsin L SEQ ID NOS: 3758-3760 CTSO Cathepsin O SEQ ID NO: 3761 CTSS Cathepsin S SEQ ID NOS: 3762-3766 CTSV Cathepsin V SEQ ID NOS: 3767-3768 CTSW Cathepsin W SEQ ID NOS: 3769-3771 CTSZ Cathepsin Z SEQ ID NO: 3772 CUBN Cubilin (intrinsic factor-cobalamin receptor) SEQ ID NOS: 3773-3776 CUTA CutA divalent cation tolerance homolog (E. coli) SEQ ID NOS: 3777-3786 CX3CL1 Chemokine (C-X3-C motif) ligand 1 SEQ ID NOS: 3787-3790 CXADR Coxsackie virus and adenovirus receptor SEQ ID NOS: 3791-3795 CXCL1 Chemokine (C-X-C motif) ligand 1 (melanoma growth SEQ ID NO: 3796 stimulating activity, alpha) CXCL10 Chemokine (C-X-C motif) ligand 10 SEQ ID NO: 3797 CXCL11 Chemokine (C-X-C motif) ligand 11 SEQ ID NOS: 3798-3799 CXCL12 Chemokine (C-X-C motif) ligand 12 SEQ ID NOS: 3800-3805 CXCL13 Chemokine (C-X-C motif) ligand 13 SEQ ID NO: 3806 CXCL14 Chemokine (C-X-C motif) ligand 14 SEQ ID NOS: 3807-3808 CXCL17 Chemokine (C-X-C motif) ligand 17 SEQ ID NOS: 3809-3810 CXCL2 Chemokine (C-X-C motif) ligand 2 SEQ ID NO: 3811 CXCL3 Chemokine (C-X-C motif) ligand 3 SEQ ID NO: 3812 CXCL5 Chemokine (C-X-C motif) ligand 5 SEQ ID NO: 3813 CXCL6 Chemokine (C-X-C motif) ligand 6 SEQ ID NOS: 3814-3815 CXCL8 Chemokine (C-X-C motif) ligand 8 SEQ ID NOS: 3816-3817 CXCL9 Chemokine (C-X-C motif) ligand 9 SEQ ID NO: 3818 CXorf36 Chromosome X open reading frame 36 SEQ ID NOS: 3819-3820 CYB5D2 Cytochrome b5 domain containing 2 SEQ ID NOS: 3821-3824 CYHR1 Cysteine/histidine-rich 1 SEQ ID NOS: 3825-3832 CYP17A1 Cytochrome P450, family 17, subfamily A, SEQ ID NOS: 3833-3837 polypeptide 1 CYP20A1 Cytochrome P450, family 20, subfamily A, SEQ ID NOS: 3838-3844 polypeptide 1 CYP21A2 Cytochrome P450, family 21, subfamily A, SEQ ID NOS: 3845-3852 polypeptide 2 CYP26B1 Cytochrome P450, family 26, subfamily B, SEQ ID NOS: 3853-3857 polypeptide 1 CYP2A6 Cytochrome P450, family 2, subfamily A, SEQ ID NOS: 3858-3859 polypeptide 6 CYP2A7 Cytochrome P450, family 2, subfamily A, SEQ ID NOS: 3860-3862 polypeptide 7 CYP2B6 Cytochrome P450, family 2, subfamily B, SEQ ID NOS: 3863-3866 polypeptide 6 CYP2C18 Cytochrome P450, family 2, subfamily C, SEQ ID NOS: 3867-3868 polypeptide 18 CYP2C19 Cytochrome P450, family 2, subfamily C, SEQ ID NOS: 3869-3870 polypeptide 19 CYP2C8 Cytochrome P450, family 2, subfamily C, SEQ ID NOS: 3871-3878 polypeptide 8 CYP2C9 Cytochrome P450, family 2, subfamily C, SEQ ID NOS: 3879-3881 polypeptide 9 CYP2E1 Cytochrome P450, family 2, subfamily E, SEQ ID NOS: 3882-3887 polypeptide 1 CYP2F1 Cytochrome P450, family 2, subfamily F, SEQ ID NOS: 3888-3891 polypeptide 1 CYP2J2 Cytochrome P450, family 2, subfamily J, SEQ ID NO: 3892 polypeptide 2 CYP2R1 Cytochrome P450, family 2, subfamily R, SEQ ID NOS: 3893-3898 polypeptide 1 CYP2S1 Cytochrome P450, family 2, subfamily S, SEQ ID NOS: 3899-3904 polypeptide 1 CYP2W1 Cytochrome P450, family 2, subfamily W, SEQ ID NOS: 3905-3907 polypeptide 1 CYP46A1 Cytochrome P450, family 46, subfamily A, SEQ ID NOS: 3908-3912 polypeptide 1 CYP4F11 Cytochrome P450, family 4, subfamily F, SEQ ID NOS: 3913-3917 polypeptide 11 CYP4F2 Cytochrome P450, family 4, subfamily F, SEQ ID NOS: 3918-3922 polypeptide 2 CYR61 Cysteine-rich, angiogenic inducer, 61 SEQ ID NO: 3923 CYTL1 Cytokine-like 1 SEQ ID NOS: 3924-3926 D2HGDH D-2-hydroxyglutarate dehydrogenase SEQ ID NOS: 3927-3935 DAG1 Dystroglycan 1 (dystrophin-associated glycoprotein SEQ ID NOS: 3936-3950 1) DAND5 DAN domain family member 5, BMP antagonist SEQ ID NOS: 3951-3952 DAO D-amino-acid oxidase SEQ ID NOS: 3953-3958 DAZAP2 DAZ associated protein 2 SEQ ID NOS: 3959-3967 DBH Dopamine beta-hydroxylase (dopamine beta- SEQ ID NOS: 3968-3969 monooxygenase) DBNL Drebrin-like SEQ ID NOS: 3970-3987 DCD Dermcidin SEQ ID NOS: 3988-3990 DCN Decorin SEQ ID NOS: 3991-4009 DDIAS DNA damage-induced apoptosis suppressor SEQ ID NOS: 4010-4019 DDOST Dolichyl-diphosphooligosaccharide-protein SEQ ID NOS: 4020-4023 glycosyltransferase subunit (non-catalytic) DDR1 Discoidin domain receptor tyrosine kinase 1 SEQ ID NOS: 4024-4069 DDR2 Discoidin domain receptor tyrosine kinase 2 SEQ ID NOS: 4070-4075 DDT D-dopachrome tautomerase SEQ ID NOS: 4076-4081 DDX17 DEAD (Asp-Glu-Ala-Asp) box helicase 17 SEQ ID NOS: 4082-4086 DDX20 DEAD (Asp-Glu-Ala-Asp) box polypeptide 20 SEQ ID NOS: 4087-4089 DDX25 DEAD (Asp-Glu-Ala-Asp) box helicase 25 SEQ ID NOS: 4090-4096 DDX28 DEAD (Asp-Glu-Ala-Asp) box polypeptide 28 SEQ ID NO: 4097 DEAF1 DEAF1 transcription factor SEQ ID NOS: 4098-4100 DEF8 Differentially expressed in FDCP 8 homolog (mouse) SEQ ID NOS: 4101-4120 DEFA1 Defensin, alpha 1 SEQ ID NOS: 4121-4122 DEFA1B Defensin, alpha 1B SEQ ID NO: 4123 DEFA3 Defensin, alpha 3, neutrophil-specific SEQ ID NO: 4124 DEFA4 Defensin, alpha 4, corticostatin SEQ ID NO: 4125 DEFA5 Defensin, alpha 5, Paneth cell-specific SEQ ID NO: 4126 DEFA6 Defensin, alpha 6, Paneth cell-specific SEQ ID NO: 4127 DEFB1 Defensin, beta 1 SEQ ID NO: 4128 DEFB103A Defensin, beta 103A SEQ ID NO: 4129 DEFB103B Defensin, beta 103B SEQ ID NO: 4130 DEFB104A Defensin, beta 104A SEQ ID NO: 4131 DEFB104B Defensin, beta 104B SEQ ID NO: 4132 DEFB105A Defensin, beta 105A SEQ ID NO: 4133 DEFB105B Defensin, beta 105B SEQ ID NO: 4134 DEFB106A Defensin, beta 106A SEQ ID NO: 4135 DEFB106B Defensin, beta 106B SEQ ID NO: 4136 DEFB107A Defensin, beta 107A SEQ ID NO: 4137 DEFB107B Defensin, beta 107B SEQ ID NO: 4138 DEFB108B Defensin, beta 108B SEQ ID NO: 4139 DEFB110 Defensin, beta 110 SEQ ID NOS: 4140-4141 DEFB113 Defensin, beta 113 SEQ ID NO: 4142 DEFB114 Defensin, beta 114 SEQ ID NO: 4143 DEFB115 Defensin, beta 115 SEQ ID NO: 4144 DEFB116 Defensin, beta 116 SEQ ID NO: 4145 DEFB118 Defensin, beta 118 SEQ ID NO: 4146 DEFB119 Defensin, beta 119 SEQ ID NOS: 4147-4149 DEFB121 Defensin, beta 121 SEQ ID NO: 4150 DEFB123 Defensin, beta 123 SEQ ID NO: 4151 DEFB124 Defensin, beta 124 SEQ ID NO: 4152 DEFB125 Defensin, beta 125 SEQ ID NO: 4153 DEFB126 Defensin, beta 126 SEQ ID NO: 4154 DEFB127 Defensin, beta 127 SEQ ID NO: 4155 DEFB128 Defensin, beta 128 SEQ ID NO: 4156 DEFB129 Defensin, beta 129 SEQ ID NO: 4157 DEFB130 Defensin, beta 130 SEQ ID NO: 4158 RP11- SEQ ID NO: 4159 1236K1.1 DEFB131 Defensin, beta 131 SEQ ID NO: 4160 CTD- SEQ ID NO: 4161 2313N18.7 DEFB132 Defensin, beta 132 SEQ ID NO: 4162 DEFB133 Defensin, beta 133 SEQ ID NO: 4163 DEFB134 Defensin, beta 134 SEQ ID NOS: 4164-4165 DEFB135 Defensin, beta 135 SEQ ID NO: 4166 DEFB136 Defensin, beta 136 SEQ ID NO: 4167 DEFB4A Defensin, beta 4A SEQ ID NO: 4168 DEFB4B Defensin, beta 4B SEQ ID NO: 4169 C10orf10 Chromosome 10 open reading frame 10 SEQ ID NOS: 4170-4171 DGCR2 DiGeorge syndrome critical region gene 2 SEQ ID NOS: 4172-4175 DHH Desert hedgehog SEQ ID NO: 4176 DHRS4 Dehydrogenase/reductase (SDR family) member 4 SEQ ID NOS: 4177-4184 DHRS4L2 Dehydrogenase/reductase (SDR family) member 4 SEQ ID NOS: 4185-4194 like 2 DHRS7 Dehydrogenase/reductase (SDR family) member 7 SEQ ID NOS: 4195-4202 DHRS7C Dehydrogenase/reductase (SDR family) member 7C SEQ ID NOS: 4203-4205 DHRS9 Dehydrogenase/reductase (SDR family) member 9 SEQ ID NOS: 4206-4213 DHRSX Dehydrogenase/reductase (SDR family) X-linked SEQ ID NOS: 4214-4218 DHX29 DEAH (Asp-Glu-Ala-His) box polypeptide 29 SEQ ID NOS: 4219-4221 DHX30 DEAH (Asp-Glu-Ala-His) box helicase 30 SEQ ID NOS: 4222-4229 DHX8 DEAH (Asp-Glu-Ala-His) box polypeptide 8 SEQ ID NOS: 4230-4234 DIO2 Deiodinase, iodothyronine, type II SEQ ID NOS: 4235-4244 DIXDC1 DIX domain containing 1 SEQ ID NOS: 4245-4248 DKK1 Dickkopf WNT signaling pathway inhibitor 1 SEQ ID NO: 4249 DKK2 Dickkopf WNT signaling pathway inhibitor 2 SEQ ID NOS: 4250-4252 DKK3 Dickkopf WNT signaling pathway inhibitor 3 SEQ ID NOS: 4253-4258 DKK4 Dickkopf WNT signaling pathway inhibitor 4 SEQ ID NO: 4259 DKKL1 Dickkopf-like 1 SEQ ID NOS: 4260-4265 DLG4 Discs, large homolog 4 (Drosophila) SEQ ID NOS: 4266-4274 DLK1 Delta-like 1 homolog (Drosophila) SEQ ID NOS: 4275-4278 DLL1 Delta-like 1 (Drosophila) SEQ ID NOS: 4279-4280 DLL3 Delta-like 3 (Drosophila) SEQ ID NOS: 4281-4283 DMBT1 Deleted in malignant brain tumors 1 SEQ ID NOS: 4284-4290 DMKN Dermokine SEQ ID NOS: 4291-4337 DMP1 Dentin matrix acidic phosphoprotein 1 SEQ ID NOS: 4338-4339 DMRTA2 DMRT-like family A2 SEQ ID NOS: 4340-4341 DNAAF5 Dynein, axonemal, assembly factor 5 SEQ ID NOS: 4342-4345 DNAH14 Dynein, axonemal, heavy chain 14 SEQ ID NOS: 4346-4360 DNAJB11 DnaJ (Hsp40) homolog, subfamily B, member 11 SEQ ID NOS: 4361-4362 DNAJB9 DnaJ (Hsp40) homolog, subfamily B, member 9 SEQ ID NO: 4363 DNAJC25- DNAJC25-GNG10 readthrough SEQ ID NO: 4364 GNG10 DNAJC3 DnaJ (Hsp40) homolog, subfamily C, member 3 SEQ ID NOS: 4365-4366 DNASE1 Deoxyribonuclease I SEQ ID NOS: 4367-4377 DNASE1L1 Deoxyribonuclease I-like 1 SEQ ID NOS: 4378-4388 DNASE1L2 Deoxyribonuclease I-like 2 SEQ ID NOS: 4389-4394 DNASE1L3 Deoxyribonuclease I-like 3 SEQ ID NOS: 4395-4400 DNASE2 Deoxyribonuclease II, lysosomal SEQ ID NOS: 4401-4402 DNASE2B Deoxyribonuclease II beta SEQ ID NOS: 4403-4404 DPEP1 Dipeptidase 1 (renal) SEQ ID NOS: 4405-4409 DPEP2 Dipeptidase 2 SEQ ID NOS: 4410-4416 DPEP3 Dipeptidase 3 SEQ ID NO: 4417 DPF3 D4, zinc and double PHD fingers, family 3 SEQ ID NOS: 4418-4424 DPP4 Dipeptidyl-peptidase 4 SEQ ID NOS: 4425-4429 DPP7 Dipeptidyl-peptidase 7 SEQ ID NOS: 4430-4435 DPT Dermatopontin SEQ ID NO: 4436 DRAXIN Dorsal inhibitory axon guidance protein SEQ ID NO: 4437 DSE Dermatan sulfate epimerase SEQ ID NOS: 4438-4446 DSG2 Desmoglein 2 SEQ ID NOS: 4447-4448 DSPP Dentin sialophosphoprotein SEQ ID NOS: 4449-4450 DST Dystonin SEQ ID NOS: 4451-4469 DUOX1 Dual oxidase 1 SEQ ID NOS: 4470-4474 DYNLT3 Dynein, light chain, Tctex-type 3 SEQ ID NOS: 4475-4477 E2F5 E2F transcription factor 5, p130-binding SEQ ID NOS: 4478-4484 EBAG9 Estrogen receptor binding site associated, antigen, 9 SEQ ID NOS: 4485-4493 EBI3 Epstein-Barr virus induced 3 SEQ ID NO: 4494 ECHDC1 Ethylmalonyl-CoA decarboxylase 1 SEQ ID NOS: 4495-4513 ECM1 Extracellular matrix protein 1 SEQ ID NOS: 4514-4516 ECM2 Extracellular matrix protein 2, female organ and SEQ ID NOS: 4517-4520 adipocyte specific ECSIT ECSIT signalling integrator SEQ ID NOS: 4521-4532 EDDM3A Epididymal protein 3A SEQ ID NO: 4533 EDDM3B Epididymal protein 3B SEQ ID NO: 4534 EDEM2 ER degradation enhancer, mannosidase alpha-like 2 SEQ ID NOS: 4535-4536 EDEM3 ER degradation enhancer, mannosidase alpha-like 3 SEQ ID NOS: 4537-4539 EDIL3 EGF-like repeats and discoidin I-like domains 3 SEQ ID NOS: 4540-4541 EDN1 Endothelin 1 SEQ ID NO: 4542 EDN2 Endothelin 2 SEQ ID NO: 4543 EDN3 Endothelin 3 SEQ ID NOS: 4544-4549 EDNRB Endothelin receptor type B SEQ ID NOS: 4550-4558 EFEMP1 EGF containing fibulin-like extracellular matrix SEQ ID NOS: 4559-4569 protein 1 EFEMP2 EGF containing fibulin-like extracellular matrix SEQ ID NOS: 4570-4581 protein 2 EFNA1 Ephrin-A1 SEQ ID NOS: 4582-4583 EFNA2 Ephrin-A2 SEQ ID NO: 4584 EFNA4 Ephrin-A4 SEQ ID NOS: 4585-4587 EGFL6 EGF-like-domain, multiple 6 SEQ ID NOS: 4588-4589 EGFL7 EGF-like-domain, multiple 7 SEQ ID NOS: 4590-4594 EGFL8 EGF-like-domain, multiple 8 SEQ ID NOS: 4595-4597 EGFLAM EGF-like, fibronectin type III and laminin G domains SEQ ID NOS: 4598-4606 EGFR Epidermal growth factor receptor SEQ ID NOS: 4607-4614 EHBP1 EH domain binding protein 1 SEQ ID NOS: 4615-4626 EHF Ets homologous factor SEQ ID NOS: 4627-4636 EHMT1 Euchromatic histone-lysine N-methyltransferase 1 SEQ ID NOS: 4637-4662 EHMT2 Euchromatic histone-lysine N-methyltransferase 2 SEQ ID NOS: 4663-4667 EIF2AK1 Eukaryotic translation initiation factor 2-alpha SEQ ID NOS: 4668-4671 kinase 1 ELANE Elastase, neutrophil expressed SEQ ID NOS: 4672-4673 ELN Elastin SEQ ID NOS: 4674-4696 ELP2 Elongator acetyltransferase complex subunit 2 SEQ ID NOS: 4697-4709 ELSPBP1 Epididymal sperm binding protein 1 SEQ ID NOS: 4710-4715 EMC1 ER membrane protein complex subunit 1 SEQ ID NOS: 4716-4722 EMC10 ER membrane protein complex subunit 10 SEQ ID NOS: 4723-4729 EMC9 ER membrane protein complex subunit 9 SEQ ID NOS: 4730-4733 EMCN Endomucin SEQ ID NOS: 4734-4738 EMID1 EMI domain containing 1 SEQ ID NOS: 4739-4745 EMILIN1 Elastin microfibril interfacer 1 SEQ ID NOS: 4746-4747 EMILIN2 Elastin microfibril interfacer 2 SEQ ID NO: 4748 EMILIN3 Elastin microfibril interfacer 3 SEQ ID NO: 4749 ENAM Enamelin SEQ ID NO: 4750 ENDOG Endonuclease G SEQ ID NO: 4751 ENDOU Endonuclease, polyU-specific SEQ ID NOS: 4752-4754 ENHO Energy homeostasis associated SEQ ID NO: 4755 ENO4 Enolase family member 4 SEQ ID NOS: 4756-4760 ENPP6 Ectonucleotide pyrophosphatase/ SEQ ID NOS: 4761-4762 phosphodiesterase 6 ENPP7 Ectonucleotide pyrophosphatase/ SEQ ID NOS: 4763-4764 phosphodiesterase 7 ENTPD5 Ectonucleoside triphosphate diphosphohydrolase 5 SEQ ID NOS: 4765-4769 ENTPD8 Ectonucleoside triphosphate diphosphohydrolase 8 SEQ ID NOS: 4770-4773 EOGT EGF domain-specific O-linked N-acetylglucosamine SEQ ID NOS: 4774-4781 (GlcNAc) transferase EPCAM Epithelial cell adhesion molecule SEQ ID NOS: 4782-4785 EPDR1 Ependymin related 1 SEQ ID NOS: 4786-4789 EPGN Epithelial mitogen SEQ ID NOS: 4790-4798 EPHA10 EPH receptor A10 SEQ ID NOS: 4799-4806 EPHA3 EPH receptor A3 SEQ ID NOS: 4807-4809 EPHA4 EPH receptor A4 SEQ ID NOS: 4810-4819 EPHA7 EPH receptor A7 SEQ ID NOS: 4820-4821 EPHA8 EPH receptor A8 SEQ ID NOS: 4822-4823 EPHB2 EPH receptor B2 SEQ ID NOS: 4824-4828 EPHB4 EPH receptor B4 SEQ ID NOS: 4829-4831 EPHX3 Epoxide hydrolase 3 SEQ ID NOS: 4832-4835 EPO Erythropoietin SEQ ID NO: 4836 EPPIN Epididymal peptidase inhibitor SEQ ID NOS: 4837-4839 EPPIN- EPPIN-WFDC6 readthrough SEQ ID NO: 4840 WFDC6 EPS15 Epidermal growth factor receptor pathway SEQ ID NOS: 4841-4843 substrate 15 EPS8L1 EPS8-like 1 SEQ ID NOS: 4844-4849 EPX Eosinophil peroxidase SEQ ID NO: 4850 EPYC Epiphycan SEQ ID NOS: 4851-4852 EQTN Equatorin, sperm acrosome associated SEQ ID NOS: 4853-4855 ERAP1 Endoplasmic reticulum aminopeptidase 1 SEQ ID NOS: 4856-4861 ERAP2 Endoplasmic reticulum aminopeptidase 2 SEQ ID NOS: 4862-4869 ERBB3 Erb-b2 receptor tyrosine kinase 3 SEQ ID NOS: 4870-4883 FAM132B Family with sequence similarity 132, member B SEQ ID NOS: 4884-4886 ERLIN1 ER lipid raft associated 1 SEQ ID NOS: 4887-4889 ERLIN2 ER lipid raft associated 2 SEQ ID NOS: 4890-4898 ERN1 Endoplasmic reticulum to nucleus signaling 1 SEQ ID NOS: 4899-4900 ERN2 Endoplasmic reticulum to nucleus signaling 2 SEQ ID NOS: 4901-4905 ERO1A Endoplasmic reticulum oxidoreductase alpha SEQ ID NOS: 4906-4912 ERO1B Endoplasmic reticulum oxidoreductase beta SEQ ID NOS: 4913-4915 ERP27 Endoplasmic reticulum protein 27 SEQ ID NOS: 4916-4917 ERP29 Endoplasmic reticulum protein 29 SEQ ID NOS: 4918-4921 ERP44 Endoplasmic reticulum protein 44 SEQ ID NO: 4922 ERV3-1 Endogenous retrovirus group 3, member 1 SEQ ID NO: 4923 ESM1 Endothelial cell-specific molecule 1 SEQ ID NOS: 4924-4926 ESRP1 Epithelial splicing regulatory protein 1 SEQ ID NOS: 4927-4935 EXOG Endo/exonuclease (5′-3′), endonuclease G-like SEQ ID NOS: 4936-4949 EXTL1 Exostosin-like glycosyltransferase 1 SEQ ID NO: 4950 EXTL2 Exostosin-like glycosyltransferase 2 SEQ ID NOS: 4951-4955 F10 Coagulation factor X SEQ ID NOS: 4956-4959 F11 Coagulation factor XI SEQ ID NOS: 4960-4964 F12 Coagulation factor XII (Hageman factor) SEQ ID NO: 4965 F13B Coagulation factor XIII, B polypeptide SEQ ID NO: 4966 F2 Coagulation factor II (thrombin) SEQ ID NOS: 4967-4969 F2R Coagulation factor II (thrombin) receptor SEQ ID NOS: 4970-4971 F2RL3 Coagulation factor II (thrombin) receptor-like 3 SEQ ID NOS: 4972-4973 F5 Coagulation factor V (proaccelerin, labile factor) SEQ ID NOS: 4974-4975 F7 Coagulation factor VII (serum prothrombin SEQ ID NOS: 4976-4979 conversion accelerator) F8 Coagulation factor VIII, procoagulant component SEQ ID NOS: 4980-4985 F9 Coagulation factor IX SEQ ID NOS: 4986-4987 FABP6 Fatty acid binding protein 6, ileal SEQ ID NOS: 4988-4990 FAM107B Family with sequence similarity 107, member B SEQ ID NOS: 4991-5012 FAM131A Family with sequence similarity 131, member A SEQ ID NOS: 5013-5021 FAM171A1 Family with sequence similarity 171, member A1 SEQ ID NOS: 5022-5023 FAM171B Family with sequence similarity 171, member B SEQ ID NOS: 5024-5025 FAM172A Family with sequence similarity 172, member A SEQ ID NOS: 5026-5030 FAM177A1 Family with sequence similarity 177, member A1 SEQ ID NOS: 5031-5040 FAM180A Family with sequence similarity 180, member A SEQ ID NOS: 5041-5043 FAM189A1 Family with sequence similarity 189, member A1 SEQ ID NOS: 5044-5045 FAM198A Family with sequence similarity 198, member A SEQ ID NOS: 5046-5048 FAM19A1 Family with sequence similarity 19 (chemokine (C-C SEQ ID NOS: 5049-5051 motif)-like), member A1 FAM19A2 Family with sequence similarity 19 (chemokine (C-C SEQ ID NOS: 5052-5059 motif)-like), member A2 FAM19A3 Family with sequence similarity 19 (chemokine (C-C SEQ ID NOS: 5060-5061 motif)-like), member A3 FAM19A4 Family with sequence similarity 19 (chemokine (C-C SEQ ID NOS: 5062-5064 motif)-like), member A4 FAM19A5 Family with sequence similarity 19 (chemokine (C-C SEQ ID NOS: 5065-5068 motif)-like), member A5 FAM20A Family with sequence similarity 20, member A SEQ ID NOS: 5069-5072 FAM20C Family with sequence similarity 20, member C SEQ ID NO: 5073 FAM213A Family with sequence similarity 213, member A SEQ ID NOS: 5074-5079 FAM46B Family with sequence similarity 46, member B SEQ ID NO: 5080 FAM57A Family with sequence similarity 57, member A SEQ ID NOS: 5081-5086 FAM78A Family with sequence similarity 78, member A SEQ ID NOS: 5087-5089 FAM96A Family with sequence similarity 96, member A SEQ ID NOS: 5090-5094 FAM9B Family with sequence similarity 9, member B SEQ ID NOS: 5095-5098 FAP Fibroblast activation protein, alpha SEQ ID NOS: 5099-5105 FAS Fas cell surface death receptor SEQ ID NOS: 5106-5115 FAT1 FAT atypical cadherin 1 SEQ ID NOS: 5116-5122 FBLN1 Fibulin 1 SEQ ID NOS: 5123-5135 FBLN2 Fibulin 2 SEQ ID NOS: 5136-5141 FBLN5 Fibulin 5 SEQ ID NOS: 5142-5147 FBLN7 Fibulin 7 SEQ ID NOS: 5148-5153 FBN1 Fibrillin 1 SEQ ID NOS: 5154-5157 FBN2 Fibrillin 2 SEQ ID NOS: 5158-5163 FBN3 Fibrillin 3 SEQ ID NOS: 5164-5168 FBXW7 F-box and WD repeat domain containing 7, E3 SEQ ID NOS: 5169-5179 ubiquitin protein ligase FCAR Fc fragment of IgA receptor SEQ ID NOS: 5180-5189 FCGBP Fc fragment of IgG binding protein SEQ ID NOS: 5190-5192 FCGR1B Fc fragment of IgG, high affinity Ib, receptor (CD64) SEQ ID NOS: 5193-5198 FCGR3A Fc fragment of IgG, low affinity IIIa, receptor (CD16a) SEQ ID NOS: 5199-5205 FCGRT Fc fragment of IgG, receptor, transporter, alpha SEQ ID NOS: 5206-5216 FCMR Fc fragment of IgM receptor SEQ ID NOS: 5217-5223 FCN1 Ficolin (collagen/fibrinogen domain containing) 1 SEQ ID NOS: 5224-5225 FCN2 Ficolin (collagen/fibrinogen domain containing SEQ ID NOS: 5226-5227 lectin) 2 FCN3 Ficolin (collagen/fibrinogen domain containing) 3 SEQ ID NOS: 5228-5229 FCRL1 Fc receptor-like 1 SEQ ID NOS: 5230-5232 FCRL3 Fc receptor-like 3 SEQ ID NOS: 5233-5238 FCRL5 Fc receptor-like 5 SEQ ID NOS: 5239-5241 FCRLA Fc receptor-like A SEQ ID NOS: 5242-5253 FCRLB Fc receptor-like B SEQ ID NOS: 5254-5258 FDCSP Follicular dendritic cell secreted protein SEQ ID NO: 5259 FETUB Fetuin B SEQ ID NOS: 5260-5266 FGA Fibrinogen alpha chain SEQ ID NOS: 5267-5269 FGB Fibrinogen beta chain SEQ ID NOS: 5270-5272 FGF10 Fibroblast growth factor 10 SEQ ID NOS: 5273-5274 FGF17 Fibroblast growth factor 17 SEQ ID NOS: 5275-5276 FGF18 Fibroblast growth factor 18 SEQ ID NO: 5277 FGF19 Fibroblast growth factor 19 SEQ ID NO: 5278 FGF21 Fibroblast growth factor 21 SEQ ID NOS: 5279-5280 FGF22 Fibroblast growth factor 22 SEQ ID NOS: 5281-5282 FGF23 Fibroblast growth factor 23 SEQ ID NO: 5283 FGF3 Fibroblast growth factor 3 SEQ ID NO: 5284 FGF4 Fibroblast growth factor 4 SEQ ID NO: 5285 FGF5 Fibroblast growth factor 5 SEQ ID NOS: 5286-5288 FGF7 Fibroblast growth factor 7 SEQ ID NOS: 5289-5293 FGF8 Fibroblast growth factor 8 (androgen-induced) SEQ ID NOS: 5294-5299 FGFBP1 Fibroblast growth factor binding protein 1 SEQ ID NO: 5300 FGFBP2 Fibroblast growth factor binding protein 2 SEQ ID NO: 5301 FGFBP3 Fibroblast growth factor binding protein 3 SEQ ID NO: 5302 FGFR1 Fibroblast growth factor receptor 1 SEQ ID NOS: 5303-5325 FGFR2 Fibroblast growth factor receptor 2 SEQ ID NOS: 5326-5347 FGFR3 Fibroblast growth factor receptor 3 SEQ ID NOS: 5348-5355 FGFR4 Fibroblast growth factor receptor 4 SEQ ID NOS: 5356-5365 FGFRL1 Fibroblast growth factor receptor-like 1 SEQ ID NOS: 5366-5371 FGG Fibrinogen gamma chain SEQ ID NOS: 5372-5377 FGL1 Fibrinogen-like 1 SEQ ID NOS: 5378-5384 FGL2 Fibrinogen-like 2 SEQ ID NOS: 5385-5386 FHL1 Four and a half LIM domains 1 SEQ ID NOS: 5387-5414 FHOD3 Formin homology 2 domain containing 3 SEQ ID NOS: 5415-5421 FIBIN Fin bud initiation factor homolog (zebrafish) SEQ ID NO: 5422 FICD FIC domain containing SEQ ID NOS: 5423-5426 FJX1 Four jointed box 1 SEQ ID NO: 5427 FKBP10 FK506 binding protein 10, 65 kDa SEQ ID NOS: 5428-5433 FKBP11 FK506 binding protein 11, 19 kDa SEQ ID NOS: 5434-5440 FKBP14 FK506 binding protein 14, 22 kDa SEQ ID NOS: 5441-5443 FKBP2 FK506 binding protein 2, 13 kDa SEQ ID NOS: 5444-5447 FKBP7 FK506 binding protein 7 SEQ ID NOS: 5448-5453 FKBP9 FK506 binding protein 9, 63 kDa SEQ ID NOS: 5454-5457 FLT1 Fms-related tyrosine kinase 1 SEQ ID NOS: 5458-5466 FLT4 Fms-related tyrosine kinase 4 SEQ ID NOS: 5467-5471 FMO1 Flavin containing monooxygenase 1 SEQ ID NOS: 5472-5476 FMO2 Flavin containing monooxygenase 2 (non-functional) SEQ ID NOS: 5477-5479 FMO3 Flavin containing monooxygenase 3 SEQ ID NOS: 5480-5482 FMO5 Flavin containing monooxygenase 5 SEQ ID NOS: 5483-5489 FMOD Fibromodulin SEQ ID NO: 5490 FN1 Fibronectin 1 SEQ ID NOS: 5491-5503 FNDC1 Fibronectin type III domain containing 1 SEQ ID NOS: 5504-5505 FNDC7 Fibronectin type III domain containing 7 SEQ ID NOS: 5506-5507 FOCAD Focadhesin SEQ ID NOS: 5508-5514 FOLR2 Folate receptor 2 (fetal) SEQ ID NOS: 5515-5524 FOLR3 Folate receptor 3 (gamma) SEQ ID NOS: 5525-5529 FOXRED2 FAD-dependent oxidoreductase domain containing 2 SEQ ID NOS: 5530-5533 FP325331.1 Uncharacterized protein UNQ6126/PRO20091 SEQ ID NO: 5534 CH507- SEQ ID NOS: 5535-5541 9B2.3 FPGS Folylpolyglutamate synthase SEQ ID NOS: 5542-5548 FRAS1 Fraser extracellular matrix complex subunit 1 SEQ ID NOS: 5549-5554 FREM1 FRAS1 related extracellular matrix 1 SEQ ID NOS: 5555-5559 FREM3 FRAS1 related extracellular matrix 3 SEQ ID NO: 5560 FRMPD2 FERM and PDZ domain containing 2 SEQ ID NOS: 5561-5564 FRZB Frizzled-related protein SEQ ID NO: 5565 FSHB Follicle stimulating hormone, beta polypeptide SEQ ID NOS: 5566-5568 FSHR Follicle stimulating hormone receptor SEQ ID NOS: 5569-5572 FST Follistatin SEQ ID NOS: 5573-5576 FSTL1 Follistatin-like 1 SEQ ID NOS: 5577-5580 FSTL3 Follistatin-like 3 (secreted glycoprotein) SEQ ID NOS: 5581-5586 FSTL4 Follistatin-like 4 SEQ ID NOS: 5587-5589 FSTL5 Follistatin-like 5 SEQ ID NOS: 5590-5592 FTCDNL1 Formiminotransferase cyclodeaminase N-terminal SEQ ID NOS: 5593-5596 like FUCA1 Fucosidase, alpha-L-1, tissue SEQ ID NO: 5597 FUCA2 Fucosidase, alpha-L-2, plasma SEQ ID NOS: 5598-5599 FURIN Furin (paired basic amino acid cleaving enzyme) SEQ ID NOS: 5600-5606 FUT10 Fucosyltransferase 10 (alpha (1,3) SEQ ID NOS: 5607-5609 fucosyltransferase) FUT11 Fucosyltransferase 11 (alpha (1,3) SEQ ID NOS: 5610-5611 fucosyltransferase) FXN Frataxin SEQ ID NOS: 5612-5619 FXR1 Fragile X mental retardation, autosomal homolog 1 SEQ ID NOS: 5620-5632 FXYD3 FXYD domain containing ion transport regulator 3 SEQ ID NOS: 5633-5645 GABBR1 Gamma-aminobutyric acid (GABA) B receptor, 1 SEQ ID NOS: 5646-5657 GABRA1 Gamma-aminobutyric acid (GABA) A receptor, SEQ ID NOS: 5658-5673 alpha 1 GABRA2 Gamma-aminobutyric acid (GABA) A receptor, SEQ ID NOS: 5674-5688 alpha 2 GABRA5 Gamma-aminobutyric acid (GABA) A receptor, SEQ ID NOS: 5689-5697 alpha 5 GABRG3 Gamma-aminobutyric acid (GABA) A receptor, SEQ ID NOS: 5698-5703 gamma 3 GABRP Gamma-aminobutyric acid (GABA) A receptor, pi SEQ ID NOS: 5704-5712 GAL Galanin/GMAP prepropeptide SEQ ID NO: 5713 GAL3ST1 Galactose-3-O-sulfotransferase 1 SEQ ID NOS: 5714-5735 GAL3ST2 Galactose-3-O-sulfotransferase 2 SEQ ID NO: 5736 GAL3ST3 Galactose-3-O-sulfotransferase 3 SEQ ID NOS: 5737-5738 GALC Galactosylceramidase SEQ ID NOS: 5739-5748 GALNS Galactosamine (N-acetyl)-6-sulfatase SEQ ID NOS: 5749-5754 GALNT10 Polypeptide N-acetylgalactosaminyltransferase 10 SEQ ID NOS: 5755-5758 GALNT12 Polypeptide N-acetylgalactosaminyltransferase 12 SEQ ID NOS: 5759-5760 GALNT15 Polypeptide N-acetylgalactosaminyltransferase 15 SEQ ID NOS: 5761-5764 GALNT2 Polypeptide N-acetylgalactosaminyltransferase 2 SEQ ID NO: 5765 GALNT6 Polypeptide N-acetylgalactosaminyltransferase 6 SEQ ID NOS: 5766-5777 GALNT8 Polypeptide N-acetylgalactosaminyltransferase 8 SEQ ID NOS: 5778-5781 GALNTL6 Polypeptide N-acetylgalactosaminyltransferase- SEQ ID NOS: 5782-5785 like 6 GALP Galanin-like peptide SEQ ID NOS: 5786-5788 GANAB Glucosidase, alpha; neutral AB SEQ ID NOS: 5789-5797 GARS Glycyl-tRNA synthetase SEQ ID NOS: 5798-5801 GAS1 Growth arrest-specific 1 SEQ ID NO: 5802 GAS6 Growth arrest-specific 6 SEQ ID NO: 5803 GAST Gastrin SEQ ID NO: 5804 PDDC1 Parkinson disease 7 domain containing 1 SEQ ID NOS: 5805-5813 GBA Glucosidase, beta, acid SEQ ID NOS: 5814-5817 GBGT1 Globoside alpha-1,3-N- SEQ ID NOS: 5818-5826 acetylgalactosaminyltransferase 1 GC Group-specific component (vitamin D binding SEQ ID NOS: 5827-5831 protein) GCG Glucagon SEQ ID NOS: 5832-5833 GCGR Glucagon receptor SEQ ID NOS: 5834-5836 GCNT7 Glucosaminyl (N-acetyl) transferase family SEQ ID NOS: 5837-5838 member 7 GCSH Glycine cleavage system protein H (aminomethyl SEQ ID NOS: 5839-5847 carrier) GDF1 Growth differentiation factor 1 SEQ ID NO: 5848 GDF10 Growth differentiation factor 10 SEQ ID NO: 5849 GDF11 Growth differentiation factor 11 SEQ ID NOS: 5850-5851 GDF15 Growth differentiation factor 15 SEQ ID NOS: 5852-5854 GDF2 Growth differentiation factor 2 SEQ ID NO: 5855 GDF3 Growth differentiation factor 3 SEQ ID NO: 5856 GDF5 Growth differentiation factor 5 SEQ ID NOS: 5857-5858 GDF6 Growth differentiation factor 6 SEQ ID NOS: 5859-5861 GDF7 Growth differentiation factor 7 SEQ ID NO: 5862 GDF9 Growth differentiation factor 9 SEQ ID NOS: 5863-5867 GDNF Glial cell derived neurotrophic factor SEQ ID NOS: 5868-5875 GFOD2 Glucose-fructose oxidoreductase domain SEQ ID NOS: 5876-5881 containing 2 GFPT2 Glutamine-fructose-6-phosphate transaminase 2 SEQ ID NOS: 5882-5884 GFRA2 GDNF family receptor alpha 2 SEQ ID NOS: 5885-5891 GFRA4 GDNF family receptor alpha 4 SEQ ID NOS: 5892-5894 GGA2 Golgi-associated, gamma adaptin ear containing, SEQ ID NOS: 5895-5903 ARF binding protein 2 GGH Gamma-glutamyl hydrolase (conjugase, SEQ ID NO: 5904 folylpolygammaglutamyl hydrolase) GGT1 Gamma-glutamyltransferase 1 SEQ ID NOS: 5905-5927 GGT5 Gamma-glutamyltransferase 5 SEQ ID NOS: 5928-5932 GH1 Growth hormone 1 SEQ ID NOS: 5933-5937 GH2 Growth hormone 2 SEQ ID NOS: 5938-5942 GHDC GH3 domain containing SEQ ID NOS: 5943-5950 GHRH Growth hormone releasing hormone SEQ ID NOS: 5951-5953 GHRHR Growth hormone releasing hormone receptor SEQ ID NOS: 5954-5959 GHRL Ghrelin/obestatin prepropeptide SEQ ID NOS: 5960-5970 GIF Gastric intrinsic factor (vitamin B synthesis) SEQ ID NOS: 5971-5972 GIP Gastric inhibitory polypeptide SEQ ID NO: 5973 GKN1 Gastrokine 1 SEQ ID NO: 5974 GKN2 Gastrokine 2 SEQ ID NOS: 5975-5976 GLA Galactosidase, alpha SEQ ID NOS: 5977-5978 GLB1 Galactosidase, beta 1 SEQ ID NOS: 5979-5987 GLB1L Galactosidase, beta 1-like SEQ ID NOS: 5988-5995 GLB1L2 Galactosidase, beta 1-like 2 SEQ ID NOS: 5996-5997 GLCE Glucuronic acid epimerase SEQ ID NOS: 5998-5999 GLG1 Golgi glycoprotein 1 SEQ ID NOS: 6000-6007 GLIPR1 GLI pathogenesis-related 1 SEQ ID NOS: 6008-6011 GLIPR1L1 GLI pathogenesis-related 1 like 1 SEQ ID NOS: 6012-6015 GLIS3 GLIS family zinc finger 3 SEQ ID NOS: 6016-6024 GLMP Glycosylated lysosomal membrane protein SEQ ID NOS: 6025-6033 GLRB Glycine receptor, beta SEQ ID NOS: 6034-6039 GLS Glutaminase SEQ ID NOS: 6040-6047 GLT6D1 Glycosyltransferase 6 domain containing 1 SEQ ID NOS: 6048-6049 GLTPD2 Glycolipid transfer protein domain containing 2 SEQ ID NO: 6050 GLUD1 Glutamate dehydrogenase 1 SEQ ID NO: 6051 GM2A GM2 ganglioside activator SEQ ID NOS: 6052-6054 GML Glycosylphosphatidylinositol anchored molecule like SEQ ID NOS: 6055-6056 GNAS GNAS complex locus SEQ ID NOS: 6057-6078 GNLY Granulysin SEQ ID NOS: 6079-6082 GNPTG N-acetylglucosamine-1-phosphate transferase, SEQ ID NOS: 6083-6087 gamma subunit GNRH1 Gonadotropin-releasing hormone 1 (luteinizing- SEQ ID NOS: 6088-6089 releasing hormone) GNRH2 Gonadotropin-releasing hormone 2 SEQ ID NOS: 6090-6093 GNS Glucosamine (N-acetyl)-6-sulfatase SEQ ID NOS: 6094-6099 GOLM1 Golgi membrane protein 1 SEQ ID NOS: 6100-6104 GORAB Golgin, RAB6-interacting SEQ ID NOS: 6105-6107 GOT2 Glutamic-oxaloacetic transaminase 2, mitochondrial SEQ ID NOS: 6108-6110 GP2 Glycoprotein 2 (zymogen granule membrane) SEQ ID NOS: 6111-6119 GP6 Glycoprotein VI (platelet) SEQ ID NOS: 6120-6123 GPC2 Glypican 2 SEQ ID NOS: 6124-6125 GPC5 Glypican 5 SEQ ID NOS: 6126-6128 GPC6 Glypican 6 SEQ ID NOS: 6129-6130 GPD2 Glycerol-3-phosphate dehydrogenase 2 SEQ ID NOS: 6131-6139 (mitochondrial) GPER1 G protein-coupled estrogen receptor 1 SEQ ID NOS: 6140-6146 GPHA2 Glycoprotein hormone alpha 2 SEQ ID NOS: 6147-6149 GPHB5 Glycoprotein hormone beta 5 SEQ ID NOS: 6150-6151 GPIHBP1 Glycosylphosphatidylinositol anchored high density SEQ ID NO: 6152 lipoprotein binding protein 1 GPLD1 Glycosylphosphatidylinositol specific phospholipase SEQ ID NO: 6153 D1 GPNMB Glycoprotein (transmembrane) nmb SEQ ID NOS: 6154-6156 GPR162 G protein-coupled receptor 162 SEQ ID NOS: 6157-6160 GPX3 Glutathione peroxidase 3 SEQ ID NOS: 6161-6168 GPX4 Glutathione peroxidase 4 SEQ ID NOS: 6169-6179 GPX5 Glutathione peroxidase 5 SEQ ID NOS: 6180-6181 GPX6 Glutathione peroxidase 6 SEQ ID NOS: 6182-6184 GPX7 Glutathione peroxidase 7 SEQ ID NO: 6185 GREM1 Gremlin 1, DAN family BMP antagonist SEQ ID NOS: 6186-6188 GREM2 Gremlin 2, DAN family BMP antagonist SEQ ID NO: 6189 GRHL3 Grainyhead-like transcription factor 3 SEQ ID NOS: 6190-6195 GRIA2 Glutamate receptor, ionotropic, AMPA 2 SEQ ID NOS: 6196-6207 GRIA3 Glutamate receptor, ionotropic, AMPA 3 SEQ ID NOS: 6208-6213 GRIA4 Glutamate receptor, ionotropic, AMPA 4 SEQ ID NOS: 6214-6225 GRIK2 Glutamate receptor, ionotropic, kainate 2 SEQ ID NOS: 6226-6234 GRIN2B Glutamate receptor, ionotropic, N-methyl D- SEQ ID NOS: 6235-6238 aspartate 2B GRM2 Glutamate receptor, metabotropic 2 SEQ ID NOS: 6239-6242 GRM3 Glutamate receptor, metabotropic 3 SEQ ID NOS: 6243-6247 GRM5 Glutamate receptor, metabotropic 5 SEQ ID NOS: 6248-6252 GRN Granulin SEQ ID NOS: 6253-6268 GRP Gastrin-releasing peptide SEQ ID NOS: 6269-6273 DFNA5 Deafness, autosomal dominant 5 SEQ ID NOS: 6274-6282 GSG1 Germ cell associated 1 SEQ ID NOS: 6283-6291 GSN Gelsolin SEQ ID NOS: 6292-6300 GTDC1 Glycosyltransferase-like domain containing 1 SEQ ID NOS: 6301-6314 GTPBP10 GTP-binding protein 10 (putative) SEQ ID NOS: 6315-6323 GUCA2A Guanylate cyclase activator 2A (guanylin) SEQ ID NO: 6324 GUCA2B Guanylate cyclase activator 2B (uroguanylin) SEQ ID NO: 6325 GUSB Glucuronidase, beta SEQ ID NOS: 6326-6330 GVQW1 GVQW motif containing 1 SEQ ID NO: 6331 GXYLT1 Glucoside xylosyltransferase 1 SEQ ID NOS: 6332-6333 GXYLT2 Glucoside xylosyltransferase 2 SEQ ID NOS: 6334-6336 GYPB Glycophorin B (MNS blood group) SEQ ID NOS: 6337-6345 GZMA Granzyme A (granzyme 1, cytotoxic T-lymphocyte- SEQ ID NO: 6346 associated serine esterase 3) GZMB Granzyme B (granzyme 2, cytotoxic T-lymphocyte- SEQ ID NOS: 6347-6355 associated serine esterase 1) GZMH Granzyme H (cathepsin G-like 2, protein h-CCPX) SEQ ID NOS: 6356-6358 GZMK Granzyme K (granzyme 3; tryptase II) SEQ ID NO: 6359 GZMM Granzyme M (lymphocyte met-ase 1) SEQ ID NOS: 6360-6361 H6PD Hexose-6-phosphate dehydrogenase (glucose 1- SEQ ID NOS: 6362-6363 dehydrogenase) HABP2 Hyaluronan binding protein 2 SEQ ID NOS: 6364-6365 HADHB Hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA SEQ ID NOS: 6366-6372 thiolase/enoyl-CoA hydratase (trifunctional protein), beta subunit HAMP Hepcidin antimicrobial peptide SEQ ID NOS: 6373-6374 HAPLN1 Hyaluronan and proteoglycan link protein 1 SEQ ID NOS: 6375-6381 HAPLN2 Hyaluronan and proteoglycan link protein 2 SEQ ID NOS: 6382-6383 HAPLN3 Hyaluronan and proteoglycan link protein 3 SEQ ID NOS: 6384-6387 HAPLN4 Hyaluronan and proteoglycan link protein 4 SEQ ID NO: 6388 HARS2 Histidyl-tRNA synthetase 2, mitochondrial SEQ ID NOS: 6389-6404 HAVCR1 Hepatitis A virus cellular receptor 1 SEQ ID NOS: 6405-6409 HCCS Holocytochrome c synthase SEQ ID NOS: 6410-6412 HCRT Hypocretin (orexin) neuropeptide precursor SEQ ID NO: 6413 CECR5 Cat eye syndrome chromosome region, candidate 5 SEQ ID NOS: 6414-6416 HEATR5A HEAT repeat containing 5A SEQ ID NOS: 6417-6423 HEPH Hephaestin SEQ ID NOS: 6424-6431 HEXA Hexosaminidase A (alpha polypeptide) SEQ ID NOS: 6432-6441 HEXB Hexosaminidase B (beta polypeptide) SEQ ID NOS: 6442-6447 HFE2 Hemochromatosis type 2 (juvenile) SEQ ID NOS: 6448-6454 HGF Hepatocyte growth factor (hepapoietin A; scatter SEQ ID NOS: 6455-6465 factor) HGFAC HGF activator SEQ ID NOS: 6466-6467 HHIP Hedgehog interacting protein SEQ ID NOS: 6468-6469 HHIPL1 HHIP-like 1 SEQ ID NOS: 6470-6471 HHIPL2 HHIP-like 2 SEQ ID NO: 6472 HHLA1 HERV-H LTR-associating 1 SEQ ID NOS: 6473-6474 HHLA2 HERV-H LTR-associating 2 SEQ ID NOS: 6475-6485 HIBADH 3-hydroxyisobutyrate dehydrogenase SEQ ID NOS: 6486-6488 HINT2 Histidine triad nucleotide binding protein 2 SEQ ID NO: 6489 HLA-A Major histocompatibility complex, class I, A SEQ ID NOS: 6490-6494 HLA-C Major histocompatibility complex, class I, C SEQ ID NOS: 6495-6499 HLA-DOA Major histocompatibility complex, class II, DO alpha SEQ ID NOS: 6500-6501 HLA-DPA1 Major histocompatibility complex, class II, DP SEQ ID NOS: 6502-6505 alpha 1 HLA-DQA1 Major histocompatibility complex, class II, DQ SEQ ID NOS: 6506-6511 alpha 1 HLA-DQB1 Major histocompatibility complex, class II, DQ beta 1 SEQ ID NOS: 6512-6517 HLA-DQB2 Major histocompatibility complex, class II, DQ beta 2 SEQ ID NOS: 6518-6521 HMCN1 Hemicentin 1 SEQ ID NOS: 6522-6523 HMCN2 Hemicentin 2 SEQ ID NOS: 6524-6527 HMGCL 3-hydroxymethyl-3-methylglutaryl-CoA lyase SEQ ID NOS: 6528-6531 HMSD Histocompatibility (minor) serpin domain containing SEQ ID NOS: 6532-6533 HP Haptoglobin SEQ ID NOS: 6534-6547 HPR Haptoglobin-related protein SEQ ID NOS: 6548-6550 HPSE Heparanase SEQ ID NOS: 6551-6557 HPSE2 Heparanase 2 (inactive) SEQ ID NOS: 6558-6563 HPX Hemopexin SEQ ID NOS: 6564-6565 HRC Histidine rich calcium binding protein SEQ ID NOS: 6566-6568 HRG Histidine-rich glycoprotein SEQ ID NO: 6569 HS2ST1 Heparan sulfate 2-O-sulfotransferase 1 SEQ ID NOS: 6570-6572 HS3ST1 Heparan sulfate (glucosamine) 3-O- SEQ ID NOS: 6573-6575 sulfotransferase 1 HS6ST1 Heparan sulfate 6-O-sulfotransferase 1 SEQ ID NO: 6576 HS6ST3 Heparan sulfate 6-O-sulfotransferase 3 SEQ ID NOS: 6577-6578 HSD11B1L Hydroxysteroid (11-beta) dehydrogenase 1-like SEQ ID NOS: 6579-6597 HSD17811 Hydroxysteroid (17-beta) dehydrogenase 11 SEQ ID NOS: 6598-6599 HSD17B7 Hydroxysteroid (17-beta) dehydrogenase 7 SEQ ID NOS: 6600-6604 HSP90B1 Heat shock protein 90 kDa beta (Grp94), member 1 SEQ ID NOS: 6605-6610 HSPA13 Heat shock protein 70 kDa family, member 13 SEQ ID NO: 6611 HSPA5 Heat shock 70 kDa protein 5 (glucose-regulated SEQ ID NO: 6612 protein, 78 kDa) HSPG2 Heparan sulfate proteoglycan 2 SEQ ID NOS: 6613-6617 HTATIP2 HIV-1 Tat interactive protein 2, 30 kDa SEQ ID NOS: 6618-6625 HTN1 Histatin 1 SEQ ID NOS: 6626-6628 HTN3 Histatin 3 SEQ ID NOS: 6629-6631 HTRA1 HtrA serine peptidase 1 SEQ ID NOS: 6632-6633 HTRA3 HtrA serine peptidase 3 SEQ ID NOS: 6634-6635 HTRA4 HtrA serine peptidase 4 SEQ ID NO: 6636 HYAL1 Hyaluronoglucosaminidase 1 SEQ ID NOS: 6637-6645 HYAL2 Hyaluronoglucosaminidase 2 SEQ ID NOS: 6646-6654 HYAL3 Hyaluronoglucosaminidase 3 SEQ ID NOS: 6655-6661 HYOU1 Hypoxia up-regulated 1 SEQ ID NOS: 6662-6676 IAPP Islet amyloid polypeptide SEQ ID NOS: 6677-6681 IBSP Integrin-binding sialoprotein SEQ ID NO: 6682 ICAM1 Intercellular adhesion molecule 1 SEQ ID NOS: 6683-6685 ICAM2 Intercellular adhesion molecule 2 SEQ ID NOS: 6686-6696 ICAM4 Intercellular adhesion molecule 4 (Landsteiner- SEQ ID NOS: 6697-6699 Wiener blood group) ID1 Inhibitor of DNA binding 1, dominant negative helix- SEQ ID NOS: 6700-6701 loop-helix protein IDE Insulin-degrading enzyme SEQ ID NOS: 6702-6705 IDNK IdnK, gluconokinase homolog (E. coli) SEQ ID NOS: 6706-6711 IDS Iduronate 2-sulfatase SEQ ID NOS: 6712-6717 IDUA Iduronidase, alpha-L- SEQ ID NOS: 6718-6723 IFI27L2 Interferon, alpha-inducible protein 27-like 2 SEQ ID NOS: 6724-6725 IFI30 Interferon, gamma-inducible protein 30 SEQ ID NOS: 6726-6727 IFNA1 Interferon, alpha 1 SEQ ID NO: 6728 IFNA10 Interferon, alpha 10 SEQ ID NO: 6729 IFNA13 Interferon, alpha 13 SEQ ID NOS: 6730-6731 IFNA14 Interferon, alpha 14 SEQ ID NO: 6732 IFNA16 Interferon, alpha 16 SEQ ID NO: 6733 IFNA17 Interferon, alpha 17 SEQ ID NO: 6734 IFNA2 Interferon, alpha 2 SEQ ID NO: 6735 IFNA21 Interferon, alpha 21 SEQ ID NO: 6736 IFNA4 Interferon, alpha 4 SEQ ID NO: 6737 IFNA5 Interferon, alpha 5 SEQ ID NO: 6738 IFNA6 Interferon, alpha 6 SEQ ID NOS: 6739-6740 IFNA7 Interferon, alpha 7 SEQ ID NO: 6741 IFNA8 Interferon, alpha 8 SEQ ID NO: 6742 IFNAR1 Interferon (alpha, beta and omega) receptor 1 SEQ ID NOS: 6743-6744 IFNB1 Interferon, beta 1, fibroblast SEQ ID NO: 6745 IFNE Interferon, epsilon SEQ ID NO: 6746 IFNG Interferon, gamma SEQ ID NO: 6747 IFNGR1 Interferon gamma receptor 1 SEQ ID NOS: 6748-6758 IFNL1 Interferon, lambda 1 SEQ ID NO: 6759 IFNL2 Interferon, lambda 2 SEQ ID NO: 6760 IFNL3 Interferon, lambda 3 SEQ ID NOS: 6761-6762 IFNLR1 Interferon, lambda receptor 1 SEQ ID NOS: 6763-6767 IFNW1 Interferon, omega 1 SEQ ID NO: 6768 IGF1 Insulin-like growth factor 1 (somatomedin C) SEQ ID NOS: 6769-6774 IGF2 Insulin-like growth factor 2 SEQ ID NOS: 6775-6782 IGFALS Insulin-like growth factor binding protein, acid labile SEQ ID NOS: 6783-6785 subunit IGFBP1 Insulin-like growth factor binding protein 1 SEQ ID NOS: 6786-6788 IGFBP2 Insulin-like growth factor binding protein 2, 36 kDa SEQ ID NOS: 6789-6792 IGFBP3 Insulin-like growth factor binding protein 3 SEQ ID NOS: 6793-6800 IGFBP4 Insulin-like growth factor binding protein 4 SEQ ID NO: 6801 IGFBP5 Insulin-like growth factor binding protein 5 SEQ ID NOS: 6802-6803 IGFBP6 Insulin-like growth factor binding protein 6 SEQ ID NOS: 6804-6806 IGFBP7 Insulin-like growth factor binding protein 7 SEQ ID NOS: 6807-6808 IGFBPL1 Insulin-like growth factor binding protein-like 1 SEQ ID NO: 6809 IGFL1 IGF-like family member 1 SEQ ID NO: 6810 IGFL2 IGF-like family member 2 SEQ ID NOS: 6811-6813 IGFL3 IGF-like family member 3 SEQ ID NO: 6814 IGFLR1 IGF-like family receptor 1 SEQ ID NOS: 6815-6823 IGIP IgA-inducing protein SEQ ID NO: 6824 IGLON5 IgLON family member 5 SEQ ID NO: 6825 IGSF1 Immunoglobulin superfamily, member 1 SEQ ID NOS: 6826-6831 IGSF10 Immunoglobulin superfamily, member 10 SEQ ID NOS: 6832-6833 IGSF11 Immunoglobulin superfamily, member 11 SEQ ID NOS: 6834-6841 IGSF21 Immunoglobin superfamily, member 21 SEQ ID NO: 6842 IGSF8 Immunoglobulin superfamily, member 8 SEQ ID NOS: 6843-6846 IGSF9 Immunoglobulin superfamily, member 9 SEQ ID NOS: 6847-6849 IHH Indian hedgehog SEQ ID NO: 6850 IL10 Interleukin 10 SEQ ID NOS: 6851-6852 IL11 Interleukin 11 SEQ ID NOS: 6853-6856 IL11RA Interleukin 11 receptor, alpha SEQ ID NOS: 6857-6867 IL12B Interleukin 12B SEQ ID NO: 6868 IL12RB1 Interleukin 12 receptor, beta 1 SEQ ID NOS: 6869-6874 IL12RB2 Interleukin 12 receptor, beta 2 SEQ ID NOS: 6875-6879 IL13 Interleukin 13 SEQ ID NOS: 6880-6881 IL13RA1 Interleukin 13 receptor, alpha 1 SEQ ID NOS: 6882-6883 IL15RA Interleukin 15 receptor, alpha SEQ ID NOS: 6884-6901 IL17A Interleukin 17A SEQ ID NO: 6902 IL17B Interleukin 17B SEQ ID NO: 6903 IL17C Interleukin 17C SEQ ID NO: 6904 IL17D Interleukin 17D SEQ ID NOS: 6905-6907 IL17F Interleukin 17F SEQ ID NO: 6908 IL17RA Interleukin 17 receptor A SEQ ID NOS: 6909-6910 IL17RC Interleukin 17 receptor C SEQ ID NOS: 6911-6926 IL17RE Interleukin 17 receptor E SEQ ID NOS: 6927-6933 IL18BP Interleukin 18 binding protein SEQ ID NOS: 6934-6944 IL18R1 Interleukin 18 receptor 1 SEQ ID NOS: 6945-6948 IL18RAP Interleukin 18 receptor accessory protein SEQ ID NOS: 6949-6951 IL19 Interleukin 19 SEQ ID NOS: 6952-6954 IL1R1 Interleukin 1 receptor, type I SEQ ID NOS: 6955-6967 IL1R2 Interleukin 1 receptor, type II SEQ ID NOS: 6968-6971 IL1RAP Interleukin 1 receptor accessory protein SEQ ID NOS: 6972-6985 IL1RL1 Interleukin 1 receptor-like 1 SEQ ID NOS: 6986-6991 IL1RL2 Interleukin 1 receptor-like 2 SEQ ID NOS: 6992-6994 IL1RN Interleukin 1 receptor antagonist SEQ ID NOS: 6995-6999 IL2 Interleukin 2 SEQ ID NO: 7000 IL20 Interleukin 20 SEQ ID NOS: 7001-7003 IL20RA Interleukin 20 receptor, alpha SEQ ID NOS: 7004-7010 IL21 Interleukin 21 SEQ ID NOS: 7011-7012 IL22 Interleukin 22 SEQ ID NOS: 7013-7014 IL22RA2 Interleukin 22 receptor, alpha 2 SEQ ID NOS: 7015-7017 IL23A Interleukin 23, alpha subunit p19 SEQ ID NO: 7018 IL24 Interleukin 24 SEQ ID NOS: 7019-7024 IL25 Interleukin 25 SEQ ID NOS: 7025-7026 IL26 Interleukin 26 SEQ ID NO: 7027 IL27 Interleukin 27 SEQ ID NOS: 7028-7029 IL2RB Interleukin 2 receptor, beta SEQ ID NOS: 7030-7034 IL3 Interleukin 3 SEQ ID NO: 7035 IL31 Interleukin 31 SEQ ID NO: 7036 IL31RA Interleukin 31 receptor A SEQ ID NOS: 7037-7044 IL32 Interleukin 32 SEQ ID NOS: 7045-7074 IL34 Interleukin 34 SEQ ID NOS: 7075-7078 IL3RA Interleukin 3 receptor, alpha (low affinity) SEQ ID NOS: 7079-7081 IL4 Interleukin 4 SEQ ID NOS: 7082-7084 IL4I1 Interleukin 4 induced 1 SEQ ID NOS: 7085-7092 IL4R Interleukin 4 receptor SEQ ID NOS: 7093-7106 IL5 Interleukin 5 SEQ ID NOS: 7107-7108 IL5RA Interleukin 5 receptor, alpha SEQ ID NOS: 7109-7118 IL6 Interleukin 6 SEQ ID NOS: 7119-7125 IL6R Interleukin 6 receptor SEQ ID NOS: 7126-7131 IL6ST Interleukin 6 signal transducer SEQ ID NOS: 7132-7141 IL7 Interleukin 7 SEQ ID NOS: 7142-7149 IL7R Interleukin 7 receptor SEQ ID NOS: 7150-7156 IL9 Interleukin 9 SEQ ID NO: 7157 ILDR1 Immunoglobulin-like domain containing receptor 1 SEQ ID NOS: 7158-7162 ILDR2 Immunoglobulin-like domain containing receptor 2 SEQ ID NOS: 7163-7169 IMP4 IMP4, U3 small nucleolar ribonucleoprotein SEQ ID NOS: 7170-7175 IMPG1 Interphotoreceptor matrix proteoglycan 1 SEQ ID NOS: 7176-7179 INHA Inhibin, alpha SEQ ID NO: 7180 INHBA Inhibin, beta A SEQ ID NOS: 7181-7183 INHBB Inhibin, beta B SEQ ID NO: 7184 INHBC Inhibin, beta C SEQ ID NO: 7185 INHBE Inhibin, beta E SEQ ID NOS: 7186-7187 INPP5A Inositol polyphosphate-5-phosphatase A SEQ ID NOS: 7188-7192 INS Insulin SEQ ID NOS: 7193-7197 INS-IGF2 INS-IGF2 readthrough SEQ ID NOS: 7198-7199 INSL3 Insulin-like 3 (Leydig cell) SEQ ID NOS: 7200-7202 INSL4 Insulin-like 4 (placenta) SEQ ID NO: 7203 INSL5 Insulin-like 5 SEQ ID NO: 7204 INSL6 Insulin-like 6 SEQ ID NO: 7205 INTS3 Integrator complex subunit 3 SEQ ID NOS: 7206-7211 IPO11 Importin 11 SEQ ID NOS: 7212-7220 IPO9 Importin 9 SEQ ID NOS: 7221-7222 IQCF6 IQ motif containing F6 SEQ ID NOS: 7223-7224 IRAK3 Interleukin-1 receptor-associated kinase 3 SEQ ID NOS: 7225-7227 IRS4 Insulin receptor substrate 4 SEQ ID NO: 7228 ISLR Immunoglobulin superfamily containing leucine-rich SEQ ID NOS: 7229-7232 repeat ISLR2 Immunoglobulin superfamily containing leucine-rich SEQ ID NOS: 7233-7242 repeat 2 ISM1 Isthmin 1, angiogenesis inhibitor SEQ ID NO: 7243 ISM2 Isthmin 2 SEQ ID NOS: 7244-7249 ITGA4 Integrin, alpha 4 (antigen CD49D, alpha 4 subunit of SEQ ID NOS: 7250-7252 VLA-4 receptor) ITGA9 Integrin, alpha 9 SEQ ID NOS: 7253-7255 ITGAL Integrin, alpha L (antigen CD11A (p180), lymphocyte SEQ ID NOS: 7256-7265 function-associated antigen 1; alpha polypeptide) ITGAX Integrin, alpha X (complement component 3 SEQ ID NOS: 7266-7268 receptor 4 subunit) ITGB1 Integrin, beta 1 (fibronectin receptor, beta SEQ ID NOS: 7269-7284 polypeptide, antigen CD29 includes MDF2, MSK12) ITGB2 Integrin, beta 2 (complement component 3 receptor SEQ ID NOS: 7285-7301 3 and 4 subunit) ITGB3 Integrin, beta 3 (platelet glycoprotein IIIa, antigen SEQ ID NOS: 7302-7304 CD61) ITGB7 Integrin, beta 7 SEQ ID NOS: 7305-7312 ITGBL1 Integrin, beta-like 1 (with EGF-like repeat domains) SEQ ID NOS: 7313-7318 ITIH1 Inter-alpha-trypsin inhibitor heavy chain 1 SEQ ID NOS: 7319-7324 ITIH2 Inter-alpha-trypsin inhibitor heavy chain 2 SEQ ID NOS: 7325-7327 ITIH3 Inter-alpha-trypsin inhibitor heavy chain 3 SEQ ID NOS: 7328-7330 ITIH4 Inter-alpha-trypsin inhibitor heavy chain family, SEQ ID NOS: 7331-7334 member 4 ITIH5 Inter-alpha-trypsin inhibitor heavy chain family, SEQ ID NOS: 7335-7338 member 5 ITIH6 Inter-alpha-trypsin inhibitor heavy chain family, SEQ ID NO: 7339 member 6 ITLN1 Intelectin 1 (galactofuranose binding) SEQ ID NO: 7340 ITLN2 Intelectin 2 SEQ ID NO: 7341 IZUMO1R IZUMO1 receptor, JUNO SEQ ID NOS: 7342-7343 IZUMO4 IZUMO family member 4 SEQ ID NOS: 7344-7350 AMICA1 Adhesion molecule, interacts with CXADR antigen 1 SEQ ID NOS: 7351-7359 JCHAIN Joining chain of multimeric IgA and IgM SEQ ID NOS: 7360-7365 JMJD8 Jumonji domain containing 8 SEQ ID NOS: 7366-7370 JSRP1 Junctional sarcoplasmic reticulum protein 1 SEQ ID NO: 7371 KANSL2 KAT8 regulatory NSL complex subunit 2 SEQ ID NOS: 7372-7382 KAZALD1 Kazal-type serine peptidase inhibitor domain 1 SEQ ID NO: 7383 KCNIP3 Kv channel interacting protein 3, calsenilin SEQ ID NOS: 7384-7386 KCNK7 Potassium channel, two pore domain subfamily K, SEQ ID NOS: 7387-7392 member 7 KCNN4 Potassium channel, calcium activated SEQ ID NOS: 7393-7398 intermediate/small conductance subfamily N alpha, member 4 KCNU1 Potassium channel, subfamily U, member 1 SEQ ID NOS: 7399-7403 KCP Kielin/chordin-like protein SEQ ID NOS: 7404-7407 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 SEQ ID NO: 7408 KDELC2 KDEL (Lys-Asp-Glu-Leu) containing 2 SEQ ID NOS: 7409-7412 KDM1A Lysine (K)-specific demethylase 1A SEQ ID NOS: 7413-7416 KDM3B Lysine (K)-specific demethylase 3B SEQ ID NOS: 7417-7420 KDM6A Lysine (K)-specific demethylase 6A SEQ ID NOS: 7421-7430 KDM7A Lysine (K)-specific demethylase 7A SEQ ID NOS: 7431-7432 KDSR 3-ketodihydrosphingosine reductase SEQ ID NOS: 7433-7439 KERA Keratocan SEQ ID NO: 7440 KIAA0100 KIAA0100 SEQ ID NOS: 7441-7446 KIAA0319 KIAA0319 SEQ ID NOS: 7447-7452 KIAA1324 KIAA1324 SEQ ID NOS: 7453-7461 KIFC2 Kinesin family member C2 SEQ ID NOS: 7462-7464 KIR2DL4 Killer cell immunoglobulin-like receptor, two SEQ ID NOS: 7465-7471 domains, long cytoplasmic tail, 4 KIR3DX1 Killer cell immunoglobulin-like receptor, three SEQ ID NOS: 7472-7476 domains, X1 KIRREL2 Kin of IRRE like 2 (Drosophila) SEQ ID NOS: 7477-7481 KISS1 KiSS-1 metastasis-suppressor SEQ ID NOS: 7482-7483 KLHL11 Kelch-like family member 11 SEQ ID NO: 7484 KLHL22 Kelch-like family member 22 SEQ ID NOS: 7485-7491 KLK1 Kallikrein 1 SEQ ID NOS: 7492-7493 KLK10 Kallikrein-related peptidase 10 SEQ ID NOS: 7494-7498 KLK11 Kallikrein-related peptidase 11 SEQ ID NOS: 7499-7507 KLK12 Kallikrein-related peptidase 12 SEQ ID NOS: 7508-7514 KLK13 Kallikrein-related peptidase 13 SEQ ID NOS: 7515-7523 KLK14 Kallikrein-related peptidase 14 SEQ ID NOS: 7524-7525 KLK15 Kallikrein-related peptidase 15 SEQ ID NOS: 7526-7530 KLK2 Kallikrein-related peptidase 2 SEQ ID NOS: 7531-7543 KLK3 Kallikrein-related peptidase 3 SEQ ID NOS: 7544-7555 KLK4 Kallikrein-related peptidase 4 SEQ ID NOS: 7556-7560 KLK5 Kallikrein-related peptidase 5 SEQ ID NOS: 7561-7564 KLK6 Kallikrein-related peptidase 6 SEQ ID NOS: 7565-7571 KLK7 Kallikrein-related peptidase 7 SEQ ID NOS: 7572-7576 KLK8 Kallikrein-related peptidase 8 SEQ ID NOS: 7577-7584 KLK9 Kallikrein-related peptidase 9 SEQ ID NOS: 7585-7586 KLKB1 Kallikrein B, plasma (Fletcher factor) 1 SEQ ID NOS: 7587-7591 SETD8 SET domain containing (lysine methyltransferase) 8 SEQ ID NOS: 7592-7595 KNDC1 Kinase non-catalytic C-lobe domain (KIND) SEQ ID NOS: 7596-7597 containing 1 KNG1 Kininogen 1 SEQ ID NOS: 7598-7602 KRBA2 KRAB-A domain containing 2 SEQ ID NOS: 7603-7606 KREMEN2 Kringle containing transmembrane protein 2 SEQ ID NOS: 7607-7612 KRTDAP Keratinocyte differentiation-associated protein SEQ ID NOS: 7613-7614 L1CAM L1 cell adhesion molecule SEQ ID NOS: 7615-7624 L3MBTL2 L(3)mbt-like 2 (Drosophila) SEQ ID NOS: 7625-7629 LACRT Lacritin SEQ ID NOS: 7630-7632 LACTB Lactamase, beta SEQ ID NOS: 7633-7635 LAG3 Lymphocyte-activation gene 3 SEQ ID NOS: 7636-7637 LAIR2 Leukocyte-associated immunoglobulin-like SEQ ID NOS: 7638-7641 receptor 2 LALBA Lactalbumin, alpha- SEQ ID NOS: 7642-7643 LAMA1 Laminin, alpha 1 SEQ ID NOS: 7644-7645 LAMA2 Laminin, alpha 2 SEQ ID NOS: 7646-7649 LAMA3 Laminin, alpha 3 SEQ ID NOS: 7650-7659 LAMA4 Laminin, alpha 4 SEQ ID NOS: 7660-7674 LAMAS Laminin, alpha 5 SEQ ID NOS: 7675-7677 LAMB1 Laminin, beta 1 SEQ ID NOS: 7678-7682 LAMB2 Laminin, beta 2 (laminin S) SEQ ID NOS: 7683-7685 LAMB3 Laminin, beta 3 SEQ ID NOS: 7686-7690 LAMB4 Laminin, beta 4 SEQ ID NOS: 7691-7694 LAMC1 Laminin, gamma 1 (formerly LAMB2) SEQ ID NOS: 7695-7696 LAMC2 Laminin, gamma 2 SEQ ID NOS: 7697-7698 LAMC3 Laminin, gamma 3 SEQ ID NOS: 7699-7700 LAMP3 Lysosomal-associated membrane protein 3 SEQ ID NOS: 7701-7704 GYLTL1B Glycosyltransferase-like 1B SEQ ID NOS: 7705-7710 LAT Linker for activation of T cells SEQ ID NOS: 7711-7720 LAT2 Linker for activation of T cells family, member 2 SEQ ID NOS: 7721-7729 LBP Lipopolysaccharide binding protein SEQ ID NO: 7730 LCAT Lecithin-cholesterol acyltransferase SEQ ID NOS: 7731-7737 LCN1 Lipocalin 1 SEQ ID NOS: 7738-7739 LCN10 Lipocalin 10 SEQ ID NOS: 7740-7745 LCN12 Lipocalin 12 SEQ ID NOS: 7746-7748 LCN15 Lipocalin 15 SEQ ID NO: 7749 LCN2 Lipocalin 2 SEQ ID NOS: 7750-7752 LCN6 Lipocalin 6 SEQ ID NOS: 7753-7754 LCN8 Lipocalin 8 SEQ ID NOS: 7755-7756 LCN9 Lipocalin 9 SEQ ID NOS: 7757-7758 LCORL Ligand dependent nuclear receptor corepressor-like SEQ ID NOS: 7759-7764 LDLR Low density lipoprotein receptor SEQ ID NOS: 7765-7773 LDLRAD2 Low density lipoprotein receptor class A domain SEQ ID NOS: 7774-7775 containing 2 LEAP2 Liver expressed antimicrobial peptide 2 SEQ ID NO: 7776 LECT2 Leukocyte cell-derived chemotaxin 2 SEQ ID NOS: 7777-7780 LEFTY1 Left-right determination factor 1 SEQ ID NOS: 7781-7782 LEFTY2 Left-right determination factor 2 SEQ ID NOS: 7783-7784 LEP Leptin SEQ ID NO: 7785 LFNG LFNG O-fucosylpeptide 3-beta-N- SEQ ID NOS: 7786-7791 acetylglucosaminyltransferase LGALS3BP Lectin, galactoside-binding, soluble, 3 binding SEQ ID NOS: 7792-7806 protein LGI1 Leucine-rich, glioma inactivated 1 SEQ ID NOS: 7807-7825 LGI2 Leucine-rich repeat LGI family, member 2 SEQ ID NOS: 7826-7827 LGI3 Leucine-rich repeat LGI family, member 3 SEQ ID NOS: 7828-7831 LGI4 Leucine-rich repeat LGI family, member 4 SEQ ID NOS: 7832-7835 LGMN Legumain SEQ ID NOS: 7836-7849 LGR4 Leucine-rich repeat containing G protein-coupled SEQ ID NOS: 7850-7852 receptor 4 LHB Luteinizing hormone beta polypeptide SEQ ID NO: 7853 LHCGR Luteinizing hormone/choriogonadotropin receptor SEQ ID NOS: 7854-7858 LIF Leukemia inhibitory factor SEQ ID NOS: 7859-7860 LIFR Leukemia inhibitory factor receptor alpha SEQ ID NOS: 7861-7865 LILRA1 Leukocyte immunoglobulin-like receptor, subfamily SEQ ID NOS: 7866-7867 A (with TM domain), member 1 LILRA2 Leukocyte immunoglobulin-like receptor, subfamily SEQ ID NOS: 7868-7874 A (with TM domain), member 2 LILRB3 Leukocyte immunoglobulin-like receptor, subfamily SEQ ID NOS: 7875-7879 B (with TM and ITIM domains), member 3 LIME1 Lck interacting transmembrane adaptor 1 SEQ ID NOS: 7880-7885 LINGO1 Leucine rich repeat and Ig domain containing 1 SEQ ID NOS: 7886-7896 LIPA Lipase A, lysosomal acid, cholesterol esterase SEQ ID NOS: 7897-7901 LIPC Lipase, hepatic SEQ ID NOS: 7902-7905 LIPF Lipase, gastric SEQ ID NOS: 7906-7909 LIPG Lipase, endothelial SEQ ID NOS: 7910-7915 LIPH Lipase, member H SEQ ID NOS: 7916-7920 LIPK Lipase, family member K SEQ ID NO: 7921 LIPM Lipase, family member M SEQ ID NOS: 7922-7923 LIPN Lipase, family member N SEQ ID NO: 7924 LMAN2 Lectin, mannose-binding 2 SEQ ID NOS: 7925-7929 LMNTD1 Lamin tail domain containing 1 SEQ ID NOS: 7930-7940 LNX1 Ligand of numb-protein X 1, E3 ubiquitin protein SEQ ID NOS: 7941-7947 ligase LOX Lysyl oxidase SEQ ID NOS: 7948-7950 LOXL1 Lysyl oxidase-like 1 SEQ ID NOS: 7951-7952 LOXL2 Lysyl oxidase-like 2 SEQ ID NOS: 7953-7961 LOXL3 Lysyl oxidase-like 3 SEQ ID NOS: 7962-7968 LOXL4 Lysyl oxidase-like 4 SEQ ID NO: 7969 LPA Lipoprotein, Lp(a) SEQ ID NOS: 7970-7972 LPL Lipoprotein lipase SEQ ID NOS: 7973-7977 LPO Lactoperoxidase SEQ ID NOS: 7978-7984 LRAT Lecithin retinol acyltransferase SEQ ID NOS: 7985-7987 (phosphatidylcholine-retinol O-acyltransferase) LRCH3 Leucine-rich repeats and calponin homology (CH) SEQ ID NOS: 7988-7996 domain containing 3 LRCOL1 Leucine rich colipase-like 1 SEQ ID NOS: 7997-8000 LRFN4 Leucine rich repeat and fibronectin type III domain SEQ ID NOS: 8001-8002 containing 4 LRFN5 Leucine rich repeat and fibronectin type III domain SEQ ID NOS: 8003-8005 containing 5 LRG1 Leucine-rich alpha-2-glycoprotein 1 SEQ ID NO: 8006 LRP1 Low density lipoprotein receptor-related protein 1 SEQ ID NOS: 8007-8012 LRP11 Low density lipoprotein receptor-related protein 11 SEQ ID NOS: 8013-8014 LRP1B Low density lipoprotein receptor-related protein 1B SEQ ID NOS: 8015-8018 LRP2 Low density lipoprotein receptor-related protein 2 SEQ ID NOS: 8019-8020 LRP4 Low density lipoprotein receptor-related protein 4 SEQ ID NOS: 8021-8022 LRPAP1 Low density lipoprotein receptor-related protein SEQ ID NOS: 8023-8024 associated protein 1 LRRC17 Leucine rich repeat containing 17 SEQ ID NOS: 8025-8027 LRRC32 Leucine rich repeat containing 32 SEQ ID NOS: 8028-8031 LRRC3B Leucine rich repeat containing 3B SEQ ID NOS: 8032-8036 LRRC4B Leucine rich repeat containing 4B SEQ ID NOS: 8037-8039 LRRC70 Leucine rich repeat containing 70 SEQ ID NOS: 8040-8041 LRRN3 Leucine rich repeat neuronal 3 SEQ ID NOS: 8042-8045 LRRTM1 Leucine rich repeat transmembrane neuronal 1 SEQ ID NOS: 8046-8052 LRRTM2 Leucine rich repeat transmembrane neuronal 2 SEQ ID NOS: 8053-8055 LRRTM4 Leucine rich repeat transmembrane neuronal 4 SEQ ID NOS: 8056-8061 LRTM2 Leucine-rich repeats and transmembrane domains 2 SEQ ID NOS: 8062-8066 LSR Lipolysis stimulated lipoprotein receptor SEQ ID NOS: 8067-8077 LST1 Leukocyte specific transcript 1 SEQ ID NOS: 8078-8095 LTA Lymphotoxin alpha SEQ ID NOS: 8096-8097 LTBP1 Latent transforming growth factor beta binding SEQ ID NOS: 8098-8107 protein 1 LTBP2 Latent transforming growth factor beta binding SEQ ID NOS: 8108-8111 protein 2 LTBP3 Latent transforming growth factor beta binding SEQ ID NOS: 8112-8124 protein 3 LTBP4 Latent transforming growth factor beta binding SEQ ID NOS: 8125-8140 protein 4 LTBR Lymphotoxin beta receptor (TNFR superfamily, SEQ ID NOS: 8141-8146 member 3) LTF Lactotransferrin SEQ ID NOS: 8147-8151 LTK Leukocyte receptor tyrosine kinase SEQ ID NOS: 8152-8155 LUM Lumican SEQ ID NO: 8156 LUZP2 Leucine zipper protein 2 SEQ ID NOS: 8157-8160 LVRN Laeverin SEQ ID NOS: 8161-8166 LY6E Lymphocyte antigen 6 complex, locus E SEQ ID NOS: 8167-8180 LY6G5B Lymphocyte antigen 6 complex, locus G5B SEQ ID NOS: 8181-8182 LY6G6D Lymphocyte antigen 6 complex, locus G6D SEQ ID NOS: 8183-8184 LY6G6E Lymphocyte antigen 6 complex, locus G6E SEQ ID NOS: 8185-8188 (pseudogene) LY6H Lymphocyte antigen 6 complex, locus H SEQ ID NOS: 8189-8192 LY6K Lymphocyte antigen 6 complex, locus K SEQ ID NOS: 8193-8196 RP11- SEQ ID NO: 8197 520P18.5 LY86 Lymphocyte antigen 86 SEQ ID NOS: 8198-8199 LY96 Lymphocyte antigen 96 SEQ ID NOS: 8200-8201 LYG1 Lysozyme G-like 1 SEQ ID NOS: 8202-8203 LYG2 Lysozyme G-like 2 SEQ ID NOS: 8204-8209 LYNX1 Ly6/neurotoxin 1 SEQ ID NOS: 8210-8214 LYPD1 LY6/PLAUR domain containing 1 SEQ ID NOS: 8215-8217 LYPD2 LY6/PLAUR domain containing 2 SEQ ID NO: 8218 LYPD4 LY6/PLAUR domain containing 4 SEQ ID NOS: 8219-8221 LYPD6 LY6/PLAUR domain containing 6 SEQ ID NOS: 8222-8226 LYPD6B LY6/PLAUR domain containing 6B SEQ ID NOS: 8227-8233 LYPD8 LY6/PLAUR domain containing 8 SEQ ID NOS: 8234-8235 LYZ Lysozyme SEQ ID NOS: 8236-8238 LYZL4 Lysozyme-like 4 SEQ ID NOS: 8239-8240 LYZL6 Lysozyme-like 6 SEQ ID NOS: 8241-8243 M6PR Mannose-6-phosphate receptor (cation dependent) SEQ ID NOS: 8244-8254 MAD1L1 MAD1 mitotic arrest deficient-like 1 (yeast) SEQ ID NOS: 8255-8267 MAG Myelin associated glycoprotein SEQ ID NOS: 8268-8273 MAGT1 Magnesium transporter 1 SEQ ID NOS: 8274-8277 MALSU1 Mitochondrial assembly of ribosomal large subunit 1 SEQ ID NO: 8278 MAMDC2 MAM domain containing 2 SEQ ID NO: 8279 MAN2B1 Mannosidase, alpha, class 2B, member 1 SEQ ID NOS: 8280-8285 MAN2B2 Mannosidase, alpha, class 2B, member 2 SEQ ID NOS: 8286-8288 MANBA Mannosidase, beta A, lysosomal SEQ ID NOS: 8289-8302 MANEAL Mannosidase, endo-alpha-like SEQ ID NOS: 8303-8307 MANF Mesencephalic astrocyte-derived neurotrophic SEQ ID NOS: 8308-8309 factor MANSC1 MANSC domain containing 1 SEQ ID NOS: 8310-8313 MAP3K9 Mitogen-activated protein kinase 9 SEQ ID NOS: 8314-8319 MASP1 Mannan-binding lectin serine peptidase 1 (C4/C2 SEQ ID NOS: 8320-8327 activating component of Ra-reactive factor) MASP2 Mannan-binding lectin serine peptidase 2 SEQ ID NOS: 8328-8329 MATN1 Matrilin 1, cartilage matrix protein SEQ ID NO: 8330 MATN2 Matrilin 2 SEQ ID NOS: 8331-8343 MATN3 Matrilin 3 SEQ ID NOS: 8344-8345 MATN4 Matrilin 4 SEQ ID NOS: 8346-8350 MATR3 Matrin 3 SEQ ID NOS: 8351-8378 MAU2 MAU2 sister chromatid cohesion factor SEQ ID NOS: 8379-8381 MAZ MYC-associated zinc finger protein (purine-binding SEQ ID NOS: 8382-8396 transcription factor) MBD6 Methyl-CpG binding domain protein 6 SEQ ID NOS: 8397-8408 MBL2 Mannose-binding lectin (protein C) 2, soluble SEQ ID NO: 8409 MBNL1 Muscleblind-like splicing regulator 1 SEQ ID NOS: 8410-8428 MCCC1 Methylcrotonoyl-CoA carboxylase 1 (alpha) SEQ ID NOS: 8429-8440 MCCD1 Mitochondrial coiled-coil domain 1 SEQ ID NO: 8441 MCEE Methylmalonyl CoA epimerase SEQ ID NOS: 8442-8445 MCF2L MCF.2 cell line derived transforming sequence-like SEQ ID NOS: 8446-8467 MCFD2 Multiple coagulation factor deficiency 2 SEQ ID NOS: 8468-8479 MDFIC MyoD family inhibitor domain containing SEQ ID NOS: 8480-8487 MDGA1 MAM domain containing SEQ ID NOS: 8488-8493 glycosylphosphatidylinositol anchor 1 MDK Midkine (neurite growth-promoting factor 2) SEQ ID NOS: 8494-8503 MED20 Mediator complex subunit 20 SEQ ID NOS: 8504-8508 MEGF10 Multiple EGF-like-domains 10 SEQ ID NOS: 8509-8512 MEGF6 Multiple EGF-like-domains 6 SEQ ID NOS: 8513-8516 MEI1 Meiotic double-stranded break formation protein 1 SEQ ID NOS: 8517-8520 MEI4 Meiotic double-stranded break formation protein 4 SEQ ID NO: 8521 MEIS1 Meis homeobox 1 SEQ ID NOS: 8522-8527 MEIS3 Meis homeobox 3 SEQ ID NOS: 8528-8537 MFI2 Antigen p97 (melanoma associated) identified by SEQ ID NOS: 8538-8540 monoclonal antibodies 133.2 and 96.5 MEPE Matrix extracellular phosphoglycoprotein SEQ ID NOS: 8541-8547 MESDC2 Mesoderm development candidate 2 SEQ ID NOS: 8548-8552 MEST Mesoderm specific transcript SEQ ID NOS: 8553-8566 MET MET proto-oncogene, receptor tyrosine kinase SEQ ID NOS: 8567-8572 METRN Meteorin, glial cell differentiation regulator SEQ ID NOS: 8573-8577 METRNL Meteorin, glial cell differentiation regulator-like SEQ ID NOS: 8578-8581 METTL17 Methyltransferase like 17 SEQ ID NOS: 8582-8592 METTL24 Methyltransferase like 24 SEQ ID NO: 8593 METTL7B Methyltransferase like 7B SEQ ID NOS: 8594-8595 METTL9 Methyltransferase like 9 SEQ ID NOS: 8596-8604 MEX3C Mex-3 RNA binding family member C SEQ ID NOS: 8605-8607 MFAP2 Microfibrillar-associated protein 2 SEQ ID NOS: 8608-8609 MFAP3 Microfibrillar-associated protein 3 SEQ ID NOS: 8610-8614 MFAP3L Microfibrillar-associated protein 3-like SEQ ID NOS: 8615-8624 MFAP4 Microfibrillar-associated protein 4 SEQ ID NOS: 8625-8627 MFAP5 Microfibrillar associated protein 5 SEQ ID NOS: 8628-8638 MFGE8 Milk fat globule-EGF factor 8 protein SEQ ID NOS: 8639-8645 MFNG MFNG O-fucosylpeptide 3-beta-N- SEQ ID NOS: 8646-8653 acetylglucosaminyltransferase MGA MGA, MAX dimerization protein SEQ ID NOS: 8654-8662 MGAT2 Mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N- SEQ ID NO: 8663 acetylglucosaminyltransferase MGAT3 Mannosyl (beta-1,4-)-glycoprotein beta-1,4-N- SEQ ID NOS: 8664-8666 acetylglucosaminyltransferase MGAT4A Mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N- SEQ ID NOS: 8667-8671 acetylglucosaminyltransferase, isozyme A MGAT4B Mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N- SEQ ID NOS: 8672-8682 acetylglucosaminyltransferase, isozyme B MGAT4D MGAT4 family, member D SEQ ID NOS: 8683-8688 MGLL Monoglyceride lipase SEQ ID NOS: 8689-8698 MGP Matrix Gla protein SEQ ID NOS: 8699-8701 MGST2 Microsomal glutathione S-transferase 2 SEQ ID NOS: 8702-8705 MIA Melanoma inhibitory activity SEQ ID NOS: 8706-8711 MIA2 Melanoma inhibitory activity 2 SEQ ID NO: 8712 MIA3 Melanoma inhibitory activity family, member 3 SEQ ID NOS: 8713-8717 MICU1 Mitochondrial calcium uptake 1 SEQ ID NOS: 8718-8727 MIER1 Mesoderm induction early response 1, SEQ ID NOS: 8728-8736 transcriptional regulator MINOS1- MINOS1-NBL1 readthrough SEQ ID NOS: 8737-8739 NBL1 MINPP1 Multiple inositol-polyphosphate phosphatase 1 SEQ ID NOS: 8740-8742 MLEC Malectin SEQ ID NOS: 8743-8746 MLN Motilin SEQ ID NOS: 8747-8749 MLXIP MLX interacting protein SEQ ID NOS: 8750-8755 MLXIPL MLX interacting protein-like SEQ ID NOS: 8756-8763 MMP1 Matrix metallopeptidase 1 SEQ ID NO: 8764 MMP10 Matrix metallopeptidase 10 SEQ ID NOS: 8765-8766 MMP11 Matrix metallopeptidase 11 SEQ ID NOS: 8767-8770 MMP12 Matrix metallopeptidase 12 SEQ ID NO: 8771 MMP13 Matrix metallopeptidase 13 SEQ ID NOS: 8772-8774 MMP14 Matrix metallopeptidase 14 (membrane-inserted) SEQ ID NOS: 8775-8777 MMP17 Matrix metallopeptidase 17 (membrane-inserted) SEQ ID NOS: 8778-8785 MMP19 Matrix metallopeptidase 19 SEQ ID NOS: 8786-8791 MMP2 Matrix metallopeptidase 2 SEQ ID NOS: 8792-8799 MMP20 Matrix metallopeptidase 20 SEQ ID NO: 8800 MMP21 Matrix metallopeptidase 21 SEQ ID NO: 8801 MMP25 Matrix metallopeptidase 25 SEQ ID NOS: 8802-8803 MMP26 Matrix metallopeptidase 26 SEQ ID NOS: 8804-8805 MMP27 Matrix metallopeptidase 27 SEQ ID NO: 8806 MMP28 Matrix metallopeptidase 28 SEQ ID NOS: 8807-8812 MMP3 Matrix metallopeptidase 3 SEQ ID NOS: 8813-8815 MMP7 Matrix metallopeptidase 7 SEQ ID NO: 8816 MMP8 Matrix metallopeptidase 8 SEQ ID NOS: 8817-8822 MMP9 Matrix metallopeptidase 9 SEQ ID NO: 8823 MMRN1 Multimerin 1 SEQ ID NOS: 8824-8826 MMRN2 Multimerin 2 SEQ ID NOS: 8827-8831 MOXD1 Monooxygenase, DBH-like 1 SEQ ID NOS: 8832-8834 C6orf25 Chromosome 6 open reading frame 25 SEQ ID NOS: 8835-8842 MPO Myeloperoxidase SEQ ID NOS: 8843-8844 MPPED1 Metallophosphoesterase domain containing 1 SEQ ID NOS: 8845-8848 MPZL1 Myelin protein zero-like 1 SEQ ID NOS: 8849-8853 MR1 Major histocompatibility complex, class I-related SEQ ID NOS: 8854-8859 MRPL2 Mitochondrial ribosomal protein L2 SEQ ID NOS: 8860-8864 MRPL21 Mitochondrial ribosomal protein L21 SEQ ID NOS: 8865-8871 MRPL22 Mitochondrial ribosomal protein L22 SEQ ID NOS: 8872-8876 MRPL24 Mitochondrial ribosomal protein L24 SEQ ID NOS: 8877-8881 MRPL27 Mitochondrial ribosomal protein L27 SEQ ID NOS: 8882-8887 MRPL32 Mitochondrial ribosomal protein L32 SEQ ID NOS: 8888-8890 MRPL34 Mitochondrial ribosomal protein L34 SEQ ID NOS: 8891-8895 MRPL35 Mitochondrial ribosomal protein L35 SEQ ID NOS: 8896-8899 MRPL52 Mitochondrial ribosomal protein L52 SEQ ID NOS: 8900-8910 MRPL55 Mitochondrial ribosomal protein L55 SEQ ID NOS: 8911-8936 MRPS14 Mitochondrial ribosomal protein S14 SEQ ID NOS: 8937-8938 MRPS22 Mitochondrial ribosomal protein S22 SEQ ID NOS: 8939-8947 MRPS28 Mitochondrial ribosomal protein S28 SEQ ID NOS: 8948-8955 MS4A14 Membrane-spanning 4-domains, subfamily A, SEQ ID NOS: 8956-8966 member 14 MS4A3 Membrane-spanning 4-domains, subfamily A, SEQ ID NOS: 8967-8971 member 3 (hematopoietic cell-specific) MSH3 MutS homolog 3 SEQ ID NO: 8972 MSH5 MutS homolog 5 SEQ ID NOS: 8973-8984 MSLN Mesothelin SEQ ID NOS: 8985-8992 MSMB Microseminoprotein, beta- SEQ ID NOS: 8993-8994 MSRA Methionine sulfoxide reductase A SEQ ID NOS: 8995-9002 MSRB2 Methionine sulfoxide reductase B2 SEQ ID NOS: 9003-9004 MSRB3 Methionine sulfoxide reductase B3 SEQ ID NOS: 9005-9018 MST1 Macrophage stimulating 1 SEQ ID NOS: 9019-9020 MSTN Myostatin SEQ ID NO: 9021 MT1G Metallothionein 1G SEQ ID NOS: 9022-9025 MTHFD2 Methylenetetrahydrofolate dehydrogenase (NADP + SEQ ID NOS: 9026-9030 dependent) 2, methenyltetrahydrofolate cyclohydrolase MTMR14 Myotubularin related protein 14 SEQ ID NOS: 9031-9041 MTRNR2L11 MT-RNR2-like 11 (pseudogene) SEQ ID NO: 9042 MTRR 5-methyltetrahydrofolate-homocysteine SEQ ID NOS: 9043-9055 methyltransferase reductase MTTP Microsomal triglyceride transfer protein SEQ ID NOS: 9056-9066 MTX2 Metaxin 2 SEQ ID NOS: 9067-9071 MUC1 Mucin 1, cell surface associated SEQ ID NOS: 9072-9097 MUC13 Mucin 13, cell surface associated SEQ ID NOS: 9098-9099 MUC20 Mucin 20, cell surface associated SEQ ID NOS: 9100-9104 MUC3A Mucin 3A, cell surface associated SEQ ID NOS: 9105-9107 MUC5AC Mucin 5AC, oligomeric mucus/gel-forming SEQ ID NO: 9108 MUC5B Mucin 5B, oligomeric mucus/gel-forming SEQ ID NOS: 9109-9110 MUC6 Mucin 6, oligomeric mucus/gel-forming SEQ ID NOS: 9111-9114 MUC7 Mucin 7, secreted SEQ ID NOS: 9115-9118 MUCL1 Mucin-like 1 SEQ ID NOS: 9119-9121 MXRA5 Matrix-remodelling associated 5 SEQ ID NO: 9122 MXRA7 Matrix-remodelling associated 7 SEQ ID NOS: 9123-9129 MYDGF Myeloid-derived growth factor SEQ ID NOS: 9130-9132 MYL1 Myosin, light chain 1, alkali; skeletal, fast SEQ ID NOS: 9133-9134 MYOC Myocilin, trabecular meshwork inducible SEQ ID NOS: 9135-9136 glucocorticoid response MYRFL Myelin regulatory factor-like SEQ ID NOS: 9137-9141 MZB1 Marginal zone B and B1 cell-specific protein SEQ ID NOS: 9142-9146 N4BP2L2 NEDD4 binding protein 2-like 2 SEQ ID NOS: 9147-9152 NAA38 N(alpha)-acetyltransferase 38, NatC auxiliary subunit SEQ ID NOS: 9153-9158 NAAA N-acylethanolamine acid amidase SEQ ID NOS: 9159-9164 NAGA N-acetylgalactosaminidase, alpha- SEQ ID NOS: 9165-9167 NAGLU N-acetylglucosaminidase, alpha SEQ ID NOS: 9168-9172 NAGS N-acetylglutamate synthase SEQ ID NOS: 9173-9174 NAPSA Napsin A aspartic peptidase SEQ ID NOS: 9175-9177 CARKD Carbohydrate kinase domain containing SEQ ID NOS: 9178-9179 APOA1BP Apolipoprotein A-I binding protein SEQ ID NOS: 9180-9182 NBL1 Neuroblastoma 1, DAN family BMP antagonist SEQ ID NOS: 9183-9196 NCAM1 Neural cell adhesion molecule 1 SEQ ID NOS: 9197-9216 NCAN Neurocan SEQ ID NOS: 9217-9218 NCBP2-AS2 NCBP2 antisense RNA 2 (head to head) SEQ ID NO: 9219 NCSTN Nicastrin SEQ ID NOS: 9220-9229 NDNF Neuron-derived neurotrophic factor SEQ ID NOS: 9230-9232 NDP Norrie disease (pseudoglioma) SEQ ID NOS: 9233-9235 NDUFA10 NADH dehydrogenase (ubiquinone) 1 alpha SEQ ID NOS: 9236-9245 subcomplex, 10, 42 kDa NDUFB5 NADH dehydrogenase (ubiquinone) 1 beta SEQ ID NOS: 9246-9254 subcomplex, 5, 16 kDa NDUFS8 NADH dehydrogenase (ubiquinone) Fe—S protein 8, SEQ ID NOS: 9255-9264 23 kDa (NADH-coenzyme Q reductase) NDUFV1 NADH dehydrogenase (ubiquinone) flavoprotein 1, SEQ ID NOS: 9265-9278 51 kDa NECAB3 N-terminal EF-hand calcium binding protein 3 SEQ ID NOS: 9279-9288 PVRL1 Poliovirus receptor-related 1 (herpesvirus entry SEQ ID NOS: 9289-9291 mediator C) NELL1 Neural EGFL like 1 SEQ ID NOS: 9292-9295 NELL2 Neural EGFL like 2 SEQ ID NOS: 9296-9310 NENF Neudesin neurotrophic factor SEQ ID NO: 9311 NETO1 Neuropilin (NRP) and tolloid (TLL)-like 1 SEQ ID NOS: 9312-9316 NFASC Neurofascin SEQ ID NOS: 9317-9331 NFE2L1 Nuclear factor, erythroid 2-like 1 SEQ ID NOS: 9332-9350 NFE2L3 Nuclear factor, erythroid 2-like 3 SEQ ID NOS: 9351-9352 NGEF Neuronal guanine nucleotide exchange factor SEQ ID NOS: 9353-9358 NGF Nerve growth factor (beta polypeptide) SEQ ID NO: 9359 NGLY1 N-glycanase 1 SEQ ID NOS: 9360-9366 NGRN Neugrin, neurite outgrowth associated SEQ ID NOS: 9367-9368 NHLRC3 NHL repeat containing 3 SEQ ID NOS: 9369-9371 NID1 Nidogen 1 SEQ ID NOS: 9372-9373 NID2 Nidogen 2 (osteonidogen) SEQ ID NOS: 9374-9376 NKG7 Natural killer cell granule protein 7 SEQ ID NOS: 9377-9381 NLGN3 Neuroligin 3 SEQ ID NOS: 9382-9386 NLGN4Y Neuroligin 4, Y-linked SEQ ID NOS: 9387-9393 NLRP5 NLR family, pyrin domain containing 5 SEQ ID NOS: 9394-9396 NMB Neuromedin B SEQ ID NOS: 9397-9398 NME1 NME/NM23 nucleoside diphosphate kinase 1 SEQ ID NOS: 9399-9405 NME1- NME1-NME2 readthrough SEQ ID NOS: 9406-9408 NME2 NME3 NME/NM23 nucleoside diphosphate kinase 3 SEQ ID NOS: 9409-9413 NMS Neuromedin S SEQ ID NO: 9414 NMU Neuromedin U SEQ ID NOS: 9415-9418 NOA1 Nitric oxide associated 1 SEQ ID NO: 9419 NODAL Nodal growth differentiation factor SEQ ID NOS: 9420-9421 NOG Noggin SEQ ID NO: 9422 NOMO3 NODAL modulator 3 SEQ ID NOS: 9423-9429 NOS1AP Nitric oxide synthase 1 (neuronal) adaptor protein SEQ ID NOS: 9430-9434 NOTCH3 Notch 3 SEQ ID NOS: 9435-9438 NOTUM Notum pectinacetylesterase homolog (Drosophila) SEQ ID NOS: 9439-9441 NOV Nephroblastoma overexpressed SEQ ID NO: 9442 NPB Neuropeptide B SEQ ID NOS: 9443-9444 NPC2 Niemann-Pick disease, type C2 SEQ ID NOS: 9445-9453 NPFF Neuropeptide FF-amide peptide precursor SEQ ID NO: 9454 NPFFR2 Neuropeptide FF receptor 2 SEQ ID NOS: 9455-9458 NPHS1 Nephrosis 1, congenital, Finnish type (nephrin) SEQ ID NOS: 9459-9460 NPNT Nephronectin SEQ ID NOS: 9461-9471 NPPA Natriuretic peptide A SEQ ID NOS: 9472-9474 NPPB Natriuretic peptide B SEQ ID NO: 9475 NPPC Natriuretic peptide C SEQ ID NOS: 9476-9477 NPS Neuropeptide S SEQ ID NO: 9478 NPTX1 Neuronal pentraxin I SEQ ID NO: 9479 NPTX2 Neuronal pentraxin II SEQ ID NO: 9480 NPTXR Neuronal pentraxin receptor SEQ ID NOS: 9481-9482 NPVF Neuropeptide VF precursor SEQ ID NO: 9483 NPW Neuropeptide W SEQ ID NOS: 9484-9486 NPY Neuropeptide Y SEQ ID NOS: 9487-9489 NQO2 NAD(P)H dehydrogenase, quinone 2 SEQ ID NOS: 9490-9498 NRCAM Neuronal cell adhesion molecule SEQ ID NOS: 9499-9511 NRG1 Neuregulin 1 SEQ ID NOS: 9512-9529 NRN1L Neuritin 1-like SEQ ID NOS: 9530-9532 NRP1 Neuropilin 1 SEQ ID NOS: 9533-9546 NRP2 Neuropilin 2 SEQ ID NOS: 9547-9553 NRTN Neurturin SEQ ID NO: 9554 NRXN1 Neurexin 1 SEQ ID NOS: 9555-9585 NRXN2 Neurexin 2 SEQ ID NOS: 9586-9594 NT5C3A 5′-nucleotidase, cytosolic IIIA SEQ ID NOS: 9595-9605 NT5DC3 5′-nucleotidase domain containing 3 SEQ ID NOS: 9606-9608 NT5E 5′-nucleotidase, ecto (CD73) SEQ ID NOS: 9609-9613 NTF3 Neurotrophin 3 SEQ ID NOS: 9614-9615 NTF4 Neurotrophin 4 SEQ ID NOS: 9616-9617 NTM Neurotrimin SEQ ID NOS: 9618-9627 NTN1 Netrin 1 SEQ ID NOS: 9628-9629 NTN3 Netrin 3 SEQ ID NO: 9630 NTN4 Netrin 4 SEQ ID NOS: 9631-9635 NTN5 Netrin 5 SEQ ID NOS: 9636-9637 NTNG1 Netrin G1 SEQ ID NOS: 9638-9644 NTNG2 Netrin G2 SEQ ID NOS: 9645-9646 NTS Neurotensin SEQ ID NOS: 9647-9648 NUBPL Nucleotide binding protein-like SEQ ID NOS: 9649-9655 NUCB1 Nucleobindin 1 SEQ ID NOS: 9656-9662 NUCB2 Nucleobindin 2 SEQ ID NOS: 9663-9678 NUDT19 Nudix (nucleoside diphosphate linked moiety X)-type SEQ ID NO: 9679 motif 19 NUDT9 Nudix (nucleoside diphosphate linked moiety X)-type SEQ ID NOS: 9680-9684 motif 9 NUP155 Nucleoporin 155 kDa SEQ ID NOS: 9685-9688 NUP214 Nucleoporin 214 kDa SEQ ID NOS: 9689-9700 NUP85 Nucleoporin 85 kDa SEQ ID NOS: 9701-9715 NXPE3 Neurexophilin and PC-esterase domain family, SEQ ID NOS: 9716-9721 member 3 NXPE4 Neurexophilin and PC-esterase domain family, SEQ ID NOS: 9722-9723 member 4 NXPH1 Neurexophilin 1 SEQ ID NOS: 9724-9727 NXPH2 Neurexophilin 2 SEQ ID NO: 9728 NXPH3 Neurexophilin 3 SEQ ID NOS: 9729-9730 NXPH4 Neurexophilin 4 SEQ ID NOS: 9731-9732 NYX Nyctalopin SEQ ID NOS: 9733-9734 OAF Out at first homolog SEQ ID NOS: 9735-9736 OBP2A Odorant binding protein 2A SEQ ID NOS: 9737-9743 OBP2B Odorant binding protein 2B SEQ ID NOS: 9744-9747 OC90 Otoconin 90 SEQ ID NO: 9748 OCLN Occludin SEQ ID NOS: 9749-9751 ODAM Odontogenic, ameloblast asssociated SEQ ID NOS: 9752-9755 C4orf26 Chromosome 4 open reading frame 26 SEQ ID NOS: 9756-9759 OGG1 8-oxoguanine DNA glycosylase SEQ ID NOS: 9760-9773 OGN Osteoglycin SEQ ID NOS: 9774-9776 OIT3 Oncoprotein induced transcript 3 SEQ ID NOS: 9777-9778 OLFM1 Olfactomedin 1 SEQ ID NOS: 9779-9789 OLFM2 Olfactomedin 2 SEQ ID NOS: 9790-9793 OLFM3 Olfactomedin 3 SEQ ID NOS: 9794-9796 OLFM4 Olfactomedin 4 SEQ ID NO: 9797 OLFML1 Olfactomedin-like 1 SEQ ID NOS: 9798-9801 OLFML2A Olfactomedin-like 2A SEQ ID NOS: 9802-9804 OLFML2B Olfactomedin-like 2B SEQ ID NOS: 9805-9809 OLFML3 Olfactomedin-like 3 SEQ ID NOS: 9810-9812 OMD Osteomodulin SEQ ID NO: 9813 OMG Oligodendrocyte myelin glycoprotein SEQ ID NO: 9814 OOSP2 Oocyte secreted protein 2 SEQ ID NOS: 9815-9816 OPCML Opioid binding protein/cell adhesion molecule-like SEQ ID NOS: 9817-9821 PROL1 Proline rich, lacrimal 1 SEQ ID NO: 9822 OPTC Opticin SEQ ID NOS: 9823-9824 ORAI1 ORAI calcium release-activated calcium modulator 1 SEQ ID NO: 9825 ORM1 Orosomucoid 1 SEQ ID NO: 9826 ORM2 Orosomucoid 2 SEQ ID NO: 9827 ORMDL2 ORMDL sphingolipid biosynthesis regulator 2 SEQ ID NOS: 9828-9831 OS9 Osteosarcoma amplified 9, endoplasmic reticulum SEQ ID NOS: 9832-9846 lectin OSCAR Osteoclast associated, immunoglobulin-like receptor SEQ ID NOS: 9847-9857 OSM Oncostatin M SEQ ID NOS: 9858-9860 OSMR Oncostatin M receptor SEQ ID NOS: 9861-9865 OSTN Osteocrin SEQ ID NOS: 9866-9867 OTOA Otoancorin SEQ ID NOS: 9868-9873 OTOG Otogelin SEQ ID NOS: 9874-9876 OTOGL Otogelin-like SEQ ID NOS: 9877-9883 OTOL1 Otolin 1 SEQ ID NO: 9884 OTOR Otoraplin SEQ ID NO: 9885 OTOS Otospiralin SEQ ID NOS: 9886-9887 OVCH1 Ovochymase 1 SEQ ID NOS: 9888-9890 OVCH2 Ovochymase 2 (gene/pseudogene) SEQ ID NOS: 9891-9892 OVGP1 Oviductal glycoprotein 1, 120 kDa SEQ ID NO: 9893 OXCT1 3-oxoacid CoA transferase 1 SEQ ID NOS: 9894-9897 OXCT2 3-oxoacid CoA transferase 2 SEQ ID NO: 9898 OXNAD1 Oxidoreductase NAD-binding domain containing 1 SEQ ID NOS: 9899-9905 OXT Oxytocin/neurophysin I prepropeptide SEQ ID NO: 9906 P3H1 Prolyl 3-hydroxylase 1 SEQ ID NOS: 9907-9911 P3H2 Prolyl 3-hydroxylase 2 SEQ ID NOS: 9912-9915 P3H3 Prolyl 3-hydroxylase 3 SEQ ID NO: 9916 P3H4 Prolyl 3-hydroxylase family member 4 (non- SEQ ID NOS: 9917-9921 enzymatic) P4HA1 Prolyl 4-hydroxylase, alpha polypeptide I SEQ ID NOS: 9922-9926 P4HA2 Prolyl 4-hydroxylase, alpha polypeptide II SEQ ID NOS: 9927-9941 P4HA3 Prolyl 4-hydroxylase, alpha polypeptide III SEQ ID NOS: 9942-9946 P4HB Prolyl 4-hydroxylase, beta polypeptide SEQ ID NOS: 9947-9958 PAEP Progestagen-associated endometrial protein SEQ ID NOS: 9959-9967 PAM Peptidylglycine alpha-amidating monooxygenase SEQ ID NOS: 9968-9981 PAMR1 Peptidase domain containing associated with muscle SEQ ID NOS: 9982-9988 regeneration 1 PAPLN Papilin, proteoglycan-like sulfated glycoprotein SEQ ID NOS: 9989-9996 PAPPA Pregnancy-associated plasma protein A, SEQ ID NO: 9997 pappalysin 1 PAPPA2 Pappalysin 2 SEQ ID NOS: 9998-9999 PARP15 Poly (ADP-ribose) polymerase family, member 15 SEQ ID NOS: 10000-10003 PARVB Parvin, beta SEQ ID NOS: 10004-10008 PATE1 Prostate and testis expressed 1 SEQ ID NOS: 10009-10010 PATE2 Prostate and testis expressed 2 SEQ ID NOS: 10011-10012 PATE3 Prostate and testis expressed 3 SEQ ID NO: 10013 PATE4 Prostate and testis expressed 4 SEQ ID NOS: 10014-10015 PATL2 Protein associated with topoisomerase II homolog 2 SEQ ID NOS: 10016-10021 (yeast) PAX2 Paired box 2 SEQ ID NOS: 10022-10027 PAX4 Paired box 4 SEQ ID NOS: 10028-10034 PCCB Propionyl CoA carboxylase, beta polypeptide SEQ ID NOS: 10035-10049 PCDH1 Protocadherin 1 SEQ ID NOS: 10050-10055 PCDH12 Protocadherin 12 SEQ ID NOS: 10056-10057 PCDH15 Protocadherin-related 15 SEQ ID NOS: 10058-10091 PCDHA1 Protocadherin alpha 1 SEQ ID NOS: 10092-10094 PCDHA10 Protocadherin alpha 10 SEQ ID NOS: 10095-10097 PCDHA11 Protocadherin alpha 11 SEQ ID NOS: 10098-10100 PCDHA6 Protocadherin alpha 6 SEQ ID NOS: 10101-10103 PCDHB12 Protocadherin beta 12 SEQ ID NOS: 10104-10106 PCDHGA11 Protocadherin gamma subfamily A, 11 SEQ ID NOS: 10107-10109 PCF11 PCF11 cleavage and polyadenylation factor subunit SEQ ID NOS: 10110-10114 PCOLCE Procollagen C-endopeptidase enhancer SEQ ID NO: 10115 PCOLCE2 Procollagen C-endopeptidase enhancer 2 SEQ ID NOS: 10116-10119 PCSK1 Proprotein convertase subtilisin/kexin type 1 SEQ ID NOS: 10120-10122 PCSK1N Proprotein convertase subtilisin/kexin type 1 SEQ ID NO: 10123 inhibitor PCSK2 Proprotein convertase subtilisin/kexin type 2 SEQ ID NOS: 10124-10126 PCSK4 Proprotein convertase subtilisin/kexin type 4 SEQ ID NOS: 10127-10129 PCSK5 Proprotein convertase subtilisin/kexin type 5 SEQ ID NOS: 10130-10134 PCSK9 Proprotein convertase subtilisin/kexin type 9 SEQ ID NO: 10135 PCYOX1 Prenylcysteine oxidase 1 SEQ ID NOS: 10136-10140 PCYOX1L Prenylcysteine oxidase 1 like SEQ ID NOS: 10141-10145 PDE11A Phosphodiesterase 11A SEQ ID NOS: 10146-10151 PDE2A Phosphodiesterase 2A, cGMP-stimulated SEQ ID NOS: 10152-10173 PDE7A Phosphodiesterase 7A SEQ ID NOS: 10174-10177 PDF Peptide deformylase (mitochondrial) SEQ ID NO: 10178 PDGFA Platelet-derived growth factor alpha polypeptide SEQ ID NOS: 10179-10182 PDGFB Platelet-derived growth factor beta polypeptide SEQ ID NOS: 10183-10186 PDGFC Platelet derived growth factor C SEQ ID NOS: 10187-10190 PDGFD Platelet derived growth factor D SEQ ID NOS: 10191-10193 PDGFRA Platelet-derived growth factor receptor, alpha SEQ ID NOS: 10194-10200 polypeptide PDGFRB Platelet-derived growth factor receptor, beta SEQ ID NOS: 10201-10204 polypeptide PDGFRL Platelet-derived growth factor receptor-like SEQ ID NOS: 10205-10206 PDHA1 Pyruvate dehydrogenase (lipoamide) alpha 1 SEQ ID NOS: 10207-10215 PDIA2 Protein disulfide isomerase family A, member 2 SEQ ID NOS: 10216-10219 PDIA3 Protein disulfide isomerase family A, member 3 SEQ ID NOS: 10220-10223 PDIA4 Protein disulfide isomerase family A, member 4 SEQ ID NOS: 10224-10225 PDIA5 Protein disulfide isomerase family A, member 5 SEQ ID NOS: 10226-10229 PDIA6 Protein disulfide isomerase family A, member 6 SEQ ID NOS: 10230-10236 PDILT Protein disulfide isomerase-like, testis expressed SEQ ID NOS: 10237-10238 PDYN Prodynorphin SEQ ID NOS: 10239-10241 PDZD8 PDZ domain containing 8 SEQ ID NO: 10242 PDZRN4 PDZ domain containing ring finger 4 SEQ ID NOS: 10243-10245 PEAR1 Platelet endothelial aggregation receptor 1 SEQ ID NOS: 10246-10249 PEBP4 Phosphatidylethanolamine-binding protein 4 SEQ ID NOS: 10250-10251 PECAM1 Platelet/endothelial cell adhesion molecule 1 SEQ ID NOS: 10252-10255 PENK Proenkephalin SEQ ID NOS: 10256-10261 PET117 PET117 homolog SEQ ID NO: 10262 PF4 Platelet factor 4 SEQ ID NO: 10263 PF4V1 Platelet factor 4 variant 1 SEQ ID NO: 10264 PFKP Phosphofructokinase, platelet SEQ ID NOS: 10265-10273 PFN1 Profilin 1 SEQ ID NOS: 10274-10276 PGA3 Pepsinogen 3, group I (pepsinogen A) SEQ ID NOS: 10277-10280 PGA4 Pepsinogen 4, group I (pepsinogen A) SEQ ID NOS: 10281-10283 PGA5 Pepsinogen 5, group I (pepsinogen A) SEQ ID NOS: 10284-10286 PGAM5 PGAM family member 5, serine/threonine protein SEQ ID NOS: 10287-10290 phosphatase, mitochondrial PGAP3 Post-GPI attachment to proteins 3 SEQ ID NOS: 10291-10298 PGC Progastricsin (pepsinogen C) SEQ ID NOS: 10299-10302 PGF Placental growth factor SEQ ID NOS: 10303-10306 PGLYRP1 Peptidoglycan recognition protein 1 SEQ ID NO: 10307 PGLYRP2 Peptidoglycan recognition protein 2 SEQ ID NOS: 10308-10311 PGLYRP3 Peptidoglycan recognition protein 3 SEQ ID NO: 10312 PGLYRP4 Peptidoglycan recognition protein 4 SEQ ID NOS: 10313-10314 PHACTR1 Phosphatase and actin regulator 1 SEQ ID NOS: 10315-10321 PHB Prohibitin SEQ ID NOS: 10322-10330 PI15 Peptidase inhibitor 15 SEQ ID NOS: 10331-10332 PI3 Peptidase inhibitor 3, skin-derived SEQ ID NO: 10333 PIANP PILR alpha associated neural protein SEQ ID NOS: 10334-10339 PIGK Phosphatidylinositol glycan anchor biosynthesis, SEQ ID NOS: 10340-10343 class K PIGL Phosphatidylinositol glycan anchor biosynthesis, SEQ ID NOS: 10344-10351 class L PIGT Phosphatidylinositol glycan anchor biosynthesis, SEQ ID NOS: 10352-10406 class T PIGZ Phosphatidylinositol glycan anchor biosynthesis, SEQ ID NOS: 10407-10409 class Z PIK3AP1 Phosphoinositide-3-kinase adaptor protein 1 SEQ ID NOS: 10410-10412 PIK3IP1 Phosphoinositide-3-kinase interacting protein 1 SEQ ID NOS: 10413-10416 PILRA Paired immunoglobin-like type 2 receptor alpha SEQ ID NOS: 10417-10421 PILRB Paired immunoglobin-like type 2 receptor beta SEQ ID NOS: 10422-10433 PINLYP Phospholipase A2 inhibitor and LY6/PLAUR domain SEQ ID NOS: 10434-10438 containing PIP Prolactin-induced protein SEQ ID NO: 10439 PIWIL4 Piwi-like RNA-mediated gene silencing 4 SEQ ID NOS: 10440-10444 PKDCC Protein kinase domain containing, cytoplasmic SEQ ID NOS: 10445-10446 PKHD1 Polycystic kidney and hepatic disease 1 (autosomal SEQ ID NOS: 10447-10448 recessive) PLA1A Phospholipase A1 member A SEQ ID NOS: 10449-10453 PLA2G10 Phospholipase A2, group X SEQ ID NOS: 10454-10455 PLA2G12A Phospholipase A2, group XIIA SEQ ID NOS: 10456-10458 PLA2G12B Phospholipase A2, group XIIB SEQ ID NO: 10459 PLA2G15 Phospholipase A2, group XV SEQ ID NOS: 10460-10467 PLA2G1B Phospholipase A2, group IB (pancreas) SEQ ID NOS: 10468-10470 PLA2G2A Phospholipase A2, group IIA (platelets, synovial SEQ ID NOS: 10471-10472 fluid) PLA2G2C Phospholipase A2, group IIC SEQ ID NOS: 10473-10474 PLA2G2D Phospholipase A2, group IID SEQ ID NOS: 10475-10476 PLA2G2E Phospholipase A2, group IIE SEQ ID NO: 10477 PLA2G3 Phospholipase A2, group III SEQ ID NO: 10478 PLA2G5 Phospholipase A2, group V SEQ ID NO: 10479 PLA2G7 Phospholipase A2, group VII (platelet-activating SEQ ID NOS: 10480-10481 factor acetylhydrolase, plasma) PLA2R1 Phospholipase A2 receptor 1, 180 kDa SEQ ID NOS: 10482-10483 PLAC1 Placenta-specific 1 SEQ ID NO: 10484 PLAC9 Placenta-specific 9 SEQ ID NOS: 10485-10487 PLAT Plasminogen activator, tissue SEQ ID NOS: 10488-10496 PLAU Plasminogen activator, urokinase SEQ ID NOS: 10497-10499 PLAUR Plasminogen activator, urokinase receptor SEQ ID NOS: 10500-10511 PLBD1 Phospholipase B domain containing 1 SEQ ID NOS: 10512-10514 PLBD2 Phospholipase B domain containing 2 SEQ ID NOS: 10515-10517 PLG Plasminogen SEQ ID NOS: 10518-10520 PLGLB1 Plasminogen-like B1 SEQ ID NOS: 10521-10524 PLGLB2 Plasminogen-like B2 SEQ ID NOS: 10525-10526 PLOD1 Procollagen-lysine, 2-oxoglutarate 5-dioxygenase 1 SEQ ID NOS: 10527-10529 PLOD2 Procollagen-lysine, 2-oxoglutarate 5-dioxygenase 2 SEQ ID NOS: 10530-10535 PLOD3 Procollagen-lysine, 2-oxoglutarate 5-dioxygenase 3 SEQ ID NOS: 10536-10542 PLTP Phospholipid transfer protein SEQ ID NOS: 10543-10547 PLXNA4 Plexin A4 SEQ ID NOS: 10548-10551 PLXNB2 Plexin B2 SEQ ID NOS: 10552-10560 PM20D1 Peptidase M20 domain containing 1 SEQ ID NO: 10561 PMCH Pro-melanin-concentrating hormone SEQ ID NO: 10562 PMEL Premelanosome protein SEQ ID NOS: 10563-10574 PMEPA1 Prostate transmembrane protein, androgen SEQ ID NOS: 10575-10581 induced 1 PNLIP Pancreatic lipase SEQ ID NO: 10582 PNLIPRP1 Pancreatic lipase-related protein 1 SEQ ID NOS: 10583-10591 PNLIPRP3 Pancreatic lipase-related protein 3 SEQ ID NO: 10592 PNOC Prepronociceptin SEQ ID NOS: 10593-10595 PNP Purine nucleoside phosphorylase SEQ ID NOS: 10596-10599 PNPLA4 Patatin-like phospholipase domain containing 4 SEQ ID NOS: 10600-10603 PODNL1 Podocan-like 1 SEQ ID NOS: 10604-10615 POFUT1 Protein O-fucosyltransferase 1 SEQ ID NOS: 10616-10617 POFUT2 Protein O-fucosyltransferase 2 SEQ ID NOS: 10618-10623 POGLUT1 Protein O-glucosyltransferase 1 SEQ ID NOS: 10624-10628 POLL Polymerase (DNA directed), lambda SEQ ID NOS: 10629-10641 POMC Proopiomelanocortin SEQ ID NOS: 10642-10646 POMGNT2 Protein O-linked mannose N- SEQ ID NOS: 10647-10648 acetylglucosaminyltransferase 2 (beta 1,4-) PON1 Paraoxonase 1 SEQ ID NOS: 10649-10650 PON2 Paraoxonase 2 SEQ ID NOS: 10651-10663 PON3 Paraoxonase 3 SEQ ID NOS: 10664-10669 POSTN Periostin, osteoblast specific factor SEQ ID NOS: 10670-10675 PPBP Pro-platelet basic protein (chemokine (C-X-C motif) SEQ ID NO: 10676 ligand 7) PPIB Peptidylprolyl isomerase B (cyclophilin B) SEQ ID NO: 10677 PPIC Peptidylprolyl isomerase C (cyclophilin C) SEQ ID NO: 10678 PPOX Protoporphyrinogen oxidase SEQ ID NOS: 10679-10689 PPP1CA Protein phosphatase 1, catalytic subunit, alpha SEQ ID NOS: 10690-10695 isozyme PPT1 Palmitoyl-protein thioesterase 1 SEQ ID NOS: 10696-10712 PPT2 Palmitoyl-protein thioesterase 2 SEQ ID NOS: 10713-10720 PPY Pancreatic polypeptide SEQ ID NOS: 10721-10725 PRAC2 Prostate cancer susceptibility candidate 2 SEQ ID NOS: 10726-10727 PRADC1 Protease-associated domain containing 1 SEQ ID NO: 10728 PRAP1 Proline-rich acidic protein 1 SEQ ID NOS: 10729-10730 PRB1 Proline-rich protein BstNI subfamily 1 SEQ ID NOS: 10731-10734 PRB2 Proline-rich protein BstNI subfamily 2 SEQ ID NOS: 10735-10736 PRB3 Proline-rich protein BstNI subfamily 3 SEQ ID NOS: 10737-10738 PRB4 Proline-rich protein BstNI subfamily 4 SEQ ID NOS: 10739-10742 PRCD Progressive rod-cone degeneration SEQ ID NOS: 10743-10744 PRCP Prolylcarboxypeptidase (angiotensinase C) SEQ ID NOS: 10745-10756 PRDM12 PR domain containing 12 SEQ ID NO: 10757 PRDX4 Peroxiredoxin 4 SEQ ID NOS: 10758-10761 PRELP Proline/arginine-rich end leucine-rich repeat protein SEQ ID NO: 10762 PRF1 Perforin 1 (pore forming protein) SEQ ID NOS: 10763-10765 PRG2 Proteoglycan 2, bone marrow (natural killer cell SEQ ID NOS: 10766-10768 activator, eosinophil granule major basic protein) PRG3 Proteoglycan 3 SEQ ID NO: 10769 PRG4 Proteoglycan 4 SEQ ID NOS: 10770-10775 PRH1 Proline-rich protein Haelll subfamily 1 SEQ ID NOS: 10776-10778 PRH2 Proline-rich protein Haelll subfamily 2 SEQ ID NOS: 10779-10780 PRKAG1 Protein kinase, AMP-activated, gamma 1 non- SEQ ID NOS: 10781-10795 catalytic subunit PRKCSH Protein kinase C substrate 80K-H SEQ ID NOS: 10796-10805 PRKD1 Protein kinase D1 SEQ ID NOS: 10806-10811 PRL Prolactin SEQ ID NOS: 10812-10814 PRLH Prolactin releasing hormone SEQ ID NO: 10815 PRLR Prolactin receptor SEQ ID NOS: 10816-10834 PRNP Prion protein SEQ ID NOS: 10835-10838 PRNT Prion protein (testis specific) SEQ ID NO: 10839 PROC Protein C (inactivator of coagulation factors Va and SEQ ID NOS: 10840-10847 VIIIa) PROK1 Prokineticin 1 SEQ ID NO: 10848 PROK2 Prokineticin 2 SEQ ID NOS: 10849-10850 PROM1 Prominin 1 SEQ ID NOS: 10851-10862 PROS1 Protein S (alpha) SEQ ID NOS: 10863-10866 PROZ Protein Z, vitamin K-dependent plasma glycoprotein SEQ ID NOS: 10867-10868 PRR27 Proline rich 27 SEQ ID NOS: 10869-10872 PRR4 Proline rich 4 (lacrimal) SEQ ID NOS: 10873-10875 PRRG2 Proline rich Gla (G-carboxyglutamic acid) 2 SEQ ID NOS: 10876-10878 PRRT3 Proline-rich transmembrane protein 3 SEQ ID NOS: 10879-10881 PRRT4 Proline-rich transmembrane protein 4 SEQ ID NOS: 10882-10888 PRSS1 Protease, serine, 1 (trypsin 1) SEQ ID NOS: 10889-10892 PRSS12 Protease, serine, 12 (neurotrypsin, motopsin) SEQ ID NO: 10893 PRSS16 Protease, serine, 16 (thymus) SEQ ID NOS: 10894-10901 PRSS2 Protease, serine, 2 (trypsin 2) SEQ ID NOS: 10902-10905 PRSS21 Protease, serine, 21 (testisin) SEQ ID NOS: 10906-10911 PRSS22 Protease, serine, 22 SEQ ID NOS: 10912-10914 PRSS23 Protease, serine, 23 SEQ ID NOS: 10915-10918 PRSS27 Protease, serine 27 SEQ ID NOS: 10919-10921 PRSS3 Protease, serine, 3 SEQ ID NOS: 10922-10926 PRSS33 Protease, serine, 33 SEQ ID NOS: 10927-10930 PRSS35 Protease, serine, 35 SEQ ID NO: 10931 PRSS36 Protease, serine, 36 SEQ ID NOS: 10932-10935 PRSS37 Protease, serine, 37 SEQ ID NOS: 10936-10939 PRSS38 Protease, serine, 38 SEQ ID NO: 10940 PRSS42 Protease, serine, 42 SEQ ID NOS: 10941-10942 PRSS48 Protease, serine, 48 SEQ ID NOS: 10943-10944 PRSS50 Protease, serine, 50 SEQ ID NO: 10945 PRSS53 Protease, serine, 53 SEQ ID NO: 10946 PRSS54 Protease, serine, 54 SEQ ID NOS: 10947-10951 PRSS55 Protease, serine, 55 SEQ ID NOS: 10952-10954 PRSS56 Protease, serine, 56 SEQ ID NOS: 10955-10956 PRSS57 Protease, serine, 57 SEQ ID NOS: 10957-10958 PRSS58 Protease, serine, 58 SEQ ID NOS: 10959-10960 PRSS8 Protease, serine, 8 SEQ ID NOS: 10961-10964 PRTG Protogenin SEQ ID NOS: 10965-10968 PRTN3 Proteinase 3 SEQ ID NOS: 10969-10970 PSAP Prosaposin SEQ ID NOS: 10971-10974 PSAPL1 Prosaposin-like 1 (gene/pseudogene) SEQ ID NO: 10975 PSG1 Pregnancy specific beta-1-glycoprotein 1 SEQ ID NOS: 10976-10983 PSG11 Pregnancy specific beta-1-glycoprotein 11 SEQ ID NOS: 10984-10988 PSG2 Pregnancy specific beta-1-glycoprotein 2 SEQ ID NOS: 10989-10990 PSG3 Pregnancy specific beta-1-glycoprotein 3 SEQ ID NOS: 10991-10994 PSG4 Pregnancy specific beta-1-glycoprotein 4 SEQ ID NOS: 10995-11006 PSG5 Pregnancy specific beta-1-glycoprotein 5 SEQ ID NOS: 11007-11012 PSG6 Pregnancy specific beta-1-glycoprotein 6 SEQ ID NOS: 11013-11018 PSG7 Pregnancy specific beta-1-glycoprotein 7 SEQ ID NOS: 11019-11021 (gene/pseudogene) PSG8 Pregnancy specific beta-1-glycoprotein 8 SEQ ID NOS: 11022-11026 PSG9 Pregnancy specific beta-1-glycoprotein 9 SEQ ID NOS: 11027-11034 PSMD1 Proteasome 26S subunit, non-ATPase 1 SEQ ID NOS: 11035-11042 PSORS1C2 Psoriasis susceptibility 1 candidate 2 SEQ ID NO: 11043 PSPN Persephin SEQ ID NOS: 11044-11045 PTGDS Prostaglandin D2 synthase 21 kDa (brain) SEQ ID NOS: 11046-11050 PTGIR Prostaglandin I2 (prostacyclin) receptor (IP) SEQ ID NOS: 11051-11055 PTGS1 Prostaglandin-endoperoxide synthase 1 SEQ ID NOS: 11056-11064 (prostaglandin G/H synthase and cyclooxygenase) PTGS2 Prostaglandin-endoperoxide synthase 2 SEQ ID NOS: 11065-11066 (prostaglandin G/H synthase and cyclooxygenase) PTH Parathyroid hormone SEQ ID NOS: 11067-11068 PTH2 Parathyroid hormone 2 SEQ ID NO: 11069 PTHLH Parathyroid hormone-like hormone SEQ ID NOS: 11070-11078 PTK7 Protein tyrosine kinase 7 (inactive) SEQ ID NOS: 11079-11094 PTN Pleiotrophin SEQ ID NOS: 11095-11096 PTPRA Protein tyrosine phosphatase, receptor type, A SEQ ID NOS: 11097-11104 PTPRB Protein tyrosine phosphatase, receptor type, B SEQ ID NOS: 11105-11112 PTPRC Protein tyrosine phosphatase, receptor type, C SEQ ID NOS: 11113-11123 PTPRCAP Protein tyrosine phosphatase, receptor type, C- SEQ ID NO: 11124 associated protein PTPRD Protein tyrosine phosphatase, receptor type, D SEQ ID NOS: 11125-11136 PTPRF Protein tyrosine phosphatase, receptor type, F SEQ ID NOS: 11137-11144 PTPRJ Protein tyrosine phosphatase, receptor type, J SEQ ID NOS: 11145-11150 PTPRO Protein tyrosine phosphatase, receptor type, O SEQ ID NOS: 11151-11159 PTPRS Protein tyrosine phosphatase, receptor type, S SEQ ID NOS: 11160-11167 PTTG1IP Pituitary tumor-transforming 1 interacting protein SEQ ID NOS: 11168-11171 PTX3 Pentraxin 3, long SEQ ID NO: 11172 PTX4 Pentraxin 4, long SEQ ID NOS: 11173-11175 PVR Poliovirus receptor SEQ ID NOS: 11176-11181 PXDN Peroxidasin SEQ ID NOS: 11182-11186 PXDNL Peroxidasin-like SEQ ID NOS: 11187-11189 PXYLP1 2-phosphoxylose phosphatase 1 SEQ ID NOS: 11190-11202 PYY Peptide YY SEQ ID NOS: 11203-11204 PZP Pregnancy-zone protein SEQ ID NOS: 11205-11206 QPCT Glutaminyl-peptide cyclotransferase SEQ ID NOS: 11207-11209 QPRT Quinolinate phosphoribosyltransferase SEQ ID NOS: 11210-11211 QRFP Pyroglutamylated RFamide peptide SEQ ID NOS: 11212-11213 QSOX1 Quiescin Q6 sulfhydryl oxidase 1 SEQ ID NOS: 11214-11217 R3HDML R3H domain containing-like SEQ ID NO: 11218 RAB26 RAB26, member RAS oncogene family SEQ ID NOS: 11219-11222 RAB36 RAB36, member RAS oncogene family SEQ ID NOS: 11223-11225 RAB9B RAB9B, member RAS oncogene family SEQ ID NO: 11226 RAET1E Retinoic acid early transcript 1E SEQ ID NOS: 11227-11232 RAET1G Retinoic acid early transcript 1G SEQ ID NOS: 11233-11235 RAMP2 Receptor (G protein-coupled) activity modifying SEQ ID NOS: 11236-11240 protein 2 RAPGEF5 Rap guanine nucleotide exchange factor (GEF) 5 SEQ ID NOS: 11241-11247 RARRES1 Retinoic acid receptor responder (tazarotene SEQ ID NOS: 11248-11249 induced) 1 RARRES2 Retinoic acid receptor responder (tazarotene SEQ ID NOS: 11250-11253 induced) 2 RASA2 RAS p21 protein activator 2 SEQ ID NOS: 11254-11256 RBM3 RNA binding motif (RNP1, RRM) protein 3 SEQ ID NOS: 11257-11259 RBP3 Retinol binding protein 3, interstitial SEQ ID NO: 11260 RBP4 Retinol binding protein 4, plasma SEQ ID NOS: 11261-11264 RCN1 Reticulocalbin 1, EF-hand calcium binding domain SEQ ID NOS: 11265-11268 RCN2 Reticulocalbin 2, EF-hand calcium binding domain SEQ ID NOS: 11269-11272 RCN3 Reticulocalbin 3, EF-hand calcium binding domain SEQ ID NOS: 11273-11276 RCOR1 REST corepressor 1 SEQ ID NOS: 11277-11278 RDH11 Retinol dehydrogenase 11 (all-trans/9-cis/11-cis) SEQ ID NOS: 11279-11286 RDH12 Retinol dehydrogenase 12 (all-trans/9-cis/11-cis) SEQ ID NOS: 11287-11288 RDH13 Retinol dehydrogenase 13 (all-trans/9-cis) SEQ ID NOS: 11289-11297 RDH5 Retinol dehydrogenase 5 (11-cis/9-cis) SEQ ID NOS: 11298-11302 RDH8 Retinol dehydrogenase 8 (all-trans) SEQ ID NOS: 11303-11304 REG1A Regenerating islet-derived 1 alpha SEQ ID NO: 11305 REG1B Regenerating islet-derived 1 beta SEQ ID NOS: 11306-11307 REG3A Regenerating islet-derived 3 alpha SEQ ID NOS: 11308-11310 REG3G Regenerating islet-derived 3 gamma SEQ ID NOS: 11311-11313 REG4 Regenerating islet-derived family, member 4 SEQ ID NOS: 11314-11317 RELN Reelin SEQ ID NOS: 11318-11321 RELT RELT tumor necrosis factor receptor SEQ ID NOS: 11322-11325 REN Renin SEQ ID NOS: 11326-11327 REPIN1 Replication initiator 1 SEQ ID NOS: 11328-11341 REPS2 RALBP1 associated Eps domain containing 2 SEQ ID NOS: 11342-11343 RET Ret proto-oncogene SEQ ID NOS: 11344-11349 RETN Resistin SEQ ID NOS: 11350-11352 RETNLB Resistin like beta SEQ ID NO: 11353 RETSAT Retinol saturase (all-trans-retinol 13,14-reductase) SEQ ID NOS: 11354-11358 RFNG RFNG O-fucosylpeptide 3-beta-N- SEQ ID NOS: 11359-11361 acetylglucosaminyltransferase RGCC Regulator of cell cycle SEQ ID NO: 11362 RGL4 Ral guanine nucleotide dissociation stimulator-like 4 SEQ ID NOS: 11363-11369 RGMA Repulsive guidance molecule family member a SEQ ID NOS: 11370-11379 RGMB Repulsive guidance molecule family member b SEQ ID NOS: 11380-11381 RHOQ Ras homolog family member Q SEQ ID NOS: 11382-11386 RIC3 RIC3 acetylcholine receptor chaperone SEQ ID NOS: 11387-11394 HRSP12 Heat-responsive protein 12 SEQ ID NOS: 11395-11398 RIMS1 Regulating synaptic membrane exocytosis 1 SEQ ID NOS: 11399-11414 RIPPLY1 Ripply transcriptional repressor 1 SEQ ID NOS: 11415-11416 RLN1 Relaxin 1 SEQ ID NO: 11417 RLN2 Relaxin 2 SEQ ID NOS: 11418-11419 RLN3 Relaxin 3 SEQ ID NOS: 11420-11421 RMDN1 Regulator of microtubule dynamics 1 SEQ ID NOS: 11422-11435 RNASE1 Ribonuclease, RNase A family, 1 (pancreatic) SEQ ID NOS: 11436-11440 RNASE10 Ribonuclease, RNase A family, 10 (non-active) SEQ ID NOS: 11441-11442 RNASE11 Ribonuclease, RNase A family, 11 (non-active) SEQ ID NOS: 11443-11453 RNASE12 Ribonuclease, RNase A family, 12 (non-active) SEQ ID NO: 11454 RNASE13 Ribonuclease, RNase A family, 13 (non-active) SEQ ID NO: 11455 RNASE2 Ribonuclease, RNase A family, 2 (liver, eosinophil- SEQ ID NO: 11456 derived neurotoxin) RNASE3 Ribonuclease, RNase A family, 3 SEQ ID NO: 11457 RNASE4 Ribonuclease, RNase A family, 4 SEQ ID NOS: 11458-11460 RNASE6 Ribonuclease, RNase A family, k6 SEQ ID NO: 11461 RNASE7 Ribonuclease, RNase A family, 7 SEQ ID NOS: 11462-11463 RNASE8 Ribonuclease, RNase A family, 8 SEQ ID NO: 11464 RNASE9 Ribonuclease, RNase A family, 9 (non-active) SEQ ID NOS: 11465-11475 RNASEH1 Ribonuclease H1 SEQ ID NOS: 11476-11478 RNASET2 Ribonuclease T2 SEQ ID NOS: 11479-11486 RNF146 Ring finger protein 146 SEQ ID NOS: 11487-11498 RNF148 Ring finger protein 148 SEQ ID NOS: 11499-11500 RNF150 Ring finger protein 150 SEQ ID NOS: 11501-11505 RNF167 Ring finger protein 167 SEQ ID NOS: 11506-11516 RNF220 Ring finger protein 220 SEQ ID NOS: 11517-11523 RNF34 Ring finger protein 34, E3 ubiquitin protein ligase SEQ ID NOS: 11524-11531 RNLS Renalase, FAD-dependent amine oxidase SEQ ID NOS: 11532-11534 RNPEP Arginyl aminopeptidase (aminopeptidase B) SEQ ID NOS: 11535-11540 ROR1 Receptor tyrosine kinase-like orphan receptor 1 SEQ ID NOS: 11541-11543 RPL3 Ribosomal protein L3 SEQ ID NOS: 11544-11549 RPLP2 Ribosomal protein, large, P2 SEQ ID NOS: 11550-11552 RPN2 Ribophorin II SEQ ID NOS: 11553-11559 RPS27L Ribosomal protein S27-like SEQ ID NOS: 11560-11565 RS1 Retinoschisin 1 SEQ ID NO: 11566 RSF1 Remodeling and spacing factor 1 SEQ ID NOS: 11567-11573 RSPO1 R-spondin 1 SEQ ID NOS: 11574-11577 RSPO2 R-spondin 2 SEQ ID NOS: 11578-11585 RSPO3 R-spondin 3 SEQ ID NOS: 11586-11587 RSPO4 R-spondin 4 SEQ ID NOS: 11588-11589 RSPRY1 Ring finger and SPRY domain containing 1 SEQ ID NOS: 11590-11596 RTBDN Retbindin SEQ ID NOS: 11597-11609 RTN4RL1 Reticulon 4 receptor-like 1 SEQ ID NO: 11610 RTN4RL2 Reticulon 4 receptor-like 2 SEQ ID NOS: 11611-11613 SAA1 Serum amyloid A1 SEQ ID NOS: 11614-11616 SAA2 Serum amyloid A2 SEQ ID NOS: 11617-11622 SAA4 Serum amyloid A4, constitutive SEQ ID NO: 11623 SAP30 Sin3A-associated protein, 30 kDa SEQ ID NO: 11624 SAR1A Secretion associated, Ras related GTPase 1A SEQ ID NOS: 11625-11631 SARAF Store-operated calcium entry-associated regulatory SEQ ID NOS: 11632-11642 factor SARM1 Sterile alpha and TIR motif containing 1 SEQ ID NOS: 11643-11646 SATB1 SATB homeobox 1 SEQ ID NOS: 11647-11659 SAXO2 Stabilizer of axonemal microtubules 2 SEQ ID NOS: 11660-11664 SBSN Suprabasin SEQ ID NOS: 11665-11667 SBSPON Somatomedin B and thrombospondin, type 1 SEQ ID NO: 11668 domain containing SCARF1 Scavenger receptor class F, member 1 SEQ ID NOS: 11669-11673 SCG2 Secretogranin II SEQ ID NOS: 11674-11676 SCG3 Secretogranin III SEQ ID NOS: 11677-11679 SCG5 Secretogranin V SEQ ID NOS: 11680-11684 SCGB1A1 Secretoglobin, family 1A, member 1 (uteroglobin) SEQ ID NOS: 11685-11686 SCGB1C1 Secretoglobin, family 1C, member 1 SEQ ID NO: 11687 SCGB1C2 Secretoglobin, family 1C, member 2 SEQ ID NO: 11688 SCGB1D1 Secretoglobin, family 1D, member 1 SEQ ID NO: 11689 SCGB1D2 Secretoglobin, family 1D, member 2 SEQ ID NO: 11690 SCGB1D4 Secretoglobin, family 1D, member 4 SEQ ID NO: 11691 SCGB2A1 Secretoglobin, family 2A, member 1 SEQ ID NO: 11692 SCGB2A2 Secretoglobin, family 2A, member 2 SEQ ID NOS: 11693-11694 SCGB2B2 Secretoglobin, family 2B, member 2 SEQ ID NOS: 11695-11696 SCGB3A1 Secretoglobin, family 3A, member 1 SEQ ID NO: 11697 SCGB3A2 Secretoglobin, family 3A, member 2 SEQ ID NOS: 11698-11699 SCN1B Sodium channel, voltage gated, type I beta subunit SEQ ID NOS: 11700-11705 SCN3B Sodium channel, voltage gated, type III beta subunit SEQ ID NOS: 11706-11710 SCPEP1 Serine carboxypeptidase 1 SEQ ID NOS: 11711-11718 SCRG1 Stimulator of chondrogenesis 1 SEQ ID NOS: 11719-11720 SCT Secretin SEQ ID NO: 11721 SCUBE1 Signal peptide, CUB domain, EGF-like 1 SEQ ID NOS: 11722-11725 SCUBE2 Signal peptide, CUB domain, EGF-like 2 SEQ ID NOS: 11726-11732 SCUBE3 Signal peptide, CUB domain, EGF-like 3 SEQ ID NO: 11733 SDC1 Syndecan 1 SEQ ID NOS: 11734-11738 SDF2 Stromal cell-derived factor 2 SEQ ID NOS: 11739-11741 SDF2L1 Stromal cell-derived factor 2-like 1 SEQ ID NO: 11742 SDF4 Stromal cell derived factor 4 SEQ ID NOS: 11743-11746 SDHAF2 Succinate dehydrogenase complex assembly factor 2 SEQ ID NOS: 11747-11754 SDHAF4 Succinate dehydrogenase complex assembly factor 4 SEQ ID NO: 11755 SDHB Succinate dehydrogenase complex, subunit B, iron SEQ ID NOS: 11756-11758 sulfur (Ip) SDHD Succinate dehydrogenase complex, subunit D, SEQ ID NOS: 11759-11768 integral membrane protein SEC14L3 SEC14-like lipid binding 3 SEQ ID NOS: 11769-11775 SEC16A SEC16 homolog A, endoplasmic reticulum export SEQ ID NOS: 11776-11782 factor SEC16B SEC16 homolog B, endoplasmic reticulum export SEQ ID NOS: 11783-11786 factor SEC22C SEC22 homolog C, vesicle trafficking protein SEQ ID NOS: 11787-11799 SEC31A SEC31 homolog A, COPII coat complex component SEQ ID NOS: 11800-11829 SECISBP2 SECIS binding protein 2 SEQ ID NOS: 11830-11834 SECTM1 Secreted and transmembrane 1 SEQ ID NOS: 11835-11842 SEL1L Sel-1 suppressor of lin-12-like (C. elegans) SEQ ID NOS: 11843-11845 SEPT15 15 kDa selenoprotein SEQ ID NOS: 11846-11852 SELM Selenoprotein M SEQ ID NOS: 11853-11855 SEPN1 Selenoprotein N, 1 SEQ ID NOS: 11856-11859 SELO Selenoprotein O SEQ ID NOS: 11860-11861 SEPP1 Selenoprotein P, plasma, 1 SEQ ID NOS: 11862-11867 SEMA3A Sema domain, immunoglobulin domain (Ig), short SEQ ID NOS: 11868-11872 basic domain, secreted, (semaphorin) 3A SEMA3B Sema domain, immunoglobulin domain (Ig), short SEQ ID NOS: 11873-11879 basic domain, secreted, (semaphorin) 3B SEMA3C Sema domain, immunoglobulin domain (Ig), short SEQ ID NOS: 11880-11884 basic domain, secreted, (semaphorin) 3C SEMA3E Sema domain, immunoglobulin domain (Ig), short SEQ ID NOS: 11885-11889 basic domain, secreted, (semaphorin) 3E SEMA3F Sema domain, immunoglobulin domain (Ig), short SEQ ID NOS: 11890-11896 basic domain, secreted, (semaphorin) 3F SEMA3G Sema domain, immunoglobulin domain (Ig), short SEQ ID NOS: 11897-11899 basic domain, secreted, (semaphorin) 3G SEMA4A Sema domain, immunoglobulin domain (Ig), SEQ ID NOS: 11900-11908 transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4A SEMA4B Sema domain, immunoglobulin domain (Ig), SEQ ID NOS: 11909-11919 transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4B SEMA4C Sema domain, immunoglobulin domain (Ig), SEQ ID NOS: 11920-11922 transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4C SEMA4D Sema domain, immunoglobulin domain (Ig), SEQ ID NOS: 11923-11936 transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D SEMA4F Sema domain, immunoglobulin domain (Ig), SEQ ID NOS: 11937-11945 transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4F SEMA4G Sema domain, immunoglobulin domain (Ig), SEQ ID NOS: 11946-11953 transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4G SEMA5A Sema domain, seven thrombospondin repeats (type SEQ ID NOS: 11954-11955 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5A SEMA6A Sema domain, transmembrane domain (TM), and SEQ ID NOS: 11956-11963 cytoplasmic domain, (semaphorin) 6A SEMA6C Sema domain, transmembrane domain (TM), and SEQ ID NOS: 11964-11969 cytoplasmic domain, (semaphorin) 6C SEMA6D Sema domain, transmembrane domain (TM), and SEQ ID NOS: 11970-11983 cytoplasmic domain, (semaphorin) 6D SEMG1 Semenogelin I SEQ ID NO: 11984 SEMG2 Semenogelin II SEQ ID NO: 11985 SEPT9 Septin 9 SEQ ID NOS: 11986-12022 SERPINA1 Serpin peptidase inhibitor, clade A (alpha-1 SEQ ID NOS: 12023-12039 antiproteinase, antitrypsin), member 1 SERPINA10 Serpin peptidase inhibitor, clade A (alpha-1 SEQ ID NOS: 12040-12043 antiproteinase, antitrypsin), member 10 SERPINA11 Serpin peptidase inhibitor, clade A (alpha-1 SEQ ID NO: 12044 antiproteinase, antitrypsin), member 11 SERPINA12 Serpin peptidase inhibitor, clade A (alpha-1 SEQ ID NOS: 12045-12046 antiproteinase, antitrypsin), member 12 SERPINA3 Serpin peptidase inhibitor, clade A (alpha-1 SEQ ID NOS: 12047-12053 antiproteinase, antitrypsin), member 3 SERPINA4 Serpin peptidase inhibitor, clade A (alpha-1 SEQ ID NOS: 12054-12056 antiproteinase, antitrypsin), member 4 SERPINA5 Serpin peptidase inhibitor, clade A (alpha-1 SEQ ID NOS: 12057-12068 antiproteinase, antitrypsin), member 5 SERPINA6 Serpin peptidase inhibitor, clade A (alpha-1 SEQ ID NOS: 12069-12071 antiproteinase, antitrypsin), member 6 SERPINA7 Serpin peptidase inhibitor, clade A (alpha-1 SEQ ID NOS: 12072-12073 antiproteinase, antitrypsin), member 7 SERPINA9 Serpin peptidase inhibitor, clade A (alpha-1 SEQ ID NOS: 12074-12080 antiproteinase, antitrypsin), member 9 SERPINB2 Serpin peptidase inhibitor, clade B (ovalbumin), SEQ ID NOS: 12081-12085 member 2 SERPINC1 Serpin peptidase inhibitor, clade C (antithrombin), SEQ ID NOS: 12086-12087 member 1 SERPIND1 Serpin peptidase inhibitor, clade D (heparin SEQ ID NOS: 12088-12089 cofactor), member 1 SERPINE1 Serpin peptidase inhibitor, clade E (nexin, SEQ ID NO: 12090 plasminogen activator inhibitor type 1), member 1 SERPINE2 Serpin peptidase inhibitor, clade E (nexin, SEQ ID NOS: 12091-12097 plasminogen activator inhibitor type 1), member 2 SERPINE3 Serpin peptidase inhibitor, clade E (nexin, SEQ ID NOS: 12098-12101 plasminogen activator inhibitor type 1), member 3 SERPINF1 Serpin peptidase inhibitor, clade F (alpha-2 SEQ ID NOS: 12102-12110 antiplasmin, pigment epithelium derived factor), member 1 SERPINF2 Serpin peptidase inhibitor, clade F (alpha-2 SEQ ID NOS: 12111-12115 antiplasmin, pigment epithelium derived factor), member 2 SERPING1 Serpin peptidase inhibitor, clade G (C1 inhibitor), SEQ ID NOS: 12116-12126 member 1 SERPINH1 Serpin peptidase inhibitor, clade H (heat shock SEQ ID NOS: 12127-12141 protein 47), member 1, (collagen binding protein 1) SERPINI1 Serpin peptidase inhibitor, clade I (neuroserpin), SEQ ID NOS: 12142-12146 member 1 SERPINI2 Serpin peptidase inhibitor, clade I (pancpin), SEQ ID NOS: 12147-12153 member 2 SEZ6L2 Seizure related 6 homolog (mouse)-like 2 SEQ ID NOS: 12154-12160 SFRP1 Secreted frizzled-related protein 1 SEQ ID NOS: 12161-12162 SFRP2 Secreted frizzled-related protein 2 SEQ ID NO: 12163 SFRP4 Secreted frizzled-related protein 4 SEQ ID NOS: 12164-12165 SFRP5 Secreted frizzled-related protein 5 SEQ ID NO: 12166 SFTA2 Surfactant associated 2 SEQ ID NOS: 12167-12168 SFTPA1 Surfactant protein A1 SEQ ID NOS: 12169-12173 SFTPA2 Surfactant protein A2 SEQ ID NOS: 12174-12178 SFTPB Surfactant protein B SEQ ID NOS: 12179-12183 SFTPD Surfactant protein D SEQ ID NOS: 12184-12185 SFXN5 Sideroflexin 5 SEQ ID NOS: 12186-12190 SGCA Sarcoglycan, alpha (50 kDa dystrophin-associated SEQ ID NOS: 12191-12198 glycoprotein) SGSH N-sulfoglucosamine sulfohydrolase SEQ ID NOS: 12199-12207 SH3RF3 SH3 domain containing ring finger 3 SEQ ID NO: 12208 SHBG Sex hormone-binding globulin SEQ ID NOS: 12209-12227 SHE Src homology 2 domain containing E SEQ ID NOS: 12228-12230 SHH Sonic hedgehog SEQ ID NOS: 12231-12234 SHKBP1 SH3KBP1 binding protein 1 SEQ ID NOS: 12235-12250 SIAE Sialic acid acetylesterase SEQ ID NOS: 12251-12253 SIDT2 SID1 transmembrane family, member 2 SEQ ID NOS: 12254-12263 SIGLEC10 Sialic acid binding Ig-like lectin 10 SEQ ID NOS: 12264-12272 SIGLEC6 Sialic acid binding Ig-like lectin 6 SEQ ID NOS: 12273-12278 SIGLEC7 Sialic acid binding Ig-like lectin 7 SEQ ID NOS: 12279-12283 SIGLECL1 SIGLEC family like 1 SEQ ID NOS: 12284-12289 SIGMAR1 Sigma non-opioid intracellular receptor 1 SEQ ID NOS: 12290-12293 SIL1 SIL1 nucleotide exchange factor SEQ ID NOS: 12294-12302 SIRPB1 Signal-regulatory protein beta 1 SEQ ID NOS: 12303-12315 SIRPD Signal-regulatory protein delta SEQ ID NOS: 12316-12318 SLAMF1 Signaling lymphocytic activation molecule family SEQ ID NOS: 12319-12321 member 1 SLAMF7 SLAM family member 7 SEQ ID NOS: 12322-12330 SLC10A3 Solute carrier family 10, member 3 SEQ ID NOS: 12331-12335 SLC15A3 Solute carrier family 15 (oligopeptide transporter), SEQ ID NOS: 12336-12341 member 3 SLC25A14 Solute carrier family 25 (mitochondrial carrier, SEQ ID NOS: 12342-12348 brain), member 14 SLC25A25 Solute carrier family 25 (mitochondrial carrier; SEQ ID NOS: 12349-12355 phosphate carrier), member 25 SLC2A5 Solute carrier family 2 (facilitated glucose/fructose SEQ ID NOS: 12356-12364 transporter), member 5 SLC35E3 Solute carrier family 35, member E3 SEQ ID NOS: 12365-12366 SLC39A10 Solute carrier family 39 (zinc transporter), SEQ ID NOS: 12367-12373 member 10 SLC39A14 Solute carrier family 39 (zinc transporter), SEQ ID NOS: 12374-12384 member 14 SLC39A4 Solute carrier family 39 (zinc transporter), member 4 SEQ ID NOS: 12385-12387 SLC39A5 Solute carrier family 39 (zinc transporter), member 5 SEQ ID NOS: 12388-12394 SLC3A1 Solute carrier family 3 (amino acid transporter heavy SEQ ID NOS: 12395-12404 chain), member 1 SLC51A Solute carrier family 51, alpha subunit SEQ ID NOS: 12405-12409 SLC52A2 Solute carrier family 52 (riboflavin transporter), SEQ ID NOS: 12410-12420 member 2 SLC5A6 Solute carrier family 5 (sodium/multivitamin and SEQ ID NOS: 12421-12431 iodide cotransporter), member 6 SLC6A9 Solute carrier family 6 (neurotransmitter SEQ ID NOS: 12432-12439 transporter, glycine), member 9 SLC8A1 Solute carrier family 8 (sodium/calcium exchanger), SEQ ID NOS: 12440-12451 member 1 SLC8B1 Solute carrier family 8 (sodium/lithium/calcium SEQ ID NOS: 12452-12462 exchanger), member B1 SLC9A6 Solute carrier family 9, subfamily A (NHE6, cation SEQ ID NOS: 12463-12474 proton antiporter 6), member 6 SLCO1A2 Solute carrier organic anion transporter family, SEQ ID NOS: 12475-12488 member 1A2 SLIT1 Slit guidance ligand 1 SEQ ID NOS: 12489-12492 SLIT2 Slit guidance ligand 2 SEQ ID NOS: 12493-12501 SLIT3 Slit guidance ligand 3 SEQ ID NOS: 12502-12504 SLITRK3 SLIT and NTRK-like family, member 3 SEQ ID NOS: 12505-12507 SLPI Secretory leukocyte peptidase inhibitor SEQ ID NO: 12508 SLTM SAFB-like, transcription modulator SEQ ID NOS: 12509-12522 SLURP1 Secreted LY6/PLAUR domain containing 1 SEQ ID NO: 12523 SMARCA2 SWI/SNF related, matrix associated, actin dependent SEQ ID NOS: 12524-12571 regulator of chromatin, subfamily a, member 2 SMG6 SMG6 nonsense mediated mRNA decay factor SEQ ID NOS: 12572-12583 SMIM7 Small integral membrane protein 7 SEQ ID NOS: 12584-12600 SMOC1 SPARC related modular calcium binding 1 SEQ ID NOS: 12601-12602 SMOC2 SPARC related modular calcium binding 2 SEQ ID NOS: 12603-12607 SMPDL3A Sphingomyelin phosphodiesterase, acid-like 3A SEQ ID NOS: 12608-12609 SMPDL3B Sphingomyelin phosphodiesterase, acid-like 3B SEQ ID NOS: 12610-12614 SMR3A Submaxillary gland androgen regulated protein 3A SEQ ID NO: 12615 SMR3B Submaxillary gland androgen regulated protein 3B SEQ ID NOS: 12616-12618 SNED1 Sushi, nidogen and EGF-like domains 1 SEQ ID NOS: 12619-12625 SNTB1 Syntrophin, beta 1 (dystrophin-associated protein SEQ ID NOS: 12626-12628 A1, 59 kDa, basic component 1) SNTB2 Syntrophin, beta 2 (dystrophin-associated protein SEQ ID NOS: 12629-12633 A1, 59 kDa, basic component 2) SNX14 Sorting nexin 14 SEQ ID NOS: 12634-12645 SOD3 Superoxide dismutase 3, extracellular SEQ ID NOS: 12646-12647 SOST Sclerostin SEQ ID NO: 12648 SOSTDC1 Sclerostin domain containing 1 SEQ ID NOS: 12649-12650 SOWAHA Sosondowah ankyrin repeat domain family member SEQ ID NO: 12651 A SPACA3 Sperm acrosome associated 3 SEQ ID NOS: 12652-12654 SPACA4 Sperm acrosome associated 4 SEQ ID NO: 12655 SPACA5 Sperm acrosome associated 5 SEQ ID NOS: 12656-12657 SPACA5B Sperm acrosome associated 5B SEQ ID NO: 12658 SPACA7 Sperm acrosome associated 7 SEQ ID NOS: 12659-12662 SPAG11A Sperm associated antigen 11A SEQ ID NOS: 12663-12671 SPAG11B Sperm associated antigen 11B SEQ ID NOS: 12672-12680 SPARC Secreted protein, acidic, cysteine-rich (osteonectin) SEQ ID NOS: 12681-12685 SPARCL1 SPARC-like 1 (hevin) SEQ ID NOS: 12686-12695 SPATA20 Spermatogenesis associated 20 SEQ ID NOS: 12696-12709 SPESP1 Sperm equatorial segment protein 1 SEQ ID NO: 12710 SPINK1 Serine peptidase inhibitor, Kazal type 1 SEQ ID NOS: 12711-12712 SPINK13 Serine peptidase inhibitor, Kazal type 13 (putative) SEQ ID NOS: 12713-12715 SPINK14 Serine peptidase inhibitor, Kazal type 14 (putative) SEQ ID NOS: 12716-12717 SPINK2 Serine peptidase inhibitor, Kazal type 2 (acrosin- SEQ ID NOS: 12718-12723 trypsin inhibitor) SPINK4 Serine peptidase inhibitor, Kazal type 4 SEQ ID NOS: 12724-12725 SPINK5 Serine peptidase inhibitor, Kazal type 5 SEQ ID NOS: 12726-12731 SPINK6 Serine peptidase inhibitor, Kazal type 6 SEQ ID NOS: 12732-12734 SPINK7 Serine peptidase inhibitor, Kazal type 7 (putative) SEQ ID NOS: 12735-12736 SPINK8 Serine peptidase inhibitor, Kazal type 8 (putative) SEQ ID NO: 12737 SPINK9 Serine peptidase inhibitor, Kazal type 9 SEQ ID NOS: 12738-12739 SPINT1 Serine peptidase inhibitor, Kunitz type 1 SEQ ID NOS: 12740-12747 SPINT2 Serine peptidase inhibitor, Kunitz type, 2 SEQ ID NOS: 12748-12755 SPINT3 Serine peptidase inhibitor, Kunitz type, 3 SEQ ID NO: 12756 SPINT4 Serine peptidase inhibitor, Kunitz type 4 SEQ ID NO: 12757 SPOCK1 Sparc/osteonectin, cwcv and kazal-like domains SEQ ID NOS: 12758-12761 proteoglycan (testican) 1 SPOCK2 Sparc/osteonectin, cwcv and kazal-like domains SEQ ID NOS: 12762-12765 proteoglycan (testican) 2 SPOCK3 Sparc/osteonectin, cwcv and kazal-like domains SEQ ID NOS: 12766-12791 proteoglycan (testican) 3 SPON1 Spondin 1, extracellular matrix protein SEQ ID NO: 12792 SPON2 Spondin 2, extracellular matrix protein SEQ ID NOS: 12793-12802 SPP1 Secreted phosphoprotein 1 SEQ ID NOS: 12803-12807 SPP2 Secreted phosphoprotein 2, 24 kDa SEQ ID NOS: 12808-12810 SPRN Shadow of prion protein homolog (zebrafish) SEQ ID NO: 12811 SPRYD3 SPRY domain containing 3 SEQ ID NOS: 12812-12815 SPRYD4 SPRY domain containing 4 SEQ ID NO: 12816 SPTY2D1- SPTY2D1 antisense RNA 1 SEQ ID NOS: 12817-12822 AS1 SPX Spexin hormone SEQ ID NOS: 12823-12824 SRGN Serglycin SEQ ID NO: 12825 SRL Sarcalumenin SEQ ID NOS: 12826-12828 SRP14 Signal recognition particle 14 kDa (homologous Alu SEQ ID NOS: 12829-12832 RNA binding protein) SRPX Sushi-repeat containing protein, X-linked SEQ ID NOS: 12833-12836 SRPX2 Sushi-repeat containing protein, X-linked 2 SEQ ID NOS: 12837-12840 SSC4D Scavenger receptor cysteine rich family, 4 domains SEQ ID NO: 12841 SSC5D Scavenger receptor cysteine rich family, 5 domains SEQ ID NOS: 12842-12845 SSPO SCO-spondin SEQ ID NO: 12846 SSR2 Signal sequence receptor, beta (translocon- SEQ ID NOS: 12847-12856 associated protein beta) SST Somatostatin SEQ ID NO: 12857 ST3GAL1 ST3 beta-galactoside alpha-2,3-sialyltransferase 1 SEQ ID NOS: 12858-12865 ST3GAL4 ST3 beta-galactoside alpha-2,3-sialyltransferase 4 SEQ ID NOS: 12866-12881 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 SEQ ID NOS: 12882-12897 ST6GALNAC ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl- SEQ ID NOS: 12898-12902 2 1,3)-N-acetylgalactosaminide alpha-2,6- sialyltransferase 2 ST6GALNAC ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl- SEQ ID NOS: 12903-12904 5 1,3)-N-acetylgalactosaminide alpha-2,6- sialyltransferase 5 ST6GALNAC ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl- SEQ ID NOS: 12905-12912 6 1,3)-N-acetylgalactosaminide alpha-2,6- sialyltransferase 6 ST8SIA2 ST8 alpha-N-acetyl-neuraminide alpha-2,8- SEQ ID NOS: 12913-12915 sialyltransferase 2 ST8SIA4 ST8 alpha-N-acetyl-neuraminide alpha-2,8- SEQ ID NOS: 12916-12918 sialyltransferase 4 ST8SIA6 ST8 alpha-N-acetyl-neuraminide alpha-2,8- SEQ ID NOS: 12919-12920 sialyltransferase 6 STARD7 StAR-related lipid transfer (START) domain SEQ ID NOS: 12921-12922 containing 7 STATH Statherin SEQ ID NOS: 12923-12925 STC1 Stanniocalcin 1 SEQ ID NOS: 12926-12927 STC2 Stanniocalcin 2 SEQ ID NOS: 12928-12930 STMND1 Stathmin domain containing 1 SEQ ID NOS: 12931-12932 C7orf73 Chromosome 7 open reading frame 73 SEQ ID NOS: 12933-12934 STOML2 Stomatin (EPB72)-like 2 SEQ ID NOS: 12935-12938 STOX1 Storkhead box 1 SEQ ID NOS: 12939-12943 STRC Stereocilin SEQ ID NOS: 12944-12949 SUCLG1 Succinate-CoA ligase, alpha subunit SEQ ID NOS: 12950-12951 SUDS3 SDS3 homolog, SIN3A corepressor complex SEQ ID NO: 12952 component SULF1 Sulfatase 1 SEQ ID NOS: 12953-12963 SULF2 Sulfatase 2 SEQ ID NOS: 12964-12968 SUMF1 Sulfatase modifying factor 1 SEQ ID NOS: 12969-12973 SUMF2 Sulfatase modifying factor 2 SEQ ID NOS: 12974-12987 SUSD1 Sushi domain containing 1 SEQ ID NOS: 12988-12993 SUSD5 Sushi domain containing 5 SEQ ID NOS: 12994-12995 SVEP1 Sushi, von Willebrand factor type A, EGF and SEQ ID NOS: 12996-12998 pentraxin domain containing 1 SWSAP1 SWIM-type zinc finger 7 associated protein 1 SEQ ID NO: 12999 SYAP1 Synapse associated protein 1 SEQ ID NO: 13000 SYCN Syncollin SEQ ID NO: 13001 TAC1 Tachykinin, precursor 1 SEQ ID NOS: 13002-13004 TAC3 Tachykinin 3 SEQ ID NOS: 13005-13014 TAC4 Tachykinin 4 (hemokinin) SEQ ID NOS: 13015-13020 TAGLN2 Transgelin 2 SEQ ID NOS: 13021-13024 TAPBP TAP binding protein (tapasin) SEQ ID NOS: 13025-13030 TAPBPL TAP binding protein-like SEQ ID NOS: 13031-13032 TBL2 Transducin (beta)-like 2 SEQ ID NOS: 13033-13045 TBX10 T-box 10 SEQ ID NO: 13046 TCF12 Transcription factor 12 SEQ ID NOS: 13047-13060 TCN1 Transcobalamin I (vitamin B12 binding protein, R SEQ ID NO: 13061 binder family) TCN2 Transcobalamin II SEQ ID NOS: 13062-13065 TCTN1 Tectonic family member 1 SEQ ID NOS: 13066-13084 TCTN3 Tectonic family member 3 SEQ ID NOS: 13085-13089 TDP2 Tyrosyl-DNA phosphodiesterase 2 SEQ ID NOS: 13090-13091 C14orf80 Chromosome 14 open reading frame 80 SEQ ID NOS: 13092-13105 TEK TEK tyrosine kinase, endothelial SEQ ID NOS: 13106-13110 TEPP Testis, prostate and placenta expressed SEQ ID NOS: 13111-13112 TEX101 Testis expressed 101 SEQ ID NOS: 13113-13114 TEX264 Testis expressed 264 SEQ ID NOS: 13115-13126 C1orf234 Chromosome 1 open reading frame 234 SEQ ID NOS: 13127-13129 TF Transferrin SEQ ID NOS: 13130-13136 TFAM Transcription factor A, mitochondrial SEQ ID NOS: 13137-13139 TFF1 Trefoil factor 1 SEQ ID NO: 13140 TFF2 Trefoil factor 2 SEQ ID NO: 13141 TFF3 Trefoil factor 3 (intestinal) SEQ ID NOS: 13142-13144 TFPI Tissue factor pathway inhibitor (lipoprotein- SEQ ID NOS: 13145-13154 associated coagulation inhibitor) TFPI2 Tissue factor pathway inhibitor 2 SEQ ID NOS: 13155-13156 TG Thyroglobulin SEQ ID NOS: 13157-13166 TGFB1 Transforming growth factor, beta 1 SEQ ID NOS: 13167-13168 TGFB2 Transforming growth factor, beta 2 SEQ ID NOS: 13169-13170 TGFB3 Transforming growth factor, beta 3 SEQ ID NOS: 13171-13172 TGFBI Transforming growth factor, beta-induced, 68 kDa SEQ ID NOS: 13173-13180 TGFBR1 Transforming growth factor, beta receptor 1 SEQ ID NOS: 13181-13190 TGFBR3 Transforming growth factor, beta receptor III SEQ ID NOS: 13191-13197 THBS1 Thrombospondin 1 SEQ ID NOS: 13198-13199 THBS2 Thrombospondin 2 SEQ ID NOS: 13200-13202 THBS3 Thrombospondin 3 SEQ ID NOS: 13203-13207 THBS4 Thrombospondin 4 SEQ ID NOS: 13208-13209 THOC3 THO complex 3 SEQ ID NOS: 13210-13219 THPO Thrombopoietin SEQ ID NOS: 13220-13225 THSD4 Thrombospondin, type I, domain containing 4 SEQ ID NOS: 13226-13229 THY1 Thy-1 cell surface antigen SEQ ID NOS: 13230-13235 TIE1 Tyrosine kinase with immunoglobulin-like and EGF- SEQ ID NOS: 13236-13237 like domains 1 TIMMDC1 Translocase of inner mitochondrial membrane SEQ ID NOS: 13238-13245 domain containing 1 TIMP1 TIMP metallopeptidase inhibitor 1 SEQ ID NOS: 13246-13250 TIMP2 TIMP metallopeptidase inhibitor 2 SEQ ID NOS: 13251-13255 TIMP3 TIMP metallopeptidase inhibitor 3 SEQ ID NO: 13256 TIMP4 TIMP metallopeptidase inhibitor 4 SEQ ID NO: 13257 TINAGL1 Tubulointerstitial nephritis antigen-like 1 SEQ ID NOS: 13258-13260 TINF2 TERF1 (TRF1)-interacting nuclear factor 2 SEQ ID NOS: 13261-13270 TLL2 Tolloid-like 2 SEQ ID NO: 13271 TLR1 Toll-like receptor 1 SEQ ID NOS: 13272-13277 TLR3 Toll-like receptor 3 SEQ ID NOS: 13278-13280 TM2D2 TM2 domain containing 2 SEQ ID NOS: 13281-13286 TM2D3 TM2 domain containing 3 SEQ ID NOS: 13287-13294 TM7SF3 Transmembrane 7 superfamily member 3 SEQ ID NOS: 13295-13309 TM95F1 Transmembrane 9 superfamily member 1 SEQ ID NOS: 13310-13320 TMCO6 Transmembrane and coiled-coil domains 6 SEQ ID NOS: 13321-13328 TMED1 Transmembrane p24 trafficking protein 1 SEQ ID NOS: 13329-13335 TMED2 Transmembrane p24 trafficking protein 2 SEQ ID NOS: 13336-13338 TMED3 Transmembrane p24 trafficking protein 3 SEQ ID NOS: 13339-13342 TMED4 Transmembrane p24 trafficking protein 4 SEQ ID NOS: 13343-13345 TMED5 Transmembrane p24 trafficking protein 5 SEQ ID NOS: 13346-13349 TMED7 Transmembrane p24 trafficking protein 7 SEQ ID NOS: 13350-13351 TMED7- TMED7-TICAM2 readthrough SEQ ID NOS: 13352-13353 TICAM2 TMEM108 Transmembrane protein 108 SEQ ID NOS: 13354-13362 TMEM116 Transmembrane protein 116 SEQ ID NOS: 13363-13374 TMEM119 Transmembrane protein 119 SEQ ID NOS: 13375-13378 TMEM155 Transmembrane protein 155 SEQ ID NOS: 13379-13382 TMEM168 Transmembrane protein 168 SEQ ID NOS: 13383-13388 TMEM178A Transmembrane protein 178A SEQ ID NOS: 13389-13390 TMEM179 Transmembrane protein 179 SEQ ID NOS: 13391-13396 TMEM196 Transmembrane protein 196 SEQ ID NOS: 13397-13401 TMEM199 Transmembrane protein 199 SEQ ID NOS: 13402-13405 TMEM205 Transmembrane protein 205 SEQ ID NOS: 13406-13419 TMEM213 Transmembrane protein 213 SEQ ID NOS: 13420-13423 TMEM25 Transmembrane protein 25 SEQ ID NOS: 13424-13440 TMEM30C Transmembrane protein 30C SEQ ID NO: 13441 TMEM38B Transmembrane protein 38B SEQ ID NOS: 13442-13446 TMEM44 Transmembrane protein 44 SEQ ID NOS: 13447-13456 TMEM52 Transmembrane protein 52 SEQ ID NOS: 13457-13461 TMEM52B Transmembrane protein 52B SEQ ID NOS: 13462-13464 TMEM59 Transmembrane protein 59 SEQ ID NOS: 13465-13472 TMEM67 Transmembrane protein 67 SEQ ID NOS: 13473-13484 TMEM70 Transmembrane protein 70 SEQ ID NOS: 13485-13487 TMEM87A Transmembrane protein 87A SEQ ID NOS: 13488-13497 TMEM94 Transmembrane protein 94 SEQ ID NOS: 13498-13513 TMEM95 Transmembrane protein 95 SEQ ID NOS: 13514-13516 TMIGD1 Transmembrane and immunoglobulin domain SEQ ID NOS: 13517-13518 containing 1 TMPRSS12 Transmembrane (C-terminal) protease, serine 12 SEQ ID NOS: 13519-13520 TMPRSS5 Transmembrane protease, serine 5 SEQ ID NOS: 13521-13532 TMUB1 Transmembrane and ubiquitin-like domain SEQ ID NOS: 13533-13539 containing 1 TMX2 Thioredoxin-related transmembrane protein 2 SEQ ID NOS: 13540-13547 TMX3 Thioredoxin-related transmembrane protein 3 SEQ ID NOS: 13548-13555 TNC Tenascin C SEQ ID NOS: 13556-13564 TNFAIP6 Tumor necrosis factor, alpha-induced protein 6 SEQ ID NO: 13565 TNFRSF11A Tumor necrosis factor receptor superfamily, SEQ ID NOS: 13566-13570 member 11a, NFKB activator TNFRSF11B Tumor necrosis factor receptor superfamily, SEQ ID NOS: 13571-13572 member 11b TNFRSF12A Tumor necrosis factor receptor superfamily, SEQ ID NOS: 13573-13578 member 12A TNFRSF14 Tumor necrosis factor receptor superfamily, SEQ ID NOS: 13579-13585 member 14 TNFRSF18 Tumor necrosis factor receptor superfamily, SEQ ID NOS: 13586-13589 member 18 TNFRSF1A Tumor necrosis factor receptor superfamily, SEQ ID NOS: 13590-13598 member 1A TNFRSF1B Tumor necrosis factor receptor superfamily, SEQ ID NOS: 13599-13600 member 1B TNFRSF25 Tumor necrosis factor receptor superfamily, SEQ ID NOS: 13601-13612 member 25 TNFRSF6B Tumor necrosis factor receptor superfamily, SEQ ID NO: 13613 member 6b, decoy TNFSF11 Tumor necrosis factor (ligand) superfamily, SEQ ID NOS: 13614-13618 member 11 TNFSF12 Tumor necrosis factor (ligand) superfamily, SEQ ID NOS: 13619-13620 member 12 TNFSF12- TNFSF12-TNFSF13 readthrough SEQ ID NO: 13621 TNFSF13 TNFSF15 Tumor necrosis factor (ligand) superfamily, SEQ ID NOS: 13622-13623 member 15 TNN Tenascin N SEQ ID NOS: 13624-13626 TNR Tenascin R SEQ ID NOS: 13627-13629 TNXB Tenascin XB SEQ ID NOS: 13630-13636 FAM179B Family with sequence similarity 179, member B SEQ ID NOS: 13637-13642 TOMM7 Translocase of outer mitochondrial membrane 7 SEQ ID NOS: 13643-13646 homolog (yeast) TOP1MT Topoisomerase (DNA) I, mitochondrial SEQ ID NOS: 13647-13661 TOR1A Torsin family 1, member A (torsin A) SEQ ID NO: 13662 TOR1B Torsin family 1, member B (torsin B) SEQ ID NOS: 13663-13664 TOR2A Torsin family 2, member A SEQ ID NOS: 13665-13671 TOR3A Torsin family 3, member A SEQ ID NOS: 13672-13676 TPD52 Tumor protein D52 SEQ ID NOS: 13677-13689 TPO Thyroid peroxidase SEQ ID NOS: 13690-13700 TPP1 Tripeptidyl peptidase I SEQ ID NOS: 13701-13718 TPSAB1 Tryptase alpha/beta 1 SEQ ID NOS: 13719-13721 TPSB2 Tryptase beta 2 (gene/pseudogene) SEQ ID NOS: 13722-13724 TPSD1 Tryptase delta 1 SEQ ID NOS: 13725-13726 TPST1 Tyrosylprotein sulfotransferase 1 SEQ ID NOS: 13727-13729 TPST2 Tyrosylprotein sulfotransferase 2 SEQ ID NOS: 13730-13738 TRABD2A TraB domain containing 2A SEQ ID NOS: 13739-13741 TRABD2B TraB domain containing 2B SEQ ID NO: 13742 TREH Trehalase (brush-border membrane glycoprotein) SEQ ID NOS: 13743-13745 TREM1 Triggering receptor expressed on myeloid cells 1 SEQ ID NOS: 13746-13749 TREM2 Triggering receptor expressed on myeloid cells 2 SEQ ID NOS: 13750-13752 TRH Thyrotropin-releasing hormone SEQ ID NOS: 13753-13754 TRIM24 Tripartite motif containing 24 SEQ ID NOS: 13755-13756 TRIM28 Tripartite motif containing 28 SEQ ID NOS: 13757-13762 TRIO Trio Rho guanine nucleotide exchange factor SEQ ID NOS: 13763-13769 TRNP1 TMF1-regulated nuclear protein 1 SEQ ID NOS: 13770-13771 TSC22D4 TSC22 domain family, member 4 SEQ ID NOS: 13772-13775 TSHB Thyroid stimulating hormone, beta SEQ ID NOS: 13776-13777 TSHR Thyroid stimulating hormone receptor SEQ ID NOS: 13778-13785 TSKU Tsukushi, small leucine rich proteoglycan SEQ ID NOS: 13786-13790 TSLP Thymic stromal lymphopoietin SEQ ID NOS: 13791-13793 TSPAN3 Tetraspanin 3 SEQ ID NOS: 13794-13799 TSPAN31 Tetraspanin 31 SEQ ID NOS: 13800-13806 TSPEAR Thrombospondin-type laminin G domain and EAR SEQ ID NOS: 13807-13810 repeats TTC13 Tetratricopeptide repeat domain 13 SEQ ID NOS: 13811-13817 TTC19 Tetratricopeptide repeat domain 19 SEQ ID NOS: 13818-13823 TTC9B Tetratricopeptide repeat domain 9B SEQ ID NO: 13824 TTLL11 Tubulin tyrosine ligase-like family member 11 SEQ ID NOS: 13825-13829 TTR Transthyretin SEQ ID NOS: 13830-13832 TWSG1 Twisted gastrulation BMP signaling modulator 1 SEQ ID NOS: 13833-13835 TXNDC12 Thioredoxin domain containing 12 (endoplasmic SEQ ID NOS: 13836-13838 reticulum) TXNDC15 Thioredoxin domain containing 15 SEQ ID NOS: 13839-13845 TXNDC5 Thioredoxin domain containing 5 (endoplasmic SEQ ID NOS: 13846-13847 reticulum) TXNRD2 Thioredoxin reductase 2 SEQ ID NOS: 13848-13860 TYRP1 Tyrosinase-related protein 1 SEQ ID NOS: 13861-13863 UBAC2 UBA domain containing 2 SEQ ID NOS: 13864-13868 UBALD1 UBA-like domain containing 1 SEQ ID NOS: 13869-13877 UBAP2 Ubiquitin associated protein 2 SEQ ID NOS: 13878-13884 UBXN8 UBX domain protein 8 SEQ ID NOS: 13885-13891 UCMA Upper zone of growth plate and cartilage matrix SEQ ID NOS: 13892-13893 associated UCN Urocortin SEQ ID NO: 13894 UCN2 Urocortin 2 SEQ ID NO: 13895 UCN3 Urocortin 3 SEQ ID NO: 13896 UGGT2 UDP-glucose glycoprotein glucosyltransferase 2 SEQ ID NOS: 13897-13902 UGT1A10 UDP glucuronosyltransferase 1 family, polypeptide SEQ ID NOS: 13903-13904 A10 UGT2A1 UDP glucuronosyltransferase 2 family, polypeptide SEQ ID NOS: 13905-13909 A1, complex locus UGT2B11 UDP glucuronosyltransferase 2 family, polypeptide SEQ ID NO: 13910 B11 UGT2B28 UDP glucuronosyltransferase 2 family, polypeptide SEQ ID NOS: 13911-13912 B28 UGT2B4 UDP glucuronosyltransferase 2 family, polypeptide SEQ ID NOS: 13913-13916 B4 UGT2B7 UDP glucuronosyltransferase 2 family, polypeptide SEQ ID NOS: 13917-13920 B7 UGT3A1 UDP glycosyltransferase 3 family, polypeptide A1 SEQ ID NOS: 13921-13926 UGT3A2 UDP glycosyltransferase 3 family, polypeptide A2 SEQ ID NOS: 13927-13930 UGT8 UDP glycosyltransferase 8 SEQ ID NOS: 13931-13933 ULBP3 UL16 binding protein 3 SEQ ID NOS: 13934-13935 UMOD Uromodulin SEQ ID NOS: 13936-13947 UNC5C Unc-5 netrin receptor C SEQ ID NOS: 13948-13952 UPK3B Uroplakin 3B SEQ ID NOS: 13953-13955 USP11 Ubiquitin specific peptidase 11 SEQ ID NOS: 13956-13959 USP14 Ubiquitin specific peptidase 14 (tRNA-guanine SEQ ID NOS: 13960-13966 transglycosylase) USP3 Ubiquitin specific peptidase 3 SEQ ID NOS: 13967-13982 CIRH1A Cirrhosis, autosomal recessive 1A (cirhin) SEQ ID NOS: 13983-13992 UTS2 Urotensin 2 SEQ ID NOS: 13993-13995 UTS2B Urotensin 2B SEQ ID NOS: 13996-14001 UTY Ubiquitously transcribed tetratricopeptide repeat SEQ ID NOS: 14002-14014 containing, Y-linked UXS1 UDP-glucuronate decarboxylase 1 SEQ ID NOS: 14015-14022 VASH1 Vasohibin 1 SEQ ID NOS: 14023-14025 VCAN Versican SEQ ID NOS: 14026-14032 VEGFA Vascular endothelial growth factor A SEQ ID NOS: 14033-14058 VEGFB Vascular endothelial growth factor B SEQ ID NOS: 14059-14061 VEGFC Vascular endothelial growth factor C SEQ ID NO: 14062 FIGF C-fos induced growth factor (vascular endothelial SEQ ID NO: 14063 growth factor D) VGF VGF nerve growth factor inducible SEQ ID NOS: 14064-14066 VIP Vasoactive intestinal peptide SEQ ID NOS: 14067-14069 VIPR2 Vasoactive intestinal peptide receptor 2 SEQ ID NOS: 14070-14073 VIT Vitrin SEQ ID NOS: 14074-14081 VKORC1 Vitamin K epoxide reductase complex, subunit 1 SEQ ID NOS: 14082-14089 VLDLR Very low density lipoprotein receptor SEQ ID NOS: 14090-14092 VMO1 Vitelline membrane outer layer 1 homolog (chicken) SEQ ID NOS: 14093-14096 VNN1 Vanin 1 SEQ ID NO: 14097 VNN2 Vanin 2 SEQ ID NOS: 14098-14111 VNN3 Vanin 3 SEQ ID NOS: 14112-14123 VOPP1 Vesicular, overexpressed in cancer, prosurvival SEQ ID NOS: 14124-14136 protein 1 VPREB1 Pre-B lymphocyte 1 SEQ ID NOS: 14137-14138 VPREB3 Pre-B lymphocyte 3 SEQ ID NOS: 14139-14140 VPS37B Vacuolar protein sorting 37 homolog B (S. cerevisiae) SEQ ID NOS: 14141-14143 VPS51 Vacuolar protein sorting 51 homolog (S. cerevisiae) SEQ ID NOS: 14144-14155 VSIG1 V-set and immunoglobulin domain containing 1 SEQ ID NOS: 14156-14158 VSIG10 V-set and immunoglobulin domain containing 10 SEQ ID NOS: 14159-14160 VSTM1 V-set and transmembrane domain containing 1 SEQ ID NOS: 14161-14167 VSTM2A V-set and transmembrane domain containing 2A SEQ ID NOS: 14168-14171 VSTM2B V-set and transmembrane domain containing 2B SEQ ID NO: 14172 VSTM2L V-set and transmembrane domain containing 2 like SEQ ID NOS: 14173-14175 VSTM4 V-set and transmembrane domain containing 4 SEQ ID NOS: 14176-14177 VTN Vitronectin SEQ ID NOS: 14178-14179 VWA1 Von Willebrand factor A domain containing 1 SEQ ID NOS: 14180-14183 VWA2 Von Willebrand factor A domain containing 2 SEQ ID NOS: 14184-14185 VWA5B2 Von Willebrand factor A domain containing 5B2 SEQ ID NOS: 14186-14187 VWA7 Von Willebrand factor A domain containing 7 SEQ ID NO: 14188 VWC2 Von Willebrand factor C domain containing 2 SEQ ID NO: 14189 VWC2L Von Willebrand factor C domain containing protein SEQ ID NOS: 14190-14191 2-like VWCE Von Willebrand factor C and EGF domains SEQ ID NOS: 14192-14196 VWDE Von Willebrand factor D and EGF domains SEQ ID NOS: 14197-14202 VWF Von Willebrand factor SEQ ID NOS: 14203-14205 WDR25 WD repeat domain 25 SEQ ID NOS: 14206-14212 WDR81 WD repeat domain 81 SEQ ID NOS: 14213-14222 WDR90 WD repeat domain 90 SEQ ID NOS: 14223-14230 WFDC1 WAP four-disulfide core domain 1 SEQ ID NOS: 14231-14233 WFDC10A WAP four-disulfide core domain 10A SEQ ID NO: 14234 WFDC10B WAP four-disulfide core domain 10B SEQ ID NOS: 14235-14236 WFDC11 WAP four-disulfide core domain 11 SEQ ID NOS: 14237-14239 WFDC12 WAP four-disulfide core domain 12 SEQ ID NO: 14240 WFDC13 WAP four-disulfide core domain 13 SEQ ID NO: 14241 WFDC2 WAP four-disulfide core domain 2 SEQ ID NOS: 14242-14246 WFDC3 WAP four-disulfide core domain 3 SEQ ID NOS: 14247-14250 WFDC5 WAP four-disulfide core domain 5 SEQ ID NOS: 14251-14252 WFDC6 WAP four-disulfide core domain 6 SEQ ID NOS: 14253-14254 WFDC8 WAP four-disulfide core domain 8 SEQ ID NOS: 14255-14256 WFIKKN1 WAP, follistatin/kazal, immunoglobulin, kunitz and SEQ ID NO: 14257 netrin domain containing 1 WFIKKN2 WAP, follistatin/kazal, immunoglobulin, kunitz and SEQ ID NOS: 14258-14259 netrin domain containing 2 DFNB31 Deafness, autosomal recessive 31 SEQ ID NOS: 14260-14263 WIF1 WNT inhibitory factor 1 SEQ ID NOS: 14264-14266 WISP1 WNT1 inducible signaling pathway protein 1 SEQ ID NOS: 14267-14271 WISP2 WNT1 inducible signaling pathway protein 2 SEQ ID NOS: 14272-14274 WISP3 WNT1 inducible signaling pathway protein 3 SEQ ID NOS: 14275-14282 WNK1 WNK lysine deficient protein kinase 1 SEQ ID NOS: 14283-14296 WNT1 Wingless-type MMTV integration site family, SEQ ID NOS: 14297-14298 member 1 WNT10B Wingless-type MMTV integration site family, SEQ ID NOS: 14299-14303 member 10B WNT11 Wingless-type MMTV integration site family, SEQ ID NOS: 14304-14306 member 11 WNT16 Wingless-type MMTV integration site family, SEQ ID NOS: 14307-14308 member 16 WNT2 Wingless-type MMTV integration site family SEQ ID NOS: 14309-14311 member 2 WNT3 Wingless-type MMTV integration site family, SEQ ID NO: 14312 member 3 WNT3A Wingless-type MMTV integration site family, SEQ ID NO: 14313 member 3A WNT5A Wingless-type MMTV integration site family, SEQ ID NOS: 14314-14317 member 5A WNT5B Wingless-type MMTV integration site family, SEQ ID NOS: 14318-14324 member 5B WNT6 Wingless-type MMTV integration site family, SEQ ID NO: 14325 member 6 WNT7A Wingless-type MMTV integration site family, SEQ ID NO: 14326 member 7A WNT7B Wingless-type MMTV integration site family, SEQ ID NOS: 14327-14331 member 7B WNT8A Wingless-type MMTV integration site family, SEQ ID NOS: 14332-14335 member 8A WNT8B Wingless-type MMTV integration site family, SEQ ID NO: 14336 member 8B WNT9A Wingless-type MMTV integration site family, SEQ ID NO: 14337 member 9A WNT9B Wingless-type MMTV integration site family, SEQ ID NOS: 14338-14340 member 9B WSB1 WD repeat and SOCS box containing 1 SEQ ID NOS: 14341-14350 WSCD1 WSC domain containing 1 SEQ ID NOS: 14351-14360 WSCD2 WSC domain containing 2 SEQ ID NOS: 14361-14364 XCL1 Chemokine (C motif) ligand 1 SEQ ID NO: 14365 XCL2 Chemokine (C motif) ligand 2 SEQ ID NO: 14366 XPNPEP2 X-prolyl aminopeptidase (aminopeptidase P) 2, SEQ ID NOS: 14367-14368 membrane-bound XXYLT1 Xyloside xylosyltransferase 1 SEQ ID NOS: 14369-14374 XYLT1 Xylosyltransferase I SEQ ID NO: 14375 XYLT2 Xylosyltransferase II SEQ ID NOS: 14376-14381 ZFYVE21 Zinc finger, FYVE domain containing 21 SEQ ID NOS: 14382-14386 ZG16 Zymogen granule protein 16 SEQ ID NO: 14387 ZG16B Zymogen granule protein 16B SEQ ID NOS: 14388-14391 ZIC4 Zic family member 4 SEQ ID NOS: 14392-14400 ZNF207 Zinc finger protein 207 SEQ ID NOS: 14401-14411 ZNF26 Zinc finger protein 26 SEQ ID NOS: 14412-14415 ZNF34 Zinc finger protein 34 SEQ ID NOS: 14416-14419 ZNF419 Zinc finger protein 419 SEQ ID NOS: 14420-14434 ZNF433 Zinc finger protein 433 SEQ ID NOS: 14435-14444 ZNF449 Zinc finger protein 449 SEQ ID NOS: 14445-14446 ZNF488 Zinc finger protein 488 SEQ ID NOS: 14447-14448 ZNF511 Zinc finger protein 511 SEQ ID NOS: 14449-14450 ZNF570 Zinc finger protein 570 SEQ ID NOS: 14451-14456 ZNF691 Zinc finger protein 691 SEQ ID NOS: 14457-14464 ZNF98 Zinc finger protein 98 SEQ ID NOS: 14465-14468 ZPBP Zona pellucida binding protein SEQ ID NOS: 14469-14472 ZPBP2 Zona pellucida binding protein 2 SEQ ID NOS: 14473-14476 ZSCAN29 Zinc finger and SCAN domain containing 29 SEQ ID NOS: 14477-14483

    [0412] In certain embodiments, the therapeutic protein is not secreted, but rather functions intracellularly.

    [0413] In certain embodiments, the therapeutic protein is not secreted, but rather directs a modified cell of the disclosure to a cell niche of a subject's body.

    [0414] In certain embodiments of the methods of the disclosure, the subject has a disease or disorder and the plurality of therapeutic immune cells or immune precursor cells improves a sign or symptom of the disease or disorder, optionally by providing a therapeutic protein systemically or locally within the subject that acts upon the immune cell, the immune precursor cell or a second cell in the subject. Exemplary therapeutic secreted proteins may be used as a monotherapy or in combination with another therapy in the treatment or prevention of any disease or disorder. These secreted proteins may be used as a monotherapy or in combination with another therapy for enzyme replacement and/or administration of biologic therapeutics.

    Inducible Proapoptotic Polypeptides

    [0415] Inducible proapoptotic polypeptides of the disclosure are superior to existing inducible polypeptides because the inducible proapoptotic polypeptides of the disclosure are far less immunogenic. While inducible proapoptotic polypeptides of the disclosure are recombinant polypeptides, and, therefore, non-naturally occurring, the sequences that are recombined to produce the inducible proapoptotic polypeptides of the disclosure do not comprise non-human sequences that the host human immune system could recognize as “non-self” and, consequently, induce an immune response in the subject receiving an inducible proapoptotic polypeptide of the disclosure, a cell comprising the inducible proapoptotic polypeptide or a composition comprising the inducible proapoptotic polypeptide or the cell comprising the inducible proapoptotic polypeptide.

    [0416] Modified cells and/or transposons of the disclosure may comprise an inducible proapoptotic polypeptide comprising (a) a ligand binding region, (b) a linker, and (c) a proapoptotic polypeptide, wherein the inducible proapoptotic polypeptide does not comprise a non-human sequence. In certain embodiments, the non-human sequence comprises a restriction site. In certain embodiments, the ligand binding region may be a multimeric ligand binding region. Inducible proapoptotic polypeptides of the disclosure may also be referred to as an “iC9 safety switch”. In certain embodiments, modified cells and/or transposons of the disclosure may comprise an inducible caspase polypeptide comprising (a) a ligand binding region, (b) a linker, and (c) a caspase polypeptide, wherein the inducible proapoptotic polypeptide does not comprise a non-human sequence. In certain embodiments, modified cells and/or transposons of the disclosure may comprise an inducible caspase polypeptide comprising (a) a ligand binding region, (b) a linker, and (c) a caspase polypeptide, wherein the inducible proapoptotic polypeptide does not comprise a non-human sequence. In certain embodiments, transposons of the disclosure may comprise an inducible caspase polypeptide comprising (a) a ligand binding region, (b) a linker, and (c) a truncated caspase 9 polypeptide, wherein the inducible proapoptotic polypeptide does not comprise a non-human sequence. In certain embodiments of the inducible proapoptotic polypeptides, inducible caspase polypeptides or truncated caspase 9 polypeptides of the disclosure, the ligand binding region may comprise a FK506 binding protein 12 (FKBP12) polypeptide. In certain embodiments, the amino acid sequence of the ligand binding region that comprise a FK506 binding protein 12 (FKBP12) polypeptide may comprise a modification at position 36 of the sequence. The modification may be a substitution of valine (V) for phenylalanine (F) at position 36 (F36V).

    [0417] In certain embodiments, the FKBP12 polypeptide is encoded by an amino acid sequence comprising

    TABLE-US-00161 (SEQ ID NO: 14635) GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKVDSSRDRNKPFKF MLGKQEVIRGWEEGVAQMSVGQRAKLTISPDVAYGATGHPGIIPPHAT LVFDVELLKLE.

    [0418] In certain embodiments, the FKBP12 polypeptide is encoded by a nucleic acid sequence comprising

    TABLE-US-00162 (SEQ ID NO: 14636) GGGGTCCAGGTCGAGACTATTTCACCAGGGGATGGGCGAACATTTCCA AAAAGGGGCCAGACTTGCGTCGTGCATTACACCGGGATGCTGGAGGAC GGGAAGAAAGTGGACAGCTCCAGGGATCGCAACAAGCCCTTCAAGTTC ATGCTGGGAAAGCAGGAAGTGATCCGAGGATGGGAGGAAGGCGTGGCA CAGATGTCAGTCGGCCAGCGGGCCAAACTGACCATTAGCCCTGACTAC GCTTATGGAGCAACAGGCCACCCAGGGATCATTCCCCCTCATGCCACC CTGGTCTTCGATGTGGAACTGCTGAAGCTGGAG. 
    In certain embodiments, the induction agent specific for the ligand binding region may comprise a FK506 binding protein 12 (FKBP12) polypeptide having a substitution of valine (V) for phenylalanine (F) at position 36 (F36V) comprises AP20187 and/or AP1903, both synthetic drugs.

    [0419] In certain embodiments of the inducible proapoptotic polypeptides, inducible caspase polypeptides or truncated caspase 9 polypeptides of the disclosure, the linker region is encoded by an amino acid comprising GGGGS (SEQ ID NO: 14637) or a nucleic acid sequence comprising GGAGGAGGAGGATCC (SEQ ID NO: 14638). In certain embodiments, the nucleic acid sequence encoding the linker does not comprise a restriction site.

    [0420] In certain embodiments of the truncated caspase 9 polypeptides of the disclosure, the truncated caspase 9 polypeptide is encoded by an amino acid sequence that does not comprise an arginine (R) at position 87 of the sequence. Alternatively, or in addition, in certain embodiments of the inducible proapoptotic polypeptides, inducible caspase polypeptides or truncated caspase 9 polypeptides of the disclosure, the truncated caspase 9 polypeptide is encoded by an amino acid sequence that does not comprise an alanine (A) at position 282 the sequence. In certain embodiments of the inducible proapoptotic polypeptides, inducible caspase polypeptides or truncated caspase 9 polypeptides of the disclosure, the truncated caspase 9 polypeptide is encoded by an amino acid comprising

    TABLE-US-00163 (SEQ ID NO: 14639) GFGDVGALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTRTG SNIDCEKLRRRFSSLHFMVEVKGDLTAKKMVLALLELAQQDHGALDCC VVVILSHGCQASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGGK PKLFFIQACGGEQKDHGFEVASTSPEDESPGSNPEPDATPFQEGLRTF DQLDAISSLPTPSDIFVSYSTFPGFVSWRDPKSGSWYVETLDDIFEQW AHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFFKTS  or a nucleic acid sequence comprising (SEQ ID NO: 14640) TTTGGGGACGTGGGGGCCCTGGAGTCTCTGCGAGGAAATGCCGATCTG GCTTACATCCTGAGCATGGAACCCTGCGGCCACTGTCTGATCATTAAC AATGTGAACTTCTGCAGAGAAAGCGGACTGCGAACACGGACTGGCTCC AATATTGACTGTGAGAAGCTGCGGAGAAGGTTCTCTAGTCTGCACTTT ATGGTCGAAGTGAAAGGGGATCTGACCGCCAAGAAAATGGTGCTGGCC CTGCTGGAGCTGGCTCAGCAGGACCATGGAGCTCTGGATTGCTGCGTG GTCGTGATCCTGTCCCACGGGTGCCAGGCTTCTCATCTGCAGTTCCCC GGAGCAGTGTACGGAACAGACGGCTGTCCTGTCAGCGTGGAGAAGATC GTCAACATCTTCAACGGCACTTCTTGCCCTAGTCTGGGGGGAAAGCCA AAACTGTTCTTTATCCAGGCCTGTGGCGGGGAACAGAAAGATCACGGC TTCGAGGTGGCCAGCACCAGCCCTGAGGACGAATCACCAGGGAGCAAC CCTGAACCAGATGCAACTCCATTCCAGGAGGGACTGAGGACCTTTGAC CAGCTGGATGCTATCTCAAGCCTGCCCACTCCTAGTGACATTTTCGTG TCTTACAGTACCTTCCCAGGCTTTGTCTCATGGCGCGATCCCAAGTCA GGGAGCTGGTACGTGGAGACACTGGACGACATCTTTGAACAGTGGGCC CATTCAGAGGACCTGCAGAGCCTGCTGCTGCGAGTGGCAAACGCTGTC TCTGTGAAGGGCATCTACAAACAGATGCCCGGGTGCTTCAATTTTCTG AGAAAGAAACTGTTCTTTAAGACTTCC.

    [0421] In certain embodiments of the inducible proapoptotic polypeptides, wherein the polypeptide comprises a truncated caspase 9 polypeptide, the inducible proapoptotic polypeptide is encoded by an amino acid sequence comprising

    TABLE-US-00164 (SEQ ID NO: 14641) GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKVDSSRDRNKPFKF MLGKQEVIRGWEEGVAQMSVGQRAKLTISPDVAYGATGHPGIIPPHAT LVFDVELLKLEGGGGSGFGDVGALESLRGNADLAYILSMEPCGHCLII NNVNFCRESGLRTRTGSNIDCEKLRRRFSSLHFMVEVKGDLTAKKMVL ALLELAQQDHGALDCCVVVILSHGCQASHLQFPGAVYGTDGCPVSVEK IVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVASTSPEDESPGS NPEPDATPFQEGLRTFDQLDAIS SLPTP SDIFVSYSTFPGFVSWRD PKSGSWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMPGCF  NFLRKKLFFKTS or the nucleic acid sequence comprising (SEQ ID NO: 14642) ggggtccaggtcgagactatttcaccaggggatgggcgaacatttcca aaaaggggccagacttgcgtcgtgcattacaccgggatgctggaggac gggaagaaagtggacagctccagggatcgcaacaagcccttcaagttc atgctgggaaagcaggaagtgatccgaggatgggaggaaggcgtggca cagatgtcagtcggccagcgggccaaactgaccattagccctgactac gcttatggagcaacaggccacccagggatcattccccctcatgccacc ctggtcttcgatgtggaactgctgaagctggagggaggaggaggatcc ggatttggggacgtgggggccctggagtctctgcgaggaaatgccgat ctggcttacatcctgagcatggaaccctgcggccactgtctgatcatt aacaatgtgaacttctgcagagaaagcggactgcgaacacggactggc tccaatattgactgtgagaagctgcggagaaggttctctagtctgcac tttatggtcgaagtgaaaggggatctgaccgccaagaaaatggtgctg gccctgctggagctggctcagcaggaccatggagctctggattgctgc gtggtcgtgatcctgtcccacgggtgccaggcttctcatctgcagttc cccggagcagtgtacggaacagacggctgtcctgtcagcgtggagaag atcgtcaacatcttcaacggcacttcttgccctagtctggggggaaag ccaaaactgttctttatccaggcctgtggcggggaacagaaagatcac ggcttcgaggtggccagcaccagccctgaggacgaatcaccagggagc aaccctgaaccagatgcaactccattccaggagggactgaggaccttt gaccagctggatgctatctcaagcctgcccactcctagtgacattttc gtgtcttacagtaccttcccaggctttgtctcatggcgcgatcccaag tcagggagctggtacgtggagacactggacgacatctttgaacagtgg gcccattcagaggacctgcagagcctgctgctgcgagtggcaaacgct gtctctgtgaagggcatctacaaacagatgcccgggtgcttcaattac tgagaaagaaactgttctttaagacttcc.

    Construct Elements

    [0422] Transposons and other delivery vectors of the disclosure may comprise at least one self-cleaving peptide(s) located, for example, between one or more of a sequence encoding an inducible proapoptotic polypeptide of the disclosure, a sequence encoding a therapeutic protein of the disclosure and a selection gene of the disclosure.

    [0423] Transposons and other delivery vectorsof the disclosure may comprise at least two self-cleaving peptide(s), a first self-cleaving peptide located, for example, upstream or immediately upstream of an inducible proapoptotic polypeptide of the disclosure of the disclosure and a second first self-cleaving peptide located, for example, downstream or immediately upstream of an inducible proapoptotic polypeptide of the disclosure of the disclosure.

    [0424] The at least one self-cleaving peptide may comprise, for example, a T2A peptide, GSG-T2A peptide, an E2A peptide, a GSG-E2A peptide, an F2A peptide, a GSG-F2A peptide, a P2A peptide, or a GSG-P2A peptide. A T2A peptide may comprise an amino acid sequence comprising EGRGSLLTCGDVEENPGP (SEQ ID NO: 14643) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising EGRGSLLTCGDVEENPGP (SEQ ID NO: 14643). A GSG-T2A peptide may comprise an amino acid sequence comprising GSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 14644) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 14644). A GSG-T2A peptide may comprise a nucleic acid sequence comprising

    TABLE-US-00165 (SEQ ID NO: 14645) ggatctggagagggaaggggaagcctgctgacctgtggagacgtggagg  aaaacccaggacca.
    An E2A peptide may comprise an amino acid sequence comprising QCTNYALLKLAGDVESNPGP (SEQ ID NO: 14646) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising QCTNYALLKLAGDVESNPGP (SEQ ID NO: 14646). A GSG-E2A peptide may comprise an amino acid sequence comprising GSGQCTNYALLKLAGDVESNPGP (SEQ ID NO: 14647) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGQCTNYALLKLAGDVESNPGP (SEQ ID NO: 14647). An F2A peptide may comprise an amino acid sequence comprising VKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 14648) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising VKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 14648). A GSG-F2A peptide may comprise an amino acid sequence comprising GSGVKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 14649) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGVKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 14649). A P2A peptide may comprise an amino acid sequence comprising ATNFSLLKQAGDVEENPGP (SEQ ID NO: 14650) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising ATNFSLLKQAGDVEENPGP (SEQ ID NO: 14650). A GSG-P2A peptide may comprise an amino acid sequence comprising GSGATNFSLLKQAGDVEENPGP (SEQ ID NO: 14651) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGATNFSLLKQAGDVEENPGP (SEQ ID NO: 14651).

    [0425] Transposons and other delivery vectors of the disclosure may comprise a first and a second self-cleaving peptide, the first self-cleaving peptide located, for example, upstream of one or more of a sequence encoding a therapeutic protein of the disclosure the second self-cleaving peptide located, for example, downstream of a sequence encoding a therapeutic protein of the disclosure. The first and/or the second self-cleaving peptide may comprise, for example, a T2A peptide, GSG-T2A peptide, an E2A peptide, a GSG-E2A peptide, an F2A peptide, a GSG-F2A peptide, a P2A peptide, or a GSG-P2A peptide. A T2A peptide may comprise an amino acid sequence comprising EGRGSLLTCGDVEENPGP (SEQ ID NO: 14643) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising EGRGSLLTCGDVEENPGP (SEQ ID NO: 14643). A GSG-T2A peptide may comprise an amino acid sequence comprising GSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 14644) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 14644). A GSG-T2A peptide may comprise a nucleic acid sequence comprising

    TABLE-US-00166 (SEQ ID NO: 14645) ggatctggagagggaaggggaagcctgctgacctgtggagacgtggagg  aaaacccaggacca.
    An E2A peptide may comprise an amino acid sequence comprising QCTNYALLKLAGDVESNPGP (SEQ ID NO: 14646) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising QCTNYALLKLAGDVESNPGP (SEQ ID NO: 14646). A GSG-E2A peptide may comprise an amino acid sequence comprising GSGQCTNYALLKLAGDVESNPGP (SEQ ID NO: 14647) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGQCTNYALLKLAGDVESNPGP (SEQ ID NO: 14647). An F2A peptide may comprise an amino acid sequence comprising VKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 14648) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising VKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 14648). A GSG-F2A peptide may comprise an amino acid sequence comprising GSGVKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 14649) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGVKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 14649). A P2A peptide may comprise an amino acid sequence comprising ATNFSLLKQAGDVEENPGP (SEQ ID NO: 14650) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising ATNFSLLKQAGDVEENPGP (SEQ ID NO: 14650). A GSG-P2A peptide may comprise an amino acid sequence comprising GSGATNFSLLKQAGDVEENPGP (SEQ ID NO: 14651) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGATNFSLLKQAGDVEENPGP (SEQ ID NO: 14651).

    [0426] Transposons of the disclosure may comprise a selection gene. The selection gene may encode a gene product essential for cell viability and survival. The selection gene may encode a gene product essential for cell viability and survival when challenged by selective cell culture conditions. Selective cell culture conditions may comprise a compound harmful to cell viability or survival and wherein the gene product confers resistance to the compound.

    [0427] By “stable transformation” is intended that the polynucleotide construct introduced into a cell integrates into the genome of the host and is capable of being inherited by progeny thereof.

    [0428] By “transient transformation” is intended that a polynucleotide construct introduced into the host does not integrate into the genome of the host.

    [0429] All percentages and ratios are calculated based on the total composition unless otherwise indicated.

    [0430] Every maximum numerical limitation given throughout this disclosure includes every lower numerical limitation, as if such lower numerical limitations were expressly written herein. Every minimum numerical limitation given throughout this disclosure will include every higher numerical limitation, as if such higher numerical limitations were expressly written herein. Every numerical range given throughout this disclosure will include every narrower numerical range that falls within such broader numerical range, as if such narrower numerical ranges were all expressly written herein.

    [0431] The values disclosed herein are not to be understood as being strictly limited to the exact numerical values recited. Instead, unless otherwise specified, each such value is intended to mean both the recited value and a functionally equivalent range surrounding that value. For example, a value disclosed as “20 μm” is intended to mean “about 20 μm.”

    [0432] Every document cited herein, including any cross referenced or related patent or application, is hereby incorporated herein by reference in its entirety unless expressly excluded or otherwise limited. The citation of any document is not an admission that it is prior art with respect to any invention disclosed or claimed herein or that it alone, or in any combination with any other reference or references, teaches, suggests or discloses any such invention. Further, to the extent that any meaning or definition of a term in this document conflicts with any meaning or definition of the same term in a document incorporated by reference, the meaning or definition assigned to that term in this document shall govern.

    [0433] While particular embodiments of the disclosure have been illustrated and described, various other changes and modifications can be made without departing from the spirit and scope of the disclosure. The scope of the appended claims includes all such changes and modifications that are within the scope of this disclosure.

    EXAMPLES

    [0434] In order that the invention disclosed herein may be more efficiently understood, examples are provided below. It should be understood that these examples are for illustrative purposes only and are not to be construed as limiting the invention in any manner. Throughout these examples, molecular cloning reactions, and other standard recombinant DNA techniques, were carried out according to methods described in Maniatis et al., Molecular Cloning—A Laboratory Manual, 2nd ed., Cold Spring Harbor Press (1989), using commercially available reagents, except where otherwise noted.

    Example 1: Ex Vivo Genetic Modification of T Cells

    [0435] The piggyBac™ (PB) transposon system was used for genetically modifying human lymphocytes for production of autologous CAR-T immunotherapies and other applications. T Lymphocytes purified from patient blood or apheresis product was electroporated with a plasmid DNA transposon and a transposase. Several different electroporation systems have been used for T cell delivery of the transposon system, including the Neon (Thermo Fisher), BTX ECM 830 (Harvard Apparatus), Gene Pulser (BioRad), MaxCyte PulseAgile (MaxCyte), and the Amaxa 2B and Amaxa 4D (Lonza). Some were tested using manufacturer provided or recommended electroporation buffer, as well as several in-house developed buffers. Results were consistent with the prevailing dogma that resting T lymphocytes are particularly refractory to DNA transfection and that there appeared to be an inverse relationship between electroporation efficiency, as measured by GFP expression from the electroporated plasmid, and cell viability. FIG. 1 shows an example of an experiment testing multiple electroporation systems and nucleofection programs.

    [0436] To further test whether or not plasmid DNA was toxic to T cells during nucleofection, primary human T lymphocytes were electroporated with two different DNA plasmids. The first plasmid was a pmaxGFP™ plasmid that is provided as a control plasmid in the Lonza Amaxa nucleofection kit. It is highly purified by HPLC and does not contain endotoxin at detectable levels. The second plasmid was our in-house produced PB transposon encoding a human EF1 alpha promoter driving GFP. Transfection efficiency, as measured by GFP expression from the electroporated plasmid, and cell viability was assessed by FACS at days 2, 3, and 6 post-electroporation. Data are displayed in FIG. 2. While mock electroporated cells (no plasmid DNA) exhibited relatively high levels of cell viability by day 6 post-electroporation, 54%, T cells electroporated with either plasmid were only 1.4-2.6% viable. These data show that plasmid DNA was cytotoxic to T lymphocytes. In addition, these data show that DNA-mediated toxicity was not due to transposon element such as the ITR regions or the core insulators since the pmaxGFP™ plasmid are devoid of these elements and was also cytotoxic at the same DNA concentration. Both plasmids are approximately the same size, meaning that similar amounts of DNA were electroporated into the T cells.

    [0437] To test whether or not DNA-mediated toxicity in T cells was dose dependent, we performed a titration of our PB-GFP plasmid. FIG. 3 shows that as the dose of plasmid DNA added to the nucleofection reaction was increased incrementally (1.3, 2.5, 5.0, 10.0, and 20.0 μg of plasmid DNA), cell viability decreased as measured at both day 1 and 5 post-nucleofection. Even 1.3 μg of plasmid DNA was responsible for a 2.4-fold decrease in T cell viability by day 4.

    [0438] Since it was clear that plasmid DNA is toxic to T cells during nucleofection, we considered whether or not extracellular plasmid DNA was contributing to cell death. FIG. 4 shows that extracellular plasmid DNA was not cytotoxic to T cells. In that experiment, 5 μg of plasmid DNA was added to the cells 45 min post-electroporation and little cell death was observed at day 1 or day 4. Similarly, when 5 μg of plasmid DNA was added to the nucleofection reaction in the absence of electroporation, little cell death was observed. However, when the plasmid DNA was added before the electroporation reaction, the cells exhibited a 2.0-fold reduction in cell viability at day 1 and a 13.2-fold reduction at day 4.

    [0439] Since DNA-mediated toxicity is dose dependent, we next focused our attention on ways to reduce the total amount of DNA delivered to the T cells that is required for transposition. One relatively straightforward way of achieving this would be to deliver the transposase as encoded in mRNA instead of encoded in DNA. mRNA delivery to primary human T cells is very efficient, resulting in high transfection efficiency and high viability. We subcloned the Super piggyBac™ (SPB) transposase enzyme into our in-house mRNA production vector and produced high quality SPB mRNA. Co-delivery of PB-GFP transposon with various doses of SPB mRNA (30, 10, 3.3, 3, 1, 0.33 μg mRNA) in Jurkat cells demonstrated strong transposition at all doses tested (FIG. 5). These data show that SPB transposase can be delivered and are equally effective as either plasmid DNA or mRNA. In addition, that the amount of SPB mRNA makes little difference in overall transposition efficiency in Jurkats, in either overall percentage of GFP+ cells or in the MFI of GFP expression. To see if this also holds true for T lymphocytes, we delivered PB-GFP with either SPB plasmid DNA, at a 3:1 ratio, or 5 μg of SPB mRNA. Seven (7) days following the nucleofection reaction and the addition of IL7 and IL15, GFP transposition was assessed. FIG. 6 shows that SPB mRNA efficiently mediated transposition of the GFP transposon into T lymphocytes. Importantly, T cell viability was improved when co-delivering the SPB as an mRNA as opposed to a pDNA; 32.4% versus 25.4%, respectively. These data suggest that co-delivery of SPB as mRNA would be dose-sparing in the total amount of plasmid DNA being delivered to T cells and is thus less cytotoxic.

    [0440] Since the current plasmid transposon also contains a backbone required for plasmid amplification in bacteria, it is possible to significantly reduce the total amount of DNA by excluding this sequence. This may be achieved by restriction digest of the plasmid transposon prior to the nucleofection reaction. In addition, this could be achieved by administering the transposon as a PCR product or as a Doggybone™ DNA, which is a double stranded DNA that is produced in vitro by a mechanism that excludes the initial backbone elements required for bacterial replication of the plasmid.

    [0441] We performed a pilot experiment to see whether or not plasmid transposon needed to be circular, or if it could be delivered to the cell in a linear fashion. To test this, transposon was incubated overnight with a restriction enzyme (ApaLI) to linearize the plasmid. Either uncut or linearized plasmid is electroporated into primary T lymphocytes. GFP expression was assessed 2 days later. FIG. 7 shows that linearized plasmid was also efficiently delivered to the cell nucleus. These data demonstrate that linear transposon products can also be efficiently electroporated into primary human T cells.

    [0442] We show above that plasmid DNA is toxic in primary T lymphocytes, but we have observed that this toxic effect is not as dramatic in tumor cell lines and other transformed cells. Based upon this observation, we hypothesized that primary T lymphocytes may be refractory to plasmid DNA transfection due to heightened DNA sensing pathways, which would protect immune cells from infection by viruses and bacteria. If these data are a result of heightened DNA sensing mechanisms, then it may be possible to enhance plasmid transfection efficiency and/or cell viability by the addition of DNA sensing pathway inhibitors to the post-nucleofection reaction. Thus, we tested a number of different reagents that inhibited the TLR-9 pathway, caspase pathway, or those involved in cytoplasmic double stranded DNA sensing. These reagents include Bafilomycin Al, which is an autophagy inhibitor that interferes with endosomal acidification and blocks NFkB signaling by TLR9, Chloroquine, which is a TLR9 antagonist, Quinacrine, which is a TLR9 antagonist and a cGAS antagonist, AC-YVAD-CMK, which is a caspase 1 inhibitor targeting the AIM2 pathway, Z-VAD-FMK, which is a pan caspase inhibitor, Z-IETD-FMK, which is a caspase 8 inhibitor triggered by the TLR9 pathway. In addition, we also tested the stimulation of electroporated T cells by the addition of the cytokines IL7 and IL15, as well as the addition of anti-CD3 anti-CD28 Dynabeads® Human T-Expander CD3/CD28 beads. Results are displayed in FIG. 8. We found that few of the compounds or caspase inhibitors had any positive effect on cell viability at day 4 post-nucleofection at the doses tested. However, we acknowledge that further dosing studies may be required to better test these reagents. It may also be more effective to inhibit these pathways genetically. Two post-nucleofection conditions did enhance viability of the T cells. The addition of IL7 and IL15, whether they were added either 1 hour or 1 day following electroporation, enhanced viability over 3-fold when compared with introduction of the plasmid transposon alone without additional treatment. Furthermore, stimulation of the T cells post-nucleofection using either activator or expander beads also dramatically enhanced T cell viability; stimulation was better when the beads were added 1 hour or 1 day post-nucleofection as compared to adding the beads 2 days post. Lastly, we also tested ROCK inhibitor and the removal of dead cells from the culture using the Dead Cell Removal kit from Miltenyi, but saw no improvement in cell viability.

    [0443] To further expand upon these findings demonstrating that stimulation of the T cells post-nucleofection improves viability, we repeated the study using the addition of the cytokine IL7 and IL15. FIG. 9 shows that the addition of these cytokines each at a dose of 20 ng/mL either immediately following nucleofection or up to 1 hour post enhanced cell viability up to 2.9-fold when compared to no treatment. Addition of these cytokines up to 1 day post-nucleofection also enhanced viability, but not as strong as the prior time points.

    [0444] Since we found that immediate stimulation of the T cells post-nucleofection was able to increase cell viability, we hypothesized that stimulating the cells prior to nucleofection may also enhance viability and transfection efficiency. To test this, we stimulated primary T lymphocytes either 2, 3, or 4 days prior to transposon nucleofection. FIG. 10 shows that some level of transposition occurs when the transposon and the transposase are co-delivered after the T cells have been stimulated prior to the nucleofection reaction. The efficacy of pre-stimulation may be influenced by the kinetics of stimulation and may therefore be dependent upon the precise type of expander technology chosen.

    Example 2: Ex Vivo Genetic Modification of NK Cells

    [0445] The piggyBac™ (PB) transposon system was used for genetically modifying human NK cells. Non-activated NK cells derived from CD3-depleted leukopheresis (containing CD14/CD19/CD56+ cells) were were electroporated with plasmid piggyBac transposon DNA encoding GFP and mRNA encoding Super piggyBac transposase using the program indicated in FIG. 14 from Lonza 4D nucleofector or BTX ECM 830 (500V, 700 usec pulse length, 0.2 mm electrode gap, one pulse). Transposed cells were co-cultured (stimulated) at day 2 with artificial antigen presenting cells (aAPCs). Fluorescent activated cell sorting (FACS) analysis of GFP percent at day 7 post-EP (day 5 post-stimulation) is shown in FIG. 14. Percent viability is the percentage of 7-Aminoactinomycin (7AAD)-negative cells at day 2 post-EP.

    [0446] Transposition of non-activated NK cells from CD3-depleted leukopheresis (containing CD14/CD19/CD56+ cells) is shown in FIG. 15. Cells were electroporated with a plasmid piggyBac transposon encoding GFP and 5 ug mRNA encoding Super piggyBac transposase using the indicated Maxcyte electroporator program. Transposed cells were stimulated at day 2 with artificial antigen presenting cells (aAPCs). FACS plots (FIG. 15A) and a bar graph (FIG. 15B) from the analysis of percent GFP+ of CD56+ cells at day 6 post-EP and day 4 post-stimulation are shown. Percent viability is the percentage of 7AAD-negative cells at day 2 post EP.

    [0447] FIG. 16 shows that there is dose-dependent DNA-mediated cytotoxicity in NK cells. FACS analysis of live cells (7AAD-ve/FSC, or Forward Scatter) at day 2 post-EP using Lonza 4D Nucleofector program DN-100. FACS plots (FIG. 16A) are quantified in graph (FIG. 16B). 5x10E6 cells were electroporated per electroporation in 100 uL P3 buffer in cuvettes. Cells were electroporated with no DNA (Mock) or varying amounts of piggyBac GFP transposon co-delivered with 5 ug super piggyBac mRNA.

    Example 3: In Vitro Differentiation of piggyBac Modified HSPCs into B Cells

    [0448] Human CD34+ HSPCs were electroporated with mRNA encoding Super piggyBac along with a piggyBac transposon encoding GFP. After electroporation, HSPCs were primed for B cell differentiation in presence of human IL-3, Flt3L, TPO, SCF, and G-CSF for 5 days. On day 6, cells were transferred to a layer of MS-5 feeder cells and fed bi-weekly, along with transfer to a fresh layer of feeders once per week. On day 34 of the in vitro differentiation process, CD19+B cells were generated and detectable in the culture (FIG. 17). A fraction of the B cells were positive for the GFP piggyBac transgene (FIG. 17, lower right panel) demonstrating that the piggyBac DNA Modification System can be used to modify HSPCs, which can then be later differentiated into more differentiated immune cell types. This technique allows for the derivation of genetically-modified immune cells from hematopoietic progenitors.