ANTI AQP3 MONOCLONAL ANTIBODY SPECIFICALLY BINDING TO EXTRACELLULAR DOMAIN OF AQUAPORIN 3 (AQP3) AND USE THEREOF

20210130455 · 2021-05-06

Assignee

Inventors

Cpc classification

International classification

Abstract

A subject of the present invention is to provide an anti AQP3 antibody specifically recognizing the extracellular domain of aquaporin 3 (AQP3), which is one type of a water channel protein. By selecting a monoclonal antibody which specifically binds to an oligopeptide included in loop C as one of the extracellular domains of AQP3, an anti AQP3 antibody that is desired in the present invention is provided. An anti AQP3 monoclonal antibody of the present invention can directly bind, from the outside of a cell, to AQP3 present in a cell membrane. Furthermore, as an anti AQP3 monoclonal antibody of the present invention can have an inhibitory activity, the function of permeating a low molecular weight molecule or the like, which is carried by AQP3, can be suppressed.

Claims

1. An anti AQP3 antibody or a functional fragment thereof that specifically binds to an oligopeptide whose amino acid sequence consists of ATYPSGHLDM (SEQ ID NO:1).

2. (canceled)

3. An anti AQP3 antibody or a functional fragment thereof that specifically binds to the extracellular domain of human AQP3 and/or the extracellular domain of mouse AQP3.

4. The antibody or functional fragment thereof according to claim 1, which specifically binds to the extracellular domain of human AQP3 and/or the extracellular domain of mouse AQP3.

5. The antibody or functional fragment thereof according to claim 3, which specifically binds to the extracellular domain of AQP3 expressed on the surface of PAM212 cells, on the surface of mouse macrophages, or on the surface of HEK293 cells.

6. The antibody or functional fragment thereof according to claim 1, which: a) has an inhibitory activity on at least one function of human and/or mouse AQP3; b) inhibits proliferation of one or more of PAM212 cells, HaCaT cells, and A431 cells; c) inhibits H.sub.2O.sub.2 transport; d) inhibits phosphorylation of p65; e) inhibits a liver inflammatory response in mice treated with carbon tetrachloride; or f) comprises a combination of (a) to (e).

7. (canceled)

8. (canceled)

9. (canceled)

10. (canceled)

11. An anti AQP3 antibody or a functional fragment thereof comprising a heavy chain complementarity determining region 1 (HCDR1), a heavy chain complementarity determining region 2 (HCRD2), a heavy chain complementarity determining region 3 (HCDR3), a light chain complementarity determining region 1 (LCDR1), a light chain complementarity determining region 2 (LCDR2), and a light chain complementarity determining region 3 (LCDR3) comprising amino acid sequences selected from the sequences set forth in one of Tables 2A-5E.

12. The antibody or functional fragment thereof according to claim 11, comprising complementarity determining region (CDR) sequences of antibody A, antibody B, antibody C, antibody D, antibody E, antibody F, antibody G, antibody H, antibody J, or antibody K.

13. (canceled)

14. (canceled)

15. (canceled)

16. (canceled)

17. (canceled)

18. The antibody or functional fragment thereof according to claim 11, comprising variable heavy (VH) and variable light (VH) chain sequences of antibody A, antibody B, antibody C, antibody D, antibody E, antibody F, antibody G, antibody H, antibody J, or antibody K.

19. An antibody or functional fragment thereof that competes with the antibody or functional fragment thereof according to claim 18 for binding to human AQP3 and/or mouse AQP3.

20. The antibody or functional fragment thereof according to claim 1, which does not specifically bind to one or more human aquaporins other than AQP3 (“non-AQP3 aquaporins”).

21. (canceled)

22. The antibody or functional fragment thereof according to claim 1, wherein the antibody is a monoclonal antibody.

23. The antibody or functional fragment thereof according to claim 1, wherein the antibody or functional fragment thereof is a chimeric antibody or a humanized antibody having a constant region of a human antibody.

24. The antibody or functional fragment thereof according to claim 1, which is an antibody.

25. The antibody or functional fragment thereof according to claim 24, which is a monospecific antibody.

26. The antibody or functional fragment thereof according to claim 24, which is a multispecific antibody.

27. The antibody or functional fragment thereof according to claim 1, which is a functional fragment of an antibody.

28. The antibody or functional fragment thereof according to claim 27, which is a functional fragment selected from F(ab′).sub.2, Fab, Fab′ and Fv.

29. (canceled)

30. (canceled)

31. An antibody drug conjugate (ADC) comprising the antibody or a functional fragment thereof according to claim 1 conjugated to a cytotoxic agent.

32. (canceled)

33. (canceled)

34. (canceled)

35. (canceled)

36. (canceled)

37. (canceled)

38. A composition comprising the antibody or functional fragment thereof according to claim 1 and a pharmaceutically acceptable carrier, wherein the monoclonal antibody or a functional fragment thereof has an inhibitory activity on at least one function of AQP3.

39. (canceled)

40. (canceled)

41. A method of treating a subject having cancer comprising administering a therapeutically effective amount of the antibody of claim 1 or a functional fragment thereof to the subject.

42. The method of claim 41, wherein the cancer is colorectal cancer, cervical cancer, liver cancer, lung cancer, esophageal cancer, kidney cancer, stomach cancer, tongue cancer, skin cancer, or breast cancer.

43. A method of preventing and/or treating a skin disorder in a subject comprising administering a therapeutically effective amount of the antibody of claim 1 or a functional fragment thereof to the subject.

44. The method of claim 43, wherein the skin disorder is psoriasis, actinic keratosis, ichthyosis, or seborrheic dermatitis.

45. A method of preventing and/or treating an inflammatory disorder in a subject comprising administering a therapeutically effective amount of the antibody or claim 1 or a functional fragment thereof to the subject.

46. The method of claim 45, wherein the inflammatory disorder is atopic dermatitis, psoriasis, asthma, chronic obstructive pulmonary disease, or hepatitis.

47. (canceled)

48. (canceled)

49. (canceled)

50. (canceled)

51. (canceled)

52. A method for generating an anti AQP3 antibody, comprising immunizing a non-human mammal with a combination of (i) a peptide whose amino acid sequence consists of the amino acid sequence of SEQ ID NO:1 and (ii) AQP3 overexpressing cells.

53. (canceled)

54. (canceled)

55. (canceled)

Description

BRIEF DESCRIPTION OF DRAWINGS

[0110] FIG. 1 is a diagram illustrating the molecular structure of aquaporin. It has a transmembrane structure of traversing, from the N-terminal to the C-terminal, the membrane six times and, in the five regions connected between the six transmembrane domains of transmembrane domains I to VI, five loops (loop A to loop E) are included. Among those loops, loop A, loop C, and loop E are present at the extracellular side while loop B and loop D are present at the intracellular side, respectively. The N-terminal region and the C-terminal region are all included in the intracellular domain. Two NPAs shown in the drawing indicate an NPA box consisting of three amino acid residues of asparagine-proline-alanine. The NPA box is present inside an aquaporin molecule and it is known to be widely preserved among biospecies.

[0111] FIG. 2 is a diagram showing the result of testing the binding property of anti AQP3 antibodies of the present invention to a peptide having the amino acid sequence of SEQ ID NO:1. Left panel shows the results for antibodies C, E, H, J, and a negative control IgG antibody (IgG). Right panel shows the results for antibodies B, G, K, A, D, and F.

[0112] FIG. 3 is a diagram showing the result of testing the binding property of anti AQP3 antibodies of the present invention to cell lysate of AQP3 overexpressing HEK293T cells (AQP3). Cell lysate from HEK293T cells not overexpressing AQP3 was used as control (N.C.).

[0113] FIG. 4 is a diagram showing the result of testing the binding property of an anti AQP3 antibody of the present invention to mouse macrophage cells. Used is antibody J, which is one of the anti AQP3 antibodies of the present invention.

[0114] FIG. 5A is a diagram showing the result of testing the binding property of an anti AQP3 antibody of the present invention to mouse epithelial cells (PAM212 cells). Used is antibody J, which is one of the anti AQP3 antibodies of the present invention.

[0115] FIG. 5B is a diagram showing the result of testing the binding property of antibodies A, B, C, D, E, F, G, H, and J to mouse epithelial cells (PAM212 cells).

[0116] FIG. 5C is a diagram showing the result of testing the binding property of antibodies A, B, C, D, E, F, G, H, and J to human epithelial cells (HaCaT cells).

[0117] FIG. 6A is a diagram showing the result of testing the binding property of antibody G, which is one of the anti AQP3 antibodies of the present invention, to human epithelial cells (HaCaT cells).

[0118] FIG. 6B is a diagram showing the result of testing the binding property of antibody H, which is one of the anti AQP3 antibodies of the present invention, to human epithelial cells (HaCaT cells).

[0119] FIG. 6C is a diagram showing the result of testing the binding property of antibody J, which is one of the anti AQP3 antibodies of the present invention, to human epithelial cells (HaCaT cells).

[0120] FIG. 6D is a diagram showing the result of testing the binding property of antibody E to HEK293 cells overexpressing mouse AQP3.

[0121] FIG. 6E is a diagram showing the result of testing the binding property of antibody H to HEK293 cells overexpressing mouse AQP3.

[0122] FIG. 6F is a diagram showing the result of testing the binding property of antibody J to HEK293 cells overexpressing mouse AQP3.

[0123] FIG. 6G is a diagram showing the result of testing the binding properties of antibody E to HEK293 cells overexpressing mouse AQP3.

[0124] FIG. 6H is a diagram showing the result of testing the binding properties of antibody E to HEK293 cells overexpressing human AQP3.

[0125] FIG. 7A is a diagram showing the result of carrying out immunostaining for AQP3-expressing cells (mouse macrophages) by using an anti AQP3 antibody of the present invention. As anti AQP3 antibodies of the present invention, antibody H and antibody J were used.

[0126] FIG. 7B is a diagram showing the result of carrying out immunostaining for AQP3-expressing cells (mouse macrophages) (top panel) and AQP3 knock-out cells by using an anti AQP3 antibody of the present invention. As an anti AQP3 antibody of the present invention, antibody J was used.

[0127] FIG. 8A is a diagram showing the result of testing the activity on cell proliferation of an anti AQP3 antibody of the present invention by using mouse epithelial cells (PAM212 cells). As anti AQP3 antibodies of the present invention, antibody G and antibody J were used.

[0128] FIG. 8B is a diagram showing the result of testing the activity on cell proliferation of an anti AQP3 antibody of the present invention by using mouse epithelial cells (PAM212 cells). An anti AQP3 antibody of the present invention, antibody J was used.

[0129] FIG. 8C is a diagram showing the result of testing the activity on cell proliferation of an anti AQP3 antibody of the present invention by using mouse epithelial cells (PAM212 cells). As anti AQP3 antibodies of the present invention, antibodies A, B, C, D, E, F, G, H, and J were used.

[0130] FIG. 9 is a diagram showing the result of testing the activity on cell proliferation of an anti AQP3 antibody of the present invention by using human epithelial cells (HaCaT cells). As anti AQP3 antibodies of the present invention, antibody G, antibody H, and antibody J were used.

[0131] FIG. 10 is a diagram showing the result of testing the activity on cell proliferation of anti AQP3 antibodies of the present invention by using human epithelioid carcinoma cells (A431 cells). As anti AQP3 antibodies of the present invention, antibody G, antibody H, and antibody J were used.

[0132] FIG. 11 is a diagram showing the result of testing the functional inhibition effect of an anti AQP3 antibody of the present invention on the hydrogen peroxide permeation function in mouse macrophage cells as AQP3-expressing cells. As an anti AQP3 antibody of the present invention, antibody J was used.

[0133] FIG. 12 is a diagram showing the result of testing the functional inhibition effect of anti AQP3 antibodies of the present invention on the hydrogen peroxide permeation function in mouse macrophage cells as AQP3-expressing cells. As anti AQP3 antibodies of the present invention, antibodies A, B, C, D, E, F, G, H, and J were used.

[0134] FIG. 13 is a diagram showing the result of testing the functional inhibition effect of an anti AQP3 antibody of the present invention on the LPS responsive p65 activation (p65 phosphorylation) in mouse macrophage cells as AQP3-expressing cells. As an anti AQP3 antibody of the present invention, antibody J was used.

[0135] FIG. 14A is a diagram showing the result of testing the inhibitory effect of an anti AQP3 antibody of the present invention on acute liver disorder (inflammatory response and disorder response) which was caused in a mouse by treatment with carbon tetrachloride. The test was carried out by having the AST level in blood serum as an indicator. As an anti AQP3 antibody of the present invention, antibody J was used.

[0136] FIG. 14B is a diagram showing the result of testing the inhibitory effect of the anti AQP3 antibody of the present invention on acute liver disorder (inflammatory response and disorder response) which was caused in a mouse by treatment with carbon tetrachloride. The test was carried out by having the ALT level in blood serum as an indicator. As an anti AQP3 antibody of the present invention, antibody J was used.

[0137] FIG. 15A is a diagram showing the result of testing the inhibitory effect of an anti AQP3 antibody of the present invention on acute liver disorder (inflammatory response and disorder response) which was caused in a mouse by treatment with carbon tetrachloride. The test was carried out by having the TNF-α mRNA expression level in a RNA sample, which was derived from liver, as an indicator. As an anti AQP3 antibody of the present invention, antibody J was used.

[0138] FIG. 15B is a diagram showing the result of testing the inhibitory effect of an anti AQP3 antibody of the present invention on acute liver disorder (inflammatory response and disorder response) which was caused in a mouse by treatment with carbon tetrachloride. The test was carried out by having the IL-6 mRNA expression level in a RNA sample, which was derived from liver, as an indicator. As an anti AQP3 antibody of the present invention, antibody J was used.

DESCRIPTION OF EMBODIMENTS

[0139] (1) Preparation of an Anti AQP3 Antibody Specifically Recognizing Extracellular Domain of AQP3

[0140] Because there are three extracellular domains in AQP3, such as loop A, loop C, and loop E, by having at least one AQP3 fragment of them as an immunogen, a host animal can be immunized. In the case of human AQP3, in the polypeptide consisting of full-length 292 amino acid residues (UniProt accession: Q92482), positions 50 to 53 (loop A), positions 131 to 157 (loop C), and positions 210 to 244 (loop E; all positions represent the position from N-terminal side) form each of the extracellular domains. The immunogen is preferably an AQP3 fragment of loop C. Particularly preferably, a polypeptide composed of ten amino acid residues, which is the C-terminal part of loop C and adjacent to the boundary to the transmembrane domain IV, is used as an immunogen. The C-terminal part of loop C adjacent to the boundary to the transmembrane domain IV has the amino acid sequence ATYPSGHLDM (SEQ ID NO: 1) in both human and mouse.

[0141] Oligopeptides can be chemically synthesized by well-known standard methods. Furthermore, they can be simply obtained by using a custom-made synthesis service that is commercially available.

[0142] As for the immunogen, an oligopeptide itself can be used for immunization, or it is also possible that immunization can be carried out by using reconstituted membrane or recombinant body cells which provide a polypeptide containing the oligopeptide to a membrane. When the immunogen is prepared in the form of a transmembrane protein containing the oligopeptide part, the preparation is preferably carried out by using a baculovirus display method. In that case, a polypeptide containing the oligopeptide can be expressed on a membrane surface of baculovirus and immunization of a host animal can be carried out by using the baculovirus itself as an immunogen to induce an antibody. Those immunogens may be used for immunization either singly or a combination of them may be used simultaneously.

[0143] In some embodiments, the host animal is immunized with a peptide whose amino acid sequence consists of the amino acid sequence of SEQ ID NO:1 in combination with AQP3 overexpressing cells. For example, AQP3 overexpressing cells can be HaCaT cells, PAM212 cells, mouse macrophages, or HEK293 cells overexpressing AQP3 or a combination thereof. In another embodiment, the AQP3 overexpressing cells are AQP3 overexpressing CHO cells, e.g., CHO cells expressing mouse or human AQP3 under the control of the CMV promoter. Exemplary vectors that can be used include pCMV6-AC (Origene sc322406) (human AQP3) and pCMV6-Entry-Myc-DDK (Origene MR203989) (mouse AQP3). In some embodiments, the AQP3 overexpressing cells comprise a combination of CHO cells overexpressing mouse AQP3 and CHO cells overexpressing human AQP3.

[0144] Preferred examples of the host animal to be immunized include, although not particularly limited, animals like mouse, rat, rabbit, guinea pig, sheep, goat, donkey, chicken, and camel. More preferably, the host animal is a mouse or a rat, and particularly preferably a mouse. For example, reference can be made to the methods described in WO 2015/179360 A. An anti-blood serum containing an anti AQP3 antibody can be produced by a well-known standard method. Anti AQP3 antibodies can be any class of the five kinds of immunoglobulin molecules (IgG, IgM, IgA, IgD, and IgE). Anti AQP3 antibodies are preferably IgG or IgM, and more preferably IgG. Among the IgG subclasses, IgG2 has lower ADCC activity and IgG4 has lower CDC activity. As such, when it is desired to use an antibody having low cell damaging property, it is preferable to use, among IgGs, an antibody of subclass IgG2 or IgG4.

[0145] (2) Preparation of an Anti AQP3 Monoclonal Antibody (Anti AQP3 mAb)

[0146] An anti AQP3 mAb can be produced as a monoclonal antibody by cloning after fusion of antibody-producing cells obtained during a preparation process as described above in (1) with myeloma cells. Alternatively, according to a genetic engineering method, it can be produced by expressing the chemically-synthesized antibody gene in E. coli or the like. The method for fusing antibody-producing cells and myeloma cells, the method for screening desired cells from the cell group containing the fused cells, the method for monoclonizing the cells selected by screening, and the method for producing mAb from clones can be all carried out according to well-known standard methods. Synthesis of a desired mAb based on sequence information can be also carried out according to well-known standard methods. As it is described in detail in the examples that are given below, monoclonal antibodies that are representative examples of the anti AQP3 mAbs of the present invention have the amino acid sequences of the heavy chain and light chain CDRs or the amino acid sequences of the heavy chain and light chain variable regions that are specifically disclosed. A mAb can be also prepared as a non-secretion type recombinant mAb which consists of an amino acid sequence obtained by removing the signal sequence from each variable region of the heavy chain and light chain. The recombinant mAb with removed signal sequence can accumulate in a host cell without being secreted from the host cell expressing the recombinant mAb into a culture supernatant. The signal sequence can be predicted from the amino acid sequence information, and, for example, it can be predicted by using software for predicting signal sequence. Exemplary software for predicting signal sequence includes Signal P, PRORT II, and the like.

[0147] (3) Preparation of Inhibitory Anti AQP3 mAb

[0148] Among anti AQP3 antibodies, an antibody having an inhibitory activity for the function of AQP3 is referred herein to as an inhibitory anti AQP3 antibody. In the case of a monoclonal antibody, it is referred to as an inhibitory anti AQP3 mAb, in particular. Herein, the function of AQP3 indicates at least one activity selected from the group consisting of an activity of transporting (permeating) a low molecular weight material by AQP3, an activity of promoting cell proliferation of AQP3-expressing cells, and an activity of promoting cell migration of AQP3-expressing cells. Herein, the low molecular weight material indicates at least one material selected from the group consisting of water molecule, glycerol, and hydrogen peroxide. Presence or absence of the desired inhibitory activity of an anti AQP3 antibody can be determined by having, as an indicator, a decrease in at least one of the cell migration activity and/or cell proliferation activity by 10% or more, 20% or more, or 30% or more according to extracellular addition of a sufficient amount of the anti AQP3 antibody to the cells which constitutively express AQP3 (PAM212 cells, HaCaT cells, A431 cells, or the like) compared to a control without the addition. Alternatively, the determination can be made by having, as an indicator, a decrease in the hydrogen peroxide permeating activity of cells by 10% or more, 20% or more, or 30% or more according to extracellular addition of a sufficient amount of the anti AQP3 antibody to the cells which constitutively express AQP3 (mouse macrophage cells or the like) compared to a control without the addition.

[0149] (4) Functional Fragment of an Antibody

[0150] As long as sufficient specificity and affinity for AQP3 are exhibited, an antibody of the present invention is not necessarily required to maintain the whole structure of an immunoglobulin molecule, and it can be a functional fragment of the antibody (antigen binding fragment). Because the antigen binding property of an antibody is decided by a variable part of the antibody, the constant region part of an immunoglobulin molecule may not be necessarily present. As such, examples of a functional fragment of an antibody of the present invention include Fab, Fab′, F(ab′).sub.2, which are a fragment consisting of a variable part of an immunoglobulin molecule, Fd obtained by removing VL from Fab, single-chain Fv fragment (scFv) and a dimer thereof, i.e. a diabody. Alternatively, a single domain antibody (sdAb) obtained by removing VL from scFv, or the like can be also used, but the functional fragment of the antibody is not limited to them.

[0151] A functional fragment of an antibody can be prepared by a known technique. For example, fragmentation can be carried out by an enzyme treatment of an immunoglobulin molecule. According to degradation of an immunoglobulin molecule with papain, a Fab is obtained. According to degradation with pepsin, a F(ab′).sub.2 is obtained, and according to a reducing treatment of a F(ab′).sub.2, a Fab′ is obtained. Furthermore, it is also possible, according to a genetic engineering technique, to produce a scFv by linking a heavy chain variable part (VH) to a light chain variable part (VL) of an antibody via a linker peptide with sufficient mobility.

[0152] (5) Antibody Labeled with Reporter Material

[0153] Depending on a case, an anti AQP3 antibody or a functional fragment thereof of the present invention is used in a state where it is labeled with a reporter material. The reporter material can be any kind as long as it can label the anti AQP3 antibody or a functional fragment thereof while they maintain a desired function. A material capable of generating a signal for quantitative measurement of the present of AQP3 is more preferable. Examples thereof include a radioactive isotope, a metal micro particle, an enzyme, a fluorescent material, and a luminescent material. When a radioactive isotope, a fluorescent material, or a luminescent material is used as a reporter material, the radioactivity, fluorescence, or luminescence generated from them can be quantitatively measured as a signal. When the reporter material is an enzyme, after application to a suitable substrate, the pigment that is finally generated, color, fluorescence, or luminescence derived from fluorescent material or luminescent material can be measured as a signal. Examples of radioactive isotopes include .sup.3H and .sup.125I. Examples of fluorescent materials include fluorescein and derivatives thereof (for example, FITC), tetramethyl rhodamine (TAM RA) and derivatives thereof (for example, TRITC), Cy3, Cy5, Texas Red, phycoerythrin (PE), and quantum dots. Examples of luminescent materials include a luminol derivative, an acridinium derivative, aequorin, and a ruthenium complex. Examples of metal micro particles include gold nano particles and nano particles composed of an alloy of gold and platinum. Examples of reporter enzymes include horseradish peroxidase (HRP), β-galactosidase (β-GAL), alkali phosphatase (ALP), glucose oxidase (GOD), luciferase, and aequorin. By using each enzyme in combination with a suitable substrate, analysis based on light-emission method, colorimetric method, or fluorescence method can be made. For a quantitative analysis, an antibody or a functional fragment thereof of the present invention, which is labeled with a reporter material, is preferably used.

[0154] (6) Antibody Immobilized on Solid Support

[0155] Depending on a case, an anti AQP3 antibody or a functional fragment thereof of the present invention can be used in a state where it is immobilized on a solid support. The solid support can be any material as long as it can immobilize an antibody or a functional fragment thereof while they remain in a state of maintaining a desired activity. It is preferably a material composed of an inactive material which does not have any influence on the biological analysis using an antibody. Examples of solid supports include a micro plate, a glass plate, a plastic plate, a syringe, a vial, a column, a magnetic particle, a micro bead made of resin, a porous membrane, a porous carrier, and a microchip. The micro plate, syringe, vial, column, and microchip are all preferably made of an inactive resin. Solid supports can be also made of glass.

[0156] (7) Antibody Specifically Binding to AQP3 Derived from Human and/or Mouse

[0157] An anti AQP3 antibody or a functional fragment thereof of the present invention binds to the extracellular domain of AQP3, in particular, loop C (second extracellular domain) in some embodiments. The amino acid sequence of loop C exhibits high conservation among biospecies. Both the amino acid sequence of human loop C and the amino acid sequence of mouse loop C (positions 131 to 157 from the N-terminal side for both human and mouse) have high homology as it is described below.

TABLE-US-00031 Human: (SEQ ID NO: 2) ADNQLFVSGPNGTAGIFATYPSGHLDM Mouse: (SEQ ID NO: 3) ANNELFVSGPNGTAGIFATYPSGHLDM

[0158] Due to the above reason, an anti AQP3 antibody or a functional fragment thereof of the present invention, which binds to loop C as the extracellular domain, is highly likely to bind specifically to human AQP3 and also mouse AQP3. In some aspects, the present invention relates to antibodies which can be obtained by using the polypeptide (oligopeptide) composed of ten amino acid residues at the C-terminal side of loop C as an immunogen. The oligopeptide composed of ten amino acid residues has an amino acid sequence consisting of ATYPSGHLDM (SEQ ID NO: 1), and the human sequence and mouse sequence are in complete match in that part. Due to this reason, it is highly likely that an anti AQP3 antibody or a functional fragment thereof which is obtained according to the examples of the present invention not only specifically recognizes human AQP3 but also specifically recognizes mouse AQP3. Actually, according to the testing performed on individual mAbs described in the examples, it appears that mAbs of the disclosure can generally recognize both of them. Furthermore, an inhibitory anti AQP mAb of the present invention and a functional fragment thereof can in some embodiments inhibit the function of AQP3 for both human AQP3 and mouse AQP3.

[0159] In some embodiments, anti AQP3 antibodies and functional fragments thereof do not specifically bind to one or more human aquaporins other than AQP3, for example, one or more of AQP0 (Accession no. NP_036196.1), APQ1 (Accession no. NP_932766.1), AQP2 (Accession no. NP_000477.1), AQP4 (Accession no. NP_001641.1), AQP5 (Accession no. NP_001642.1), AQP6 (Accession no. NP_001643.2), AQP7 (Accession no. NP_001161.1), AQP8 (Accession no. NP_001160.2), AQP9 (Accession no. NP_066190.2), AQP10 (Accession no. NP_536354.2), AQP11 (Accession no. NP_766627.1), and AQP12 (Accession no. NP_945349.1).

[0160] (8) Variable Region of Antibody Molecules and Complementarity-Determining Regions in Variable Regions

[0161] An immunoglobulin molecule is a hetero tetramer molecule which is basically composed of two heavy chain polypeptides and two light chain polypeptides. Each of the heavy chain and light chain contains a variable region and a constant region. The heavy chain variable region and light chain variable region of an antibody consist of three CDRs (complementarity-determining regions) and four FRs (framework regions), and FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4 are arranged in the order, from the amino terminal to the carboxy terminal. When the amino acid sequence information of an antibody molecule is determined by a known technique, location of a variable region or a constant region can be predicted based on the sequence information. Furthermore, predicting the sequence of CDR1, CDR2, and CDR3 in a variable region can be also similarly carried out by known methods.

[0162] (9) Preparation of Antibody Molecules

[0163] A representative anti AQP3 mAb of the present invention is an mAb of which heavy chain variable region consists of the amino acid sequence represented by SEQ ID NO: 4 and light chain variable region consists of the amino acid sequence represented by SEQ ID NO: 5, an mAb of which heavy chain variable region consists of the amino acid sequence represented by SEQ ID NO: 6 and light chain variable region consists of the amino acid sequence represented by SEQ ID NO: 7, or an mAb of which heavy chain variable region consists of the amino acid sequence represented by SEQ ID NO: 8 and light chain variable region consists of the amino acid sequence represented by SEQ ID NO: 9.

[0164] An anti AQP3 antibody of the present invention can be produced as a monoclonal antibody by, after cloning the antibody gene from hybridoma or artificially synthesizing the antibody gene based on the amino acid sequence information of the antibody polypeptide, introducing the antibody gene to a suitable expression vector, and introducing the vector to a host using a gene recombination technique.

[0165] In that case, a promoter, an enhancer, a polyadenylation signal, or the like can be suitably arranged in the vector. As for the vector, any vector can be used as long as it uses a replicable host cells like bacteria, yeast, and animal cells, and a commercially available vector can be suitably used depending on a host. The expression vector can be introduced to a host cell by a known method for transforming the host cells. Examples of the method include an electroporation method, a DEAE-dextran method, and a calcium phosphate method.

[0166] The host cell is not particularly limited, but a eukaryotic cell is preferably used. Examples thereof include yeast and cultured cells derived from an animal (HEK293 cells, CHO cells, COS cells, and MEF, etc.).

[0167] Purification of a produced antibody can be carried out by using a method for separation and purification that is generally employed for proteins. For example, it can be suitably carried out by suitably combining affinity chromatography, other chromatography, filtration, ultrafiltration, salting-out, dialysis, and the like.

[0168] (10) Modified Products of Antibodies

[0169] An anti AQP3 mAb of the present invention may be a sequence-modified product of an antibody having the amino acid sequences described in the above section or Table 1 or Table 6. For example, by having an antibody of which heavy chain variable region consists of the amino acid sequence represented by SEQ ID NO: 4 and light chain variable region consists of the amino acid sequence represented by SEQ ID NO: 5 as a starting point for modification, and within a range in which the specific binding property to the extracellular domain of AQP3 is substantially maintained (within a range in which a specific binding property substantially equivalent to the specific binding property of the original antibody is maintained), a modification may be present within each variable region of the heavy chain and light chain. In each of the amino acid sequence described above, it is also possible that one or several, for example one to ten, preferably one to five, more preferably one or two, and even more preferably one amino acid residue is deleted, substituted, inserted, or added. Furthermore, when calculation is made by using a tool like BLAST, the modification may be present within a range in which there is sequence homology of at least 85% or more, preferably 90% or more, more preferably 95% or more, and particularly preferably 97% or more. However, for any modified product, there is preferably no modification of the amino acid sequence of the CDRs (such that each CDR has the same amino acid sequence as that of the antibody before modification). Namely, in some embodiments, with regard to a modified polypeptide of the heavy chain variable region which consists of the amino acid sequence represented by SEQ ID NO: 4, modification on sequence is not present for CDR1 which consists of the amino acid sequence of SEQ ID NO: 10, CDR2 which consists of the amino acid sequence of SEQ ID NO: 11, and CDR3 which consists of the amino acid sequence of SEQ ID NO: 12. Similarly, in some embodiments, with regard to a modified polypeptide of the light chain variable region which consists of the amino acid sequence represented by SEQ ID NO: 5, modification on sequence is not present for CDR1 which consists of the amino acid sequence of SEQ ID NO: 13, CDR2 which consists of the amino acid sequence of SEQ ID NO: 14, and CDR3 which consists of the amino acid sequence of SEQ ID NO: 15. The same can apply to a modified polypeptide of the heavy chain variable region which consists of the amino acid sequence represented by SEQ ID NO: 6, a modified polypeptide of the light chain variable region which consists of the amino acid sequence represented by SEQ ID NO: 7, a modified polypeptide of the heavy chain variable region which consists of the amino acid sequence represented by SEQ ID NO: 8, and a modified polypeptide of the light chain variable region which consists of the amino acid sequence represented by SEQ ID NO: 9.

[0170] It is widely known that the CDR sequence is a major factor for determining an epitope of an antibody. An anti AQP3 mAb of the present invention preferably has, even for the sequence-modified product described above, completely preserved CDRs present in total number of 6 as it is included in the heavy chain and light chain. As such, it is reasonably expected to have a specific binding property for the same epitope as the anti AQP3 mAb before modification. Furthermore, as long as it binds to the same epitope, it is also reasonably expected that, even when the anti AQP3 mAb is the above described sequence-modified product, it has the activity of inhibiting the function of AQP3 as the antibody before modification.

[0171] (11) Chimeric Antibodies and Humanized Antibodies

[0172] An anti AQP3 mAb of the present invention can be an artificially-modified gene recombination type antibody for the purpose of reducing the heteroantigenicity to a human or the like. Examples of those antibodies include a chimeric antibody and a humanized antibody. These modified antibodies can be produced by known methods.

A chimeric antibody can be prepared by linking the DNA encoding the variable region (V) of an anti AQP3 mAb of the present invention to the DNA encoding a constant (C) region of a human antibody, introducing the resultant construct to an expression vector, and introducing the vector to a host.

[0173] A humanized antibody can be obtained by grafting CDRs of an antibody of a mammal other than a human, such as CDRs of a mouse antibody, to a human acceptor antibody (CDR grafting). Production thereof can be suitably carried out by applying a common technique for gene recombination. For example, it is possible that a DNA sequence designed to encode an amino acid sequence for linking each CDR of a mouse anti AQP3 mAb and a framework region of a human antibody is synthesized by PCR method by using several oligonucleotides as a primer, which have been prepared such that they have an overlapped region at terminal regions of both the CDR and FR. For example, it can be carried out by a method described in WO 98/13388 A. The FR of the variable region of a human antibody can be obtained from published DNA data base or the like.

[0174] As for the constant region of a chimeric antibody and a humanized antibody, the constant region of a human antibody can be used. For example, Cy1, Cy2, Cy3, and Cy4 are preferably used for the heavy chain while OK and CA are preferably used for the light chain.

[0175] Because chimeric antibodies and humanized antibodies have reduced heteroantigenicity in the human body, they have long half-life in a living body of a human and are useful as an effective ingredient of the pharmaceutical composition of the present invention (agent for prevention and/or treatment). Methods of antibody humanization are known in the art. See, e.g., Riechmann et al., 1988, Nature 332:323-7; U.S. Pat. Nos. 5,530,101; 5,585,089; 5,693,761; 5,693,762; and U.S. Pat. No. 6,180,370 to Queen et al; EP239400; PCT publication WO 91/09967; U.S. Pat. No. 5,225,539; EP592106; EP519596; Padlan, 1991, Mol. Immunol., 28:489-498; Studnicka et al, 1994, Prot. Eng. 7:805-814; Roguska et al, 1994, Proc. Natl. Acad. Sci. 91:969-973; and U.S. Pat. No. 5,565,332

[0176] In some embodiments, the anti AQP3 antibodies an functional fragments thereof can be antibodies or antibody fragments whose sequence has been modified to alter at least one constant region-mediated biological effector function relative to the corresponding wild type sequence.

[0177] For example, in some embodiments, an anti AQP3 antibody of the present invention can be modified to reduce at least one constant region-mediated biological effector function relative to an unmodified antibody, e.g., reduced binding to the Fc receptor (FcγR). FcγR binding can be reduced by mutating the immunoglobulin constant region segment of the antibody at particular regions necessary for FcγR interactions (see e.g., Canffeld and Morrison, 1991, J. Exp. Med. 173:1483-1491; and Lund et al., 1991, J. Immunol. 147:2657-2662). Reduction in FcγR binding ability of the antibody can also reduce other effector functions which rely on FcγR interactions, such as opsonization, phagocytosis and antigen-dependent cellular cytotoxicity (“ADCC”). In other embodiments, an anti AQP3 antibody of the present invention can be modified to acquire or improve at least one constant region-mediated biological effector function relative to an unmodified antibody, e.g., to enhance FcγR interactions (see, e.g., US 2006/0134709). For example, an anti AQP3 antibody of the present invention can have a constant region that binds FcγRIIA, FcγRJIB and/or FcγRIIIA with greater affinity than the corresponding wild type constant region.

[0178] Thus, antibodies of the present invention can have alterations in biological activity that result in increased or decreased opsonization, phagocytosis, or ADCC. Such alterations are known in the art. For example, modifications in antibodies that reduce ADCC activity are described in U.S. Pat. No. 5,834,597. An exemplary ADCC lowering variant corresponds to “mutant 3” shown in FIG. 4 of U.S. Pat. No. 5,834,597, in which residue 236 is deleted and residues 234, 235 and 237 (using EU numbering) are substituted with alanines.

[0179] (12) Reagents for Detecting AQP3

[0180] From the viewpoint that an anti AQP3 antibody or a functional fragment thereof of the present invention has an ability of specifically binding to AQP3, a composition containing the antibody or a functional fragment thereof can be provided. This composition can be provided as a reagent for detecting AQP3. Herein, an anti AQP3 antibody or a functional fragment thereof to be contained in a reagent may also be one which is labeled with a reporter material as it has been described in above (5). When it is labeled with a reporter material, detection can be carried out without using a secondary antibody. As another embodiment, an antibody or a functional fragment thereof to be contained in a reagent may be bound or adsorbed onto a solid support such as magnetic micro particles. In a case in which the anti AQP3 antibody or a functional fragment thereof of the present invention is contained as a solution in the reagent, the concentration thereof can be suitably set depending on the purpose of the reagent or mode of use. For example, it can be set within a range of 1 ng/mL to 10 mg/mL, 100 ng/mL to 1 mg/mL, or 1 μg/mL to 300 μg/mL. Furthermore, although the reagent may be used as a stock solution by itself, it can also be used in a diluted state (10 times to 10,000 times) depending on the purpose. As for the solvent, water or a buffer solution can be suitably used.

[0181] (13) Reagents for Identification, Separation, and Purification of AQP3-Expressing Cells

[0182] An anti AQP3 antibody or a functional fragment thereof of the present invention specifically recognizes and binds to the extracellular domain of AQP3, more specifically, the epitope within loop C in some embodiments. From the viewpoint that it can bind to the extracellular domain of an AQP3 molecule, it can be also used for a system in which living cells are employed as a sample. Even for a case of carrying out immunohistological staining, it is not necessary to perform fixing or dialysis of tissue or cells. Accordingly, regardless of the state of cells to be a sample, an anti AQP3 antibody or a functional fragment thereof of the present invention can be used for the identification of AQP3-expressing cells. In particular, when isolated living cells like hematocyte cells are employed as a sample, an anti AQP3 antibody or a functional fragment thereof of the present invention can be used for separation or purification of the AQP3-expressing cells according to combination with a suitable instrument like a flow cytometer. When it is used for separation or purification of the AQP3-expressing cells, an anti AQP3 antibody or a functional fragment thereof labeled with a reporter material as described in above (5) are suitably used. As for the reporter material, a fluorescent pigment is preferable. Examples thereof include FITC, PE/RD1, ECD, PC5, PC7, and APC/Cy3. Alternatively, for separation or purification of the AQP3-expressing cells, an anti AQP3 antibody or a functional fragment thereof immobilized onto a solid phase such as magnetic micro particles can be also used. After binding to the anti AQP3 antibody or a functional fragment thereof immobilized onto a solid phase, the AQP3-expressing cells can be specifically separated by utilizing magnetic force or the like. After the separation, the antibody or a functional fragment thereof can be dissociated from the cells based on adjustment of salt strength or the like. As such, according to this order, the separation or purification of the AQP3-expressing cells can be completed. For the identification, separation, or purification of the AQP3-expressing cells, the composition containing the anti AQP3 antibody or a functional fragment thereof of the present invention is provided as a reagent for detecting AQP3. The reagent may be produced and used as it is described in above (12).

[0183] (14) Reagents for Measuring Expression Amount of AQP3

[0184] An anti AQP3 antibody or a functional fragment thereof of the present invention can be used as a component of the reagent for detecting AQP3 as described in above (12). Herein, if the anti AQP3 antibody or a functional fragment thereof is labeled with a reporter material as described in above (5) and the reporter material generates a signal allowing quantitative measurement, not only the presence or absence of AQP3 as a target but also the expression amount of AQP3 can be quantitatively measured. Furthermore, even in a case in which an anti AQP3 antibody labeled with a reporter material or a functional fragment thereof is not used, by using in combination a secondary antibody that is labeled with a reporter material which generates a signal allowing quantitative measurement, an anti AQP3 antibody or a functional fragment thereof of the present invention can be used for the measurement of the expression amount of AQP3. For this purpose, a composition containing an anti AQP3 antibody or a functional fragment thereof of the present invention is provided as a reagent for measuring the expression amount of AQP3. The reagent may be suitably produced and used as it is described in the example of above (12).

[0185] (15) Antibody Drug Conjugates

[0186] The present invention provides antibody drug conjugates (ADCs) comprising an anti AQP3 antibody of the present invention or functional fragment thereof conjugated to a cytotoxic agent. Linkers and processes for making ADCs are known in the art and can be used to make an ADC of the present invention. See, e.g., Tsuchikama and An, 2018, Protein & Cell, 9(1):33-46; Deonarain et al., 2015, Expert Opin Drug Discov. 10(5):463-81; Singh et al., 2015, Pharm Res. 2015 November; 32(11):3541-71. The ADCS of the disclosure can be included in pharmaceutical compositions for use in treating cancer.

[0187] Exemplary cytotoxic agents include, for example, auristatins, camptothecins, calicheamicins, duocarmycins, etoposides, maytansinoids (e.g., DM1, DM2, DM3, DM4), taxanes, benzodiazepines (e.g., pyrrolo[I,4]benzodiazepines, indolinobenzodiazepines, and oxazolidinobenzodiazepines including pyrrolo[I,4]benzodiazepine dimers, indolinobenzodiazepine dimers, and oxazolidinobenzodiazepine dimers) and vinca alkaloids. Techniques for conjugating therapeutic agents to proteins, and in particular to antibodies, are well-known. (See, e.g., Alley et al., 2010, Current Opinion in Chemical Biology 14: 1-9; Senter, 2008, Cancer J., 14(3): 154-169.) Typically, the therapeutic agent is conjugated to the antibody via a linker unit. The linker unit can be cleavable or non-cleavable. For example, the therapeutic agent can be attached to the antibody with a cleavable linker that is sensitive to cleavage in the intracellular environment of an AQP3 expressing cancer cell but is not substantially sensitive to the extracellular environment, such that the conjugate is cleaved from the antibody when it is internalized by the AQP3 expressing cancer cell (e.g., in the endosomal, lysosomal environment, or in the caveolear environment). In another example, the therapeutic agent can be conjugated to the antibody via a non-cleavable linker and drug release is by total antibody degradation following internalization by the AQP3 expressing cancer cell.

[0188] Typically, the ADC will comprise a linker region between the cytotoxic agent and the anti AQP3 antibody. As noted supra, typically, the linker can be cleavable under intracellular conditions, such that cleavage of the linker releases the therapeutic agent from the antibody in the intracellular environment (e.g., within a lysosome or endosome or caveolea). The linker can be, e.g., a peptidyl linker that is cleaved by an intracellular peptidase or protease enzyme, including a lysosomal or endosomal protease. Cleaving agents can include cathepsins B and D and plasmin (see, e.g., Dubowchik and Walker, 1999, Pharm. Therapeutics 83:67-123). Most typical are peptidyl linkers that are cleavable by enzymes that are present in AQP3 expressing cells. For example, a peptidyl linker that is cleavable by the thiol-dependent protease cathepsin-B, which is highly expressed in cancerous tissue, can be used (e.g., a linker comprising a Phe-Leu or a Val-Cit peptide). The linker can also be a carbohydrate linker, including a sugar linker that is cleaved by an intracellular glycosidase (e.g., a glucuronide linker cleavable by a glucuronidase).

[0189] The linker also can be a non-cleavable linker, such as an maleimido-alkylene- or maleimide-aryl linker that is directly attached to the therapeutic agent and released by proteolytic degradation of the antibody.

[0190] The anti AQP3 antibody can be conjugated to the linker via a heteroatom of the antibody. These heteroatoms can be present on the antibody in its natural state or can be introduced into the antibody. In some aspects, the anti AQP3 antibody will be conjugated to the linker via a nitrogen atom of a lysine residue. In other aspects, the anti AQP3 antibody will be conjugated to the linker via a sulfur atom of a cysteine residue. The cysteine residue can be naturally-occurring or one that is engineered into the antibody. Methods of conjugating linkers and drug-linkers to antibodies via lysine and cysteine residues are known in the art.

[0191] Exemplary antibody-drug conjugates include auristatin based antibody-drug conjugates (i.e., the drug component is an auristatin drug). Auristatins bind tubulin, have been shown to interfere with microtubule dynamics and nuclear and cellular division, and have anticancer activity. Typically the auristatin based antibody-drug conjugate comprises a linker between the auristatin drug and the anti AQP3 antibody. The linker can be, for example, a cleavable linker (e.g., a peptidyl linker, a carbohydrate linker) or a non-cleavable linker (e.g., linker released by degradation of the antibody). Auristatins include MMAF, and MMAE. The synthesis and structure of exemplary auristatins are described in U.S. Pat. Nos. 7,659,241, 7,498,298, 2009-0111756, 2009-0018086, and U.S. Pat. No. 7,968,687.

[0192] Other exemplary antibody-drug conjugates include maytansinoid antibody-drug conjugates (i.e., the drug component is a maytansinoid drug), and benzodiazepine antibody drug conjugates (i.e., the drug component is a benzodiazepine (e.g., pyrrolo[I,4]benzodiazepine dimers (PBD dimer), indolinobenzodiazepine dimers, and oxazolidinobenzodiazepine dimers)).

[0193] (16) Kits Obtained by Including a Composition Containing an Anti AQP3 Antibody or Functional Fragment Thereof

[0194] As described in above (12) to (14), by using an anti AQP3 antibody or a functional fragment thereof of the present invention, a reagent for detecting AQP3, a reagent for identification, separation, or purification of AQP3-expressing cells, and a reagent for measuring an expression amount of AQP3 can be prepared. In accordance with respective purpose, those reagents can be used for forming a kit, together with an additional component. The kit is suitably combined with constitutional elements such as AQP3 or a fragment thereof as a positive control, AQP3 with known concentration as a standard material, a secondary antibody, an enzyme substrate, a co-factor, an assistant component, a non-specific protein sample as a negative control, a buffer solution, a preservative, a diluent, a user guide book, or the like. A buffer solution for blocking or washing can be also added as a suitable constitutional element of the kit.

[0195] (17) Compositions Containing an Inhibitory Anti AQP3 mAb or Functional Fragment Thereof and Compositions as AQP3 Inhibitors

[0196] An anti AQP3 antibody, a functional fragment thereof, or ADC of the present invention specifically recognizes and binds to the extracellular domain of AQP3, in particular, the epitope in loop C in some embodiments. As it is specifically described in the examples given below, an anti AQP3 mAb of the present invention which binds to the epitope can inhibit at least one function of AQP3 such as the channel function (for example, hydrogen peroxide permeating property) of AQP3 or function of promoting cell proliferation of AQP3 in AQP3-expressing cells. Namely, an anti AQP3 antibody of the present invention can be regarded as an inhibitory anti AQP3 antibody. As such, it is possible to provide a composition which contains an inhibitory anti AQP3 mAb of the present invention or a functional fragment thereof. Furthermore, this composition can be used as an AQP3 inhibitor.

[0197] (18) Compositions for Treatment of Cancer

[0198] An increased expression level of AQP3 is confirmed in each of skin cancer, colorectal cancer, cervical cancer, liver cancer, lung cancer, esophageal cancer, kidney cancer, stomach cancer, tongue cancer, and the like. Furthermore, as it is described in the examples given below, proliferation of human cancer cell lines, in which AQP3 is expressed, can be inhibited. Accordingly, a composition containing an inhibitory anti AQP3 mAb of the present invention or a functional fragment thereof, an ADC of the present invention, or an AQP3 inhibitor can be used as a composition for treating any one of the above cancers. Furthermore, as it has been suggested that the function of AQP3 is associated with a progress level of cancer, tumor angiogenesis, infiltration property, metastasis, and energy metabolism of cancer tissues, or the like, the composition for treating cancer can be also regarded as a composition for inhibiting cancer proliferation, a composition for inhibiting angiogenesis in cancer, a composition for inhibiting cancer infiltration, and/or a composition for inhibiting/preventing cancer metastasis.

[0199] A composition for treating cancer of the present invention can be prepared in a formulation such as a solution for injection or the like. Basically, such a composition for treating cancer can be systemically administered by injection or dropwise addition. However, in a case in which it is used for the purpose of treating cancer or preventing metastasis or the like, topical administration can be also carried out. Those preparations can be prepared by known methods. When it is prepared in a preparation for injection, for example, production can be carried out by dissolving or diluting an inhibitory anti AQP3 mAb of the present invention or a functional fragment thereof, or an ADC of the present invention, which has been aseptically preserved, in water, physiological saline, or buffer solution for injection.

[0200] An effective dose of an inhibitory anti AQP3 mAb of the present invention or a functional fragment thereof or an ADC of the present invention, which becomes an effective ingredient of the treatment composition of the present invention, suitably varies depending on various conditions including a state, a symptom, or the like of a patient. In general, a single dose is determined within a range of 0.1 to 10 mg of anti AQP3 mAb/kg of body weight, and it is administered by subcutaneous injection, intravenous injection, intraperitoneal injection, or the like. The administration interval also suitably varies depending on various conditions including a state, a symptom, or the like of a patient. In general, the administration is made once for 1 to 4 weeks, but it is also possible that, after having several weekly administrations, no administration is made for a certain period, or, after one to several initial administrations, administration can be continued at the same pace while the dose is cut down to half or the like.

[0201] (19) Compositions for Preventing and/or Treating Skin Disorders

[0202] A composition containing an inhibitory anti AQP3 mAb of the present invention or a functional fragment thereof or the AQP3 inhibitor can be used, based on a mechanism of inhibiting the function of AQP3 in cells of skin tissues like keratinocyte, as a composition for preventing and/or treating a skin disorder. Specific examples of the skin disorder include psoriasis, actinic keratosis, ichthyosis, and seborrheic dermatitis. Other than that, for curing or ameliorating keratinocyte proliferative skin abnormality, a composition containing an inhibitory anti AQP3 mAb of the present invention or a functional fragment thereof or a composition for treatment of the present invention which is obtained by containing an AQP3 inhibitor can be used.

[0203] (20) Compositions for Preventing and/or Treating Inflammatory Disorders

[0204] A composition containing an inhibitory anti AQP3 mAb of the present invention or a functional fragment thereof or an AQP3 inhibitor can be used, based on a mechanism of reducing an inflammatory response according to inhibition of the function of AQP3, as a composition for preventing and/or treating an inflammatory disorder. Specific examples of the inflammatory disorder include atopic dermatitis, psoriasis, asthma, and chronic obstructive lung disease, and hepatitis. Examples of the hepatitis include acute hepatitis and acute liver disorder. Other than that, for preventing, curing, or ameliorating an inflammatory disorder accompanying increased expression of AQP3, a composition containing an inhibitory anti AQP3 mAb of the present invention or a functional fragment thereof or a composition for preventing and/or treating an inflammatory disorder obtained by containing the AQP3 inhibitor can be used.

[0205] (21) Compositions for Alleviating Abnormality in Bowel Movement

[0206] It is widely known that AQP3 is expressed in intestinal epithelial cells, and it is suggested that the expression level of AQP3 has an influence on the transport amount of moisture inside and outside an intestine. Specifically, it is suggested that the reduced expression level of AQP3 can cause diarrhea by increasing the moisture inside an intestine, while the increased expression level of AQP3 can cause constipation by reducing the moisture inside an intestine. As such, a composition containing an inhibitory anti AQP3 mAb of the present invention or a functional fragment thereof or an AQP3 inhibitor can be used, based on a mechanism of inhibiting the function of AQP3, as a composition for alleviating an abnormality in bowel movement, in particular, as a composition for alleviating constipation. The composition may be prepared and used in the form of an enteric tablet or a suppository, for example. The enteric tablet or suppository can be suitably prepared by a known method. It is not necessary to carry out the administration continuously or periodically, and it can be carried out with a suitable interval depending on a change in symptoms or the like.

[0207] (22) Preparation of Compositions for Preventing and/or Treating Skin Disorders or Inflammatory Disorders of the Present Invention

[0208] An inhibitory anti AQP mAb of the present invention or a functional fragment thereof can be provided as, together with a pharmaceutically acceptable carrier or the like, a composition for prevention and/or treatment. Also for a case in which a skin disorder or an inflammatory disorder is a subject, it can be basically and suitably prepared as a pharmaceutical composition (composition for prevention and/or treatment) like the composition for treating cancer that is described in above (18). The pharmaceutical composition can have a formulation like injection solution or the like. It may also have the form like aqueous solution, suspension, or emulsion. The pharmaceutical composition may contain a pharmaceutically acceptable diluent, aid, carrier, or the like including salts, buffering agents, adjuvants, or the like. Those preparations can be prepared by known methods. When it is produced in the form of a preparation for injection, the production can be made by dissolving or diluting a dried product or a preserved solution of the inhibitory anti AQP mAb or a functional fragment thereof, which has been aseptically preserved, with physiological saline or a buffer solution for subcutaneous injection or intravenous injection. Alternatively, it is also possible to enhance the water solubility by encapsulating the inhibitory anti AQP mAb or a functional fragment thereof by cyclodextrins.

[0209] (23) Assistant Components for Compositions for Preventing and/or Treating Skin Disorders or Inflammatory Disorders of the Present Invention

[0210] A composition containing an inhibitory anti AQP3 mAb of the present invention or a functional fragment thereof, or a composition for prevention or treatment containing an inhibitory anti AQP3 mAb may have a possibility of developing aggregation or precipitation of the anti AQP3 mAb or a functional fragment thereof, as it is often presented as a problem when other antibody preparations are developed while the preparation is a liquid preparation and concentration of the effective ingredient is high or the like. For the purpose of preventing the aggregation or precipitation, one or more than one assistant components may be included in the composition. Examples of the assistant components include saccharides such as monosaccharides, disaccharides, or oligosaccharides, sugar alcohols, salts, and surfactants. More specific examples thereof include sucrose, sodium chloride, and polyoxyethylene sorbitan monolaurate.

[0211] (24) Administration Forms of Compositions for Preventing and/or Treating Skin Disorders or Inflammatory Disorders of the Present Invention

[0212] An effective dose of an inhibitory anti AQP mAb or a functional fragment thereof, which becomes an effective ingredient of a composition for prevention and/or treatment of the present invention, suitably varies depending on various conditions including a state, a symptom, or the like of a patient. The administration dose suitably varies depending on various conditions including a state, a symptom, or the like of a patient. However, the dose as exemplified in the above (18) can be set, for example. The administration interval can be also set similar to the example of the above (18), but it is not necessary to carry out the administration continuously or periodically, and it can be carried out with a suitable interval depending on a change in symptoms or the like. It is needless to say that plural administrations would not be necessary if healing or remission is achieved by single administration. When there is recurrence or worsening of symptoms, the administration can be initiated again.

[0213] The administration period can be suitably adjusted depending on a disease condition of a patient. Although the administration dose during the administration period can be suitably adjusted, it is preferable that a constant amount is continuously administered or it is preferable to have administration form in which, after administration of relatively high dose only at initial administration stage, a shift to constant administration of less amount for maintenance is made.

EXAMPLES

[0214] Hereinbelow, the present invention is more specifically described by Examples, but the present invention is not limited by those examples at all.

Example 1: Sequence Determination of Oligopeptide Used as Immunogen

[0215] To obtain an anti AQP3 antibody which specifically recognizes the extracellular domain of AQP3, the inventors of the present invention conducted multiple computer modeling studies on the structure of AQP3, in particular, the structure of loop A, loop C, and loop E constituting the extracellular domain, and, as a result, selected as an immunogen a fragment (oligopeptide) composed of the amino acid sequence of SEQ ID NO: 1, which constitutes a part of loop C (extracellular second loop). The amino acid sequence of SEQ ID NO: 1 is a sequence which corresponds to positions 148 to 157 of the human AQP3 polypeptide, and it is composed of ten amino acid residues at the C-terminal side of loop C that are adjacent to the boundary to the transmembrane domain IV.

Example 2: Immunization and Selection of Antibody

[0216] The oligopeptide composed of the amino acid sequence of SEQ ID NO: 1 was produced as a synthetic peptide. Furthermore, cells which overexpress the AQP3 polypeptide including that amino acid sequence (AQP3-overexpressing cells) were separately produced. Then, the synthetic peptide was combined with AQP3-overexpressing cells, and used as an immunogen.

[0217] A suspension of the above immunogen was immunized together with an adjuvant into the abdominal cavity of a mouse of the C57BL/6 line. After that, immune cells were collected from the immunized mouse and the antibody gene phage library was constructed. The phage library was introduced to CHO-K1 cells, and the recombinant antibodies were displayed in the cell membrane of the transformed CHO-K1 cells. Initial patterning was also carried out by using the transformed cells and the synthetic peptide, and patterning using AQP3-solubilizing protein was carried out subsequently. Using several screenings, AQP3-binding colonies were selected. Finally, clones having AQP3-specific binding activity were immunoglobulized (IgG) to obtain ten clones and ten anti AQP3 mAb (antibodies A, B, C, D, E, F, G, H, J, and K) that are derived from those 10 clones.

[0218] Meanwhile, when the oligopeptide derived from loop E was used as an immunogen, a clone exhibiting a significant binding activity for AQP3 was not obtained.

Example 3: Binding Property of Anti AQP3 Antibodies to AQP3

[0219] A. Antibody Binding to Immunogen Peptide

[0220] Binding of antibodies A, B, C, D, E, F, G, H, J, and K to the peptide used for immunization (SEQ ID NO:1) was tested in an ELISA assay. Results are shown in FIG. 2. Antibodies B, C, E, G, H, J, and K were observed to bind the peptide. Antibodies A, D, and F, in contrast to the other antibodies, did not strongly bind the peptide in this assay. Thus, antibodies A, D, and F may therefore bind to AQP3 at a different epitope.

[0221] B. Antibody Binding to AQP3 Containing Cell Lysate Measured by ELISA

[0222] Cell lysate from HEK293T cells overexpressing mouse AQP3 and a myc-biotinylated tag was used in an ELISA assay to measure the binding of antibodies A, B, C, D, E, F, G, H, J, and K to AQP3. Cell lysate from HEK293T cells overexpressing the myc-biotinylated tag but not AQP3 was used as control. Results are shown in FIG. 3. Each of antibodies A, B, C, D, E, F, G, H, J, and K showed binding to AQP3.

[0223] C. Antibody Binding to AQP3 Expressing Cells

[0224] By using mouse epithelial cells (PAM212), mouse macrophage cells, human epithelial cells (HaCaT), and HEK293 cells as AQP3-expressing cells, the binding properties of the anti AQP3 antibodies A, B, C, D, E, F, G, H, J, and K to cells were measured.

[0225] PAM212 and macrophage cells were reacted with each anti AQP3 antibody (0.1, 1, or 10 μg/mL) at 4° C. for 1 hour. After washing the cells, a fluorescent-labeled anti mouse secondary antibody was added and the reaction was allowed to occur additionally for 1 hour (4° C.). By measuring the fluorescence intensity, the binding property of each anti AQP3 antibody to cells was obtained.

[0226] The result obtained by using the mouse macrophage cells and antibody J is shown in FIG. 4.

[0227] The testing was also carried out using solvent (Veh) or a non-specific IgG (IgG) controls. In FIG. 4, the vertical axis represents fluorescence intensity, and the mean fluorescence intensity of each sample is represented by bar height together with standard error. From all cases in which antibody J was used at any concentration of 0.1, 1, and 10 μg/mL, significantly increased fluorescence intensity was recognized compared to the controls (Veh and IgG) (in the drawing, ** represents the presence of a significant difference of P<0.01). It was found that antibody J specifically recognizes the mouse AQP3 on cell surface so that antibody J and mouse macrophage cells bind to each other.

[0228] The result obtained by using PAM212 cells, which are mouse epithelial cells, and antibody J is shown in FIG. 5A.

[0229] The testing was also carried out using solvent (Veh) or a non-specific IgG (IgG) controls. In FIG. 5A, the vertical axis represents fluorescence intensity, and the mean fluorescence intensity of each sample is represented by bar height together with standard error. From all cases in which antibody J was used at any concentration of 0.1, 1, and 10 μg/mL, significantly increased fluorescence intensity was recognized compared to the controls (Veh and IgG) (in the drawing, ** represents the presence of a significant difference of P<0.01). It was found that antibody J specifically recognizes the mouse AQP3 on cell surface so that antibody J and PAM212 cells bind to each other.

[0230] The assay was also performed using PAM212 cells and antibodies A, B, C, D, E, F, G, H, and J at a concentration of 10 μg/mL. Results are shown in FIG. 5B. Binding of antibodies C, D, E, G, and J to PAM212 cells was statistically significant.

The assay was also performed using HaCaT cells and antibodies A, B, C, D, E, F, G, H, and J at a concentration of 10 μg/mL. Results are shown in FIG. 5C. Binding of antibodies C, D, E, H, and J to HaCaT cells was statistically significant. The results obtained by performing a FACS assay using HaCaT, which are human epithelial cells, and antibody G, antibody H, or antibody J are shown in FIG. 6A-6C, respectively.
HaCaT cells were treated with Cell Dissociation Buffer for 30 minutes at 37° C., and then dislodged and collected. Then, the cells were reacted with 10 μg/mL anti AQP3 antibody at 4° C. for 1 hour. After washing the cells, a fluorescent-labeled anti mouse secondary antibody was added and the reaction was allowed to occur additionally for 1 hour (4° C.). Then, by using a flow cytometer, fluorescence intensity was measured (FIG. 6A to FIG. 6C). FIG. 6A represents the result of a case in which antibody G was used, FIG. 6B represents the result of a case in which antibody H was used, and FIG. 6C represents the result of a case in which antibody J was used. Each panel shows a histogram in which the horizontal axis represents fluorescence intensity and the vertical axis represents the cell number distribution when the mode value is set at 100. The histogram expressed with bold line represents a case in which the anti AQP3 antibody was used while the histogram expressed with thin gray line represents a case as a control in which the anti AQP3 antibody was not used (addition of non-specific IgG). In the drawing, the range represented by a horizontal bar indicates the fluorescence intensity that is exhibited by the AQP3 antibody positive cell group. Ratio (%) of the cells included in this range (=cells showing positive staining by anti AQP3 antibody) is also shown in the drawing.

[0231] From all cases in which any of antibody G, antibody H, and antibody J was used, a clear increase in fluorescence intensity was recognized compared to the control, and thus it was found that the anti AQP3 antibodies have a binding activity for human AQP3 on cell surface.

[0232] A FACS assay was also performed using HEK293 cells stably overexpressing mouse AQP3. Cells were incubated with antibody E, H, J, or negative control IgG at a concentration of 10 μg/mL for one hour and then sorted by FACS. Separately, HEK293 cells stably overexpressing human AQP3 were incubated with antibody E at a concentration of 10 μg/mL for one hour and then sorted by FACS. The results are shown in FIGS. 6D-6H. Each of antibodies E, H, and J were found to bind to AQP3 overexpressed on surface of HEK293 cells.

[0233] From the above, several anti AQP3 antibodies of the present invention were found to bind to the mouse macrophage cells, mouse epithelial cells (PAM212 cells), and human epithelial cells (HaCaT cells).

Example 4: Immunostaining

[0234] By using mouse macrophage cells as AQP3-expressing cells, an immunohistochemistry analysis was made to see whether or not anti AQP3 antibodies can be used for immunostaining.

[0235] Blocking was carried out for a plate adhered with mouse macrophage cells, and then a reaction with 10 μg/mL anti AQP3 antibody was carried out for 1 hour at 4° C. After washing the cells, a fluorescent-labeled anti mouse secondary antibody was added and the reaction was allowed to occur additionally for 1 hour (4° C.). As a control, a test not using the anti AQP3 antibody was also carried out. Furthermore, to have a clear location of cell nucleus, staining using DAPI was also carried out. Observation of the fluorescence staining was carried out by a confocal fluorescence microscope. The result obtained by using antibody H and antibody J is shown in FIG. 7A, together with the result of the control having no antibody. In FIG. 7A, the left panel shows an observation image of a case in which there was no antibody (anti AQP3 antibody was not present, only secondary antibody was present), the center panel shows an observation image of a case in which antibody H was used, and the right panel shows an observation image of a case in which antibody J was used. From all panels, a signal derived from DAPI with a dot-like shape showing the location of cell nucleus was recognized. Meanwhile, when antibody H or antibody J was used, a signal which appears to wrap around the edge of cell shape by enclosing the dot-like shape signal resulting from DAPI staining was also recognized. However, when the antibody was not present, a signal which appears to enclose the dot-like shape signal resulting from DAPI staining was not recognized at all.

[0236] Only a faint signal was observed when the immunostaining was performed using antibody J and mouse macrophage cells from AQP3 knock-out mice (Ma et al., 2000, PNAS, 97(8):4386-4391), showing that antibody J specifically binds to AQP3 expressing macrophage cells (FIG. 7B).

[0237] From the above, it was shown that the tested anti AQP3 antibodies of the present invention are antibodies which can be used for an immunohistochemistry analysis.

Example 5: Activity of Inhibiting Cell Proliferation

[0238] By using mouse epithelial cells (PAM212), mouse macrophage as mouse AQP3-expressing cells, human epithelial cells (HaCaT), or human epithelioid carcinoma cells (A431), the activity of inhibiting cell proliferation by an anti AQP3 antibody was measured.

[0239] Each of PAM212, HaCaT, and A431 were suspended in DMEM medium containing 1% FBS and seeded on a 96-well plate (5,000 cells/well). On the day after the seeding, DMEM medium containing anti AQP3 antibody (0.1, 1, or 10 μg/mL) was added and culture was continued for additional 2 days. The cell number was compared by using a reagent for measuring living cells (Nacalai Tesque Inc.) and measuring absorbance at 450 nm.

[0240] FIG. 8A and FIG. 8B represent a result obtained from a case in which PAM212 AQP3-expressing cells were used. The result obtained by using antibody G or antibody J is shown in FIG. 8A, together with the result of testing non-specific IgG as a control (non-specific IgG was added at 10 μg/mL; Control). In FIG. 8A, the vertical axis shows the absorbance at 450 nm, and the absorbance level was expressed by bar height, together with standard error (same for FIG. 8B, FIG. 9, and FIG. 10). The asterisk (*) in the drawing indicates that there is a significant difference of P<0.01 compared to the control. When antibody G or antibody J (10 μg/mL) was used, a significant inhibitory activity for PAM212 cell proliferation was observed.

[0241] Concentration-dependent effect of the anti AQP3 antibody J on the inhibitory activity for PAM212 cell proliferation was analyzed and is shown in FIG. 8B. Number of the living cells when antibody J was used at 0.1, 1, or 10 μg/mL is shown in FIG. 8B, together with the result of a non-specific IgG as a control (non-specific IgG was added at 10 μg/mL; Ct). The inhibitory activity for cell proliferation was increased by antibody J in a concentration-dependent manner. In FIG. 8B, the asterisk (*) described for the case in which in antibody J was used at 1 and 10 μg/mL indicates that there is a significant difference of P<0.01 compared to the control.

[0242] FIG. 8C. shows the effect of antibodies A, B, C, D, E, F, G, H, J, and a negative control IgG antibody at a concentration of 10 μg/mL on PAM212 cell growth. At the tested concentration, antibodies B, C, E, and J significantly inhibited cell growth.

[0243] FIG. 9 represents a result obtained from a case in which HaCaT cells were used as a material of human AQP3-expressing cells. The result obtained by using antibody G, antibody H, or antibody J is shown in FIG. 9, together with the result of testing a non-specific IgG as a control (non-specific IgG was added at 10 μg/mL; Control). In FIG. 9, the asterisks (*) and (**) indicate that there is a significant difference of P<0.05 or P<0.01, respectively, compared to the control. When antibody G, antibody H, or antibody J were used (10 μg/mL), a significant inhibitory activity for HaCaT cell proliferation was shown.

[0244] FIG. 10 represents a result obtained from a case in which A431 cells were used as a material of human AQP3-expressing cells. The result obtained by using antibody G, antibody H, or antibody J is shown in FIG. 10, together with the result of testing a non-specific IgG as a control (non-specific IgG was added at 10 μg/mL; Control). In

[0245] FIG. 10, the asterisk (*) indicates that there is a significant difference of P<0.05 compared to the control. When antibody G, antibody H, or antibody J was used (10 μg/mL), a significant inhibitory activity for A431 cell proliferation was observed. Because A431 cells are a human squamous epithelial carcinoma cell line, the effect of inhibiting proliferation into AQP3-expressing cancer cells by the anti AQP3 antibodies was exhibited.

[0246] From the above, it was clearly shown that, at least with antibody G, antibody H, and antibody J among the anti AQP3 antibodies of the present invention, the significant inhibitory activity on the cell proliferation in AQP3-expressing cells including cancer cells is exhibited when co-culture of the anti AQP3 antibody and AQP3-expressing cells is carried out.

Example 6: Activity of Inhibiting Hydrogen Peroxide Permeation

[0247] By using mouse macrophage as mouse AQP3-expressing cells, an activity of inhibiting the hydrogen peroxide permeation property (incorporating property) by an anti AQP3 antibody was measured.

[0248] Mouse macrophages were suspended in DMEM medium containing 1% FBS and seeded on a 96-well plate (10,000 cells/well). On the day after the seeding, DMEM medium containing antibody J (10 μg/mL) as an anti AQP3 antibody or 10 μg/mL control IgG antibody (Ct-IgG: IgG antibody not having specific binding property to AQP3) was added and co-culture was additionally continued overnight. To the culture, hydrogen peroxide (100 μM) or lipopolysaccharide (LPS) (300 ng/mL) was added, and the amount of reactive oxygen species (ROS) in the cells was measured. The ROS amount in the cells was evaluated by, after staining the cells by adding CM-H.sub.2DCFDA reagent (Invitrogen, 50 μM, for 20 minutes), measuring the fluorescence intensity derived from CM2DCF before and after the addition. If hydrogen peroxide as one kind of ROS permeates into the cell, it is possible to perform a measurement in which increased fluorescence intensity is taken as an indicator of an increased ROS amount in cells. Addition of LPS has a function of increasing artificially the ROS amount in cells.

[0249] FIG. 11 shows the fluorescence intensity derived from CM2DCF when antibody J was added to a co-culture system (Ab) or a solvent was added to a co-culture system (Veh), for a case in which hydrogen peroxide was added (H.sub.2O.sub.2), a case in which lipopolysaccharide was added (LPS), or a case in which both H.sub.2O.sub.2 and LPS were not added (Ct) to the co-culture system. The vertical axis represents a relative value of the fluorescence intensity. A case of applying a solvent to the cells which have been added with Ct-IgG antibody (left bars in the drawing) is set at 100%, and the relative fluorescence intensity at each condition is represented by bar height, together with standard error. In the drawing, the asterisk (**) indicates that there is a significant difference of P<0.01 among the comparisons, and it is clearly shown that, when hydrogen peroxide was added or LPS was added, the ROS amount in cells significantly increased compared to Veh group added with a solvent, and, at any conditions of adding hydrogen peroxide or adding LPS, if antibody J was present during the co-culture, the ROS amount in cells significantly decreased compared to a case in which antibody J was absent.

[0250] FIG. 12 shows the results of an H.sub.2O.sub.2 transport assay performed using antibodies A, B, C, D, E, F, G, H, and J.

[0251] Antibodies C, D, E, H, and J have an activity of significantly suppressing the incorporation of hydrogen peroxide to the inside of AQP3-expressing cells.

Example 7: Cell Signal Inhibitory Activity

[0252] It is known that, in mouse macrophage, p65/NFκB is phosphorylated and activated in accordance with the stimulation by LPS. To determine whether or not the cell signal responding to LPS is inhibited by an anti AQP3 antibody in mouse macrophage, which is a mouse AQP3-expressing cell, a test was carried out.

[0253] Mouse macrophages were suspended in DMEM medium containing 1% FBS and seeded on a 60 mm dish (2×10.sup.6 cells/dish). On the day after the seeding, DMEM medium containing antibody J (10 μg/mL) as an anti AQP3 antibody or 10 μg/mL control IgG antibody (non-specific IgG antibody) was added and co-culture was additionally continued overnight (in FIG. 13 showing the result, the former condition was described as “anti-AQP3 +”, while the latter condition was described as “anti-AQP3−”). Each cultured product under both conditions was subjected to a treatment with LPS (100 ng/mL, for 1 hour) or a no treatment with LPS (in FIG. 13 showing the result, the former condition was described as “LPS +”, while the latter condition was described as “LPS −”). According to the addition/no addition of the anti AQP3 antibody and the treatment/no treatment with LPS, four treatment groups were created with the mouse macrophage as a sample. From each cell of the four treatment groups, proteins were extracted, and phosphorylation state of p65/NFκB was determined by immunoblotting for each group. FIG. 13 shows the result of carrying out immunoblotting by using an antibody which is specific to each of non-phosphorylated p65 (p65) and phosphorylated p65 (P-p65).

While phosphorylated p65 was strongly induced by LPS treatment at the condition of “anti-AQP3 −” (compare the top panel signals of the left most column with the second column from the right side), at the condition “anti-AQP3+” in which an anti AQP3 antibody was present, induction of phosphorylated p65 (P-p65) by LPS treatment was inhibited (compare the top panel signals of the second column from the left side with the right most column, and, for comparison between conditions regarding LPS addition, compare the top panel signals of the two right columns).

[0254] For the intracellular signal in which LPS-induced p65/NFκB is involved with the phosphorylation and activation in AQP3-expressing cells, antibody J has an inhibitory activity.

Example 8: Inhibitory Activity on Liver Disorder (Acute Hepatitis and Acute Liver Disorder)

[0255] A test was carried out to determine in an animal subject the anti-inflammatory activity of an anti AQP3 antibody of the present invention (inflammation inhibiting activity and disorder inhibiting activity).

[0256] A mouse was used as a test material. The mouse was administered intravenously with an anti AQP3 antibody (antibody J) (5 μg/g of body weight). On the day after the administration, carbon tetrachloride (CCl.sub.4), which is a chemical for inducing a liver disorder (acute hepatitis and acute liver disorder), was administered (0.5 μL/g of body weight). 24 Hours after administering the carbon tetrachloride, blood serum and a liver RNA sample were collected. Blood serum AST value, blood serum ALT value, accumulation level of liver TNF-α mRNA, and accumulation level of liver IL-6 mRNA, as an indicator of the degree of the liver disorder, were evaluated. The analysis results using the blood sample and the analysis using the liver RNA sample are shown in FIG. 14 and FIG. 15, respectively.

[0257] FIG. 14A shows the analysis result of blood serum AST level. In the drawing, the vertical axis represents the AST level [IU/L], each spot represented by “o” shows an individual measurement value, and the horizontal bar indicates a median value. Ct means a control that has not been subjected to a treatment with carbon tetrachloride. In the carbon tetrachloride treatment group (CCl.sub.4), Ab represents a group which has been treated in advance with an anti AQP3 antibody (antibody J) and Veh represents a group which has not been treated with an anti AQP3 antibody. In the drawing, the asterisk (*) indicates that there is a significant difference of p<0.01 between the carbon tetrachloride treatment group (both of Veh group and Ab group) and the control group (Ct), and also there is a significant difference of p<0.01 between Veh group and Ab group within the carbon tetrachloride treatment group.

[0258] FIG. 14B shows the analysis result of blood serum ALT level. In the drawing, the vertical axis represents the ALT level [IU/L], each spot represented by “o” shows an individual measurement value, and the horizontal bar indicates a median value. Ct means a control that has not been subjected to a treatment with carbon tetrachloride. In the carbon tetrachloride treatment group (CCl.sub.4), Ab represents a group which has been treated in advance with an anti AQP3 antibody (antibody J) and Veh represents a group which has not been treated with an anti AQP3 antibody. In the drawing, the asterisk (*) indicates that there is a significant difference of p<0.01 between the carbon tetrachloride treatment group (both of Veh group and Ab group) and the control group (Ct), and also there is a significant difference of p<0.01 between Veh group and Ab group within the carbon tetrachloride treatment group.

[0259] It is widely known that both the blood serum AST value and blood serum ALT value can be an indicator of a liver disorder (acute hepatitis and acute liver disorder). From the above test results, it is understood that, in a mouse which has been treated in advance with an anti AQP3 antibody of the present invention, a liver disorder and/or liver inflammation reaction that is caused later by carbon tetrachloride can be prevented or inhibited.

[0260] FIG. 15A shows the analysis result of accumulation level of TNF-α mRNA in a liver homogenates. In the drawing, the vertical axis represents the TNF-α expression level, which was obtained by dividing the accumulation level of TNF-α mRNA by 18s rRNA level as a control. In the drawing, TNF-α expression level is shown by bar height together with standard error. Ct means a control that has not been subjected to a treatment with carbon tetrachloride. In the carbon tetrachloride treatment group (CCl.sub.4), Ab represents a group which has been treated in advance with an anti AQP3 antibody (antibody J) and Veh represents a group which has not been treated with an anti AQP3 antibody. In the drawing, the asterisk (*) indicates that there is a significant difference of p<0.01 between Veh group and the control group (Ct), and also between Veh group and Ab group.

[0261] FIG. 15B shows the analysis result of accumulation level of IL-6 mRNA in a liver homogenates. In the drawing, the vertical axis represents the IL-6 expression level, which was obtained by dividing the accumulation level of IL-6 mRNA by 18s rRNA level as a control. In the drawing, IL-6 expression level is shown by bar height together with standard error. Ct means a control that has not been subjected to a treatment with carbon tetrachloride. In the carbon tetrachloride treatment group (CCl.sub.4), Ab represents a group which has been treated in advance with an anti AQP3 antibody (antibody J) and Veh represents a group which has not been treated with an anti AQP3 antibody. In the drawing, the asterisk (*) indicates that there is a significant difference of p<0.01 between Veh group and the control group (Ct), and also between Veh group and Ab group.

[0262] It is widely known that expression of TNF-α or IL-6 in liver is an indicator of a liver disorder (acute hepatitis and acute liver disorder). From the above test results, it is understood that, in a mouse which has been treated in advance with an anti AQP3 antibody of the present invention, a liver disorder and/or liver inflammation reaction that is caused later by carbon tetrachloride can be prevented or inhibited.

[0263] For a case of an individual animal which may have a liver disorder (acute hepatitis and acute liver disorder), an occurrence of liver disorder or inflammatory response can be prevented or inhibited by an anti AQP3 antibody of the present invention.

Example 9: Sequence Analysis of Anti AQP3 Antibody

[0264] Among ten anti AQP3 antibodies (antibodies A, B, C, D, E, F, G, H, J, and K) derived from 10 clones, which have been obtained in the examples of the present invention, the amino acid sequence of the heavy chain and light chain was determined for each antibody. The heavy chain and light chain sequences (without the predicted signal sequences, which are the same for antibodies A, B, C, D, E, F, G, H, J, and K, and which are discussed below with respect to antibodies F, H, and J) are shown in Table 6.

TABLE-US-00032 TABLE 6 Heavy Chain (HC) and Light Chain (LC) Sequences SEQ ID Description Sequence NO: Antibody A QVQLQQPGAELVRPGASVTLSCKASGYTFTDYEMHWVKQTPV 449 HC HGLEWIGGVDPETGGTGYNQKFRGKAILTADKSSSTAYMELR SLTSEDSAVYYCARHGGSFYAMDYWGQGTSVTVSSAKTTAPS VYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSG VHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASST KVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDV LMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTH REDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIER TISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPED IYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWV ERNSYSCSVVHEGLHNHHTTKSFSRTPGK Antibody A DIVMTQSPKFMSTSVGDRVSITCKASQDVSTAVAWYQQKPGQ 450 LC SPKLLIYWASTRHTGVPDRFTGSGSGTDYTLTISSVQAEDLA LYYCQQHYSTPPTFGGGTKLELKRADAAPTVSIFPPSSEQLT SGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDS KDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFN RNEC Antibody B EVQLVESGGDLVKPGGSLKLSCAASGFTFSSYGMSWVRQTPD 451 HC KRLEWVATISRGSIYTYYPDSVKGRFTISRDNAKNTLYLQMS SLKSEDTAMYYCARLSLYDYDGARYTMDYWGQGTSVTVSSAK TTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSG SLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAH PASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPP KIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTA QTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLP APIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTD FMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVE KKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK Antibody B DTVMTQSPKFMSTSVGDRVSITCKASQDVGTAVAWYQQKPGQ 452 LC SPKLLIYWASTRHTGVPDRFTGSGSGTDFTLTTSNVQSEDLA DYFCQQYSSYHTFGAGTKLELKRADAAPTVSIFPPSSEQLTS GGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSK DSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR NEC Antibody C QVQLKQSGAELARPGASVKLSCKASGYNFKSYGISWVKQRTG 453 HC QGLEWIGEIYPGSGNTYYNEKLKGKATLTADKSSSTAYMELR SLTSEDSAVYFCARTYGYDSFPWFAYWGQGTLVTVSSAKTTA PSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLS SGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPAS STKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIK DVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQ THREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPI ERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMP EDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKN WVERNSYSCSVVHEGLHNHHTTKSFSRTPGK Antibody C DIVMTQAAPSVPVTPGESVSISCRSSKSLLHSNGNTYLYWFL 454 LC QRPGQSPQLLIYRVSNLASGVPDRFSGSGSGTAFTLRISRVE AEDEGVYYCMQHLEYPFTFGAGTKLEIKRADAAPTVSIFPPS SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSW TDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPI VKSFNRNEC Antibody D EVQLQQSGAELVRPGASVTLSCKASGYTFTDYEMHWVQQTPV 455 HC HGLEWIGGIDPETGGTGYNQKFKGKAILTADKSSSTAYMELR SLTSEDSAVYFCTRHGSYAMDYWGQGTSVTVSSAKTTAPSVY PLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVH TFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKV DKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLM ISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHRE DYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTI SKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIY VEWTNMGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVER NSYSCSVVHEGLHNHHTTKSFSRTPGK Antibody D DIVMTQSPKFMSTSVGDRVSITCKASQDVSTAVAWYQQKPGQ 456 LC SPKLLIYWASTRHTGVPDRFTGSGSGTDYTLTISSVQAEDLA LYYCQQHYSTPPTFGGGTRLEIKRADAAPTVSIFPPSSEQLT SGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDS KDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFN RNEC Antibody E EVKLLESGAELVRPGASVTLSCKASGYTFTDYEMHWVKQTPV 457 HC HGLEWIGGIDPESGGTGYNQKFKGKAILTADKSSSTAYMELR SLTSEDSAVYFCTRSGYYGSPLLDYWGQGTTLTVSSAKTTAP SVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSS GVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASS TKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKD VLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVKTAQTQT HREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIE RTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPE DIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNW VERNSYSCSVVHEGLHMHHTTKSFSRTPGK Antibody E QIVLSQSPAIMSASLGERVTMTCTASSSVSSSYLHWYQQKPG 458 LC SSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDA ATYYCHQYHRSPPTFGAGTKLEIKRADAAPTVSIFPPSSEQL TSGGASVVCFLNNFYPKDINVKWKIDGSERQMGVLNSWTDQD SKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSF NRNEC Antibody F QVQLKESGPELVKPGASVKISCKASGYTFTDYYINWVKQRPG 459 HC QGLEWIGWIFPGSGSTYYNEKFKGKATLTVDKSSSTAYMLLS SLTSEDSAVYFCADYGSSYRYFDVWGAGTTVTVSSAKTTAPS VYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSG VHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASST KVDKKIEPRGPTTKPCPPCKCPAPNLLGGPSVFTFPPKTKDV LMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTH REDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIER TISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPED IYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWV ERNSYSCSVVHEGLHNHHTTKSFSRTPGK Antibody F DIVMTQSPAILSASPGEKVTMTCRASSSVSYMHWYQQKPGSS 460 LC PKPWIYATSYLASGVPARFSGSGSGTSYSLTIGRVEAEDAAT YYCQQWSSNPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTS GGASVVCFLNKFYPKDINVKWKIDGSERQNGVLNSWTDQDSK DSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR NEC Antibody G QVQLKQSGAELVRPGASVTLSCKASGYTFTDYEMHWVKQTPV 461 HC HGLEWIGGIDPETGGTAYNQKFKGKAILTADKSSSTAYMELR SLTSEDSAVYYCTRWGAITSFVALRGFAYWGQGTLVTVSSAK TTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSG SLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAH PASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPP KIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTA QTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLP APTERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTD FMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVE KKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK Antibody G DTQMTQSPSSLSVSAGEKVTMSCKSSQSLLNSGNQKNYLAWY 462 LC QQKPGQPPKLLIYGASTRESGVPDRFTGSGSGTDFTLTTSSV QAEDLAVYYCQNDHSYPPTFGAGTKLELKRADAAPTVSIFPP SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNS WTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSP IVKSFNRNEC Antibody H EVKLVESGGDLVKPGGSLKLSCAASGFTFSSYGMSWVRQTPD 463 HC KRLEWVATISRRSIYTYYPDSVQGRFTISRDNAKNTLYLQMS SLKSEDTAMYYCARLSLYDYDGARYTMDYWGQGTSVTVSSAK TTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSG SLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAH PASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPP KIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTA QTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLP APIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTD FMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVE KKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK Antibody H DIKMTQSPKFMSTSVGDRVSITCKASQDVGTAVAWYQQKPGQ 464 LC SPKLLIYWASTRHTGVPDRFTGSGSGTDFTLTISNVQSEDLA DYFCQQYSSYHTFGAGTKLEIKRADAAPTVSIFPPSSEQLTS GGASVVCFLNNEYPKDINVKWKIDGSERQNGVLNSWTDQDSK DSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR NEC Antibody J QVHLQQSGTELVKPGASVKLSCEASGYTFTSYWMHWVKQRPG 465 HC QGLEWIGNINPSNGGTNYNEKFKSKATLTVDKSSSTAYMQLS SLTSEDSAVYYCARGGIYYGNYDYYAMDYWGQGTSVTVSSAK TTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSG SLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAH PASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPP KIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTA QTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLP APIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTD FMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVE KKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK Antibody J DIVMTQAAPSVPVTPGESVSISCRSSKSLLHSNGNTYLYWFL 466 LC QRPGQSPQLLIYRVSNLASGVPDRFSGSGSGTAFTLRISRVE AEDVGVYYCMQHLEYPFTFGGGTKLEIKRADAAPTVSIFPPS SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSW TDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPI VKSFNRNEC Antibody K QVQLKQSGAELVRPGTSVKVSCKASGYAFTNYLIEWVKQRPG 467 HC QGLEWIGVINPGSGGTNYNEKFKGKATLTADKSSSTAYMQLS SLTSEDSAVYFCARWGFYYAMDYWGQGTSVTVSSAKTTAPSV YPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGV HTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTK VDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVL MISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHR EDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERT ISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDI YVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVE RNSYSCSVVHEGLHNHHTTKSFSRTPGK Antibody K DIVMTQSPSSLSASLGERVSLTCRASQEISGYLSWLQQKPDG 468 LC TIKRLIYAASTLDSGVPKRFSGSRSGSDYSLTISSLESEDFA DYYCLQYASYPLTFGAGTKLEIKRADAAPTVSIFPPSSEQLT SGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDS KDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFN RNEC

[0265] Furthermore, by combining the determined amino acid sequence information with a known analytical technique, sequences of the variable region, CDR, and signal peptide included in each chain of the immunoglobulin molecule were determined.

(1) Antibody F

[0266] The heavy chain variable region of antibody F has the amino acid sequence that is represented by SEQ ID NO: 4.

[0267] When counting is made from the N-terminal side, the region composed of 19 amino acid residues starting from the methionine residue at position 6 to the serine residue at position 24 in the amino acid sequence is believed to be a signal peptide.

[0268] In this heavy chain variable region, CDR1 (IMGT definition) has an amino acid sequence of GYTFTDYY (SEQ ID NO: 10), CDR2 (IMGT definition) has an amino acid sequence of IFPGSGST (SEQ ID NO: 11), and CDR3 (IMGT definition) has an amino acid sequence of ADYGSSYRYFDV (SEQ ID NO: 12), respectively.

[0269] The light chain variable region of antibody F has the amino acid sequence that is represented by SEQ ID NO: 5.

[0270] When counting is made from the N-terminal side, the region composed of 20 amino acid residues starting from the methionine residue at position 6 to the glycine residue at position 25 in the amino acid sequence is believed to be a signal peptide.

[0271] In this light chain variable region, CDR1 (IMGT definition) has an amino acid sequence of SSVSY (SEQ ID NO: 13), CDR2 (IMGT definition) has an amino acid sequence of ATS (SEQ ID NO: 14), and CDR3 (IMGT definition) has an amino acid sequence of QQWSSNPLT (SEQ ID NO: 15), respectively.

(2) Antibody H

[0272] The heavy chain variable region of antibody H has the amino acid sequence that is represented by SEQ ID NO: 6.

[0273] When counting is made from the N-terminal side, the region composed of 19 amino acid residues starting from the methionine residue at position 6 to the serine residue at position 24 in the amino acid sequence is believed to be a signal peptide.

[0274] In this heavy chain variable region, CDR1 (IMGT definition) has an amino acid sequence of GFTYSSYG (SEQ ID NO: 16), CDR2 (IMGT definition) has an amino acid sequence of ISRRSIYT (SEQ ID NO: 17), and CDR3 (IMGT definition) has an amino acid sequence of ARLSLYDYDGARYTMDY (SEQ ID NO: 18), respectively.

[0275] The light chain variable region of antibody H has the amino acid sequence that is represented by SEQ ID NO: 7.

[0276] When counting is made from the N-terminal side, the region composed of 20 amino acid residues starting from the methionine residue at position 6 to the glycine residue at position 25 in the amino acid sequence is believed to be a signal peptide.

[0277] In this light chain variable region, CDR1 (IMGT definition) has an amino acid sequence of QDVGTA (SEQ ID NO: 19), CDR2 (IMGT definition) has an amino acid sequence of WAS (SEQ ID NO: 20), and CDR3 (IMGT definition) has an amino acid sequence of QQYSSYHT (SEQ ID NO: 21), respectively.

(3) Antibody J

[0278] The heavy chain variable region of antibody J has the amino acid sequence that is represented by SEQ ID NO: 8.

[0279] When counting is made from the N-terminal side, the region composed of 19 amino acid residues starting from the methionine residue at position 6 to the serine residue at position 24 in the amino acid sequence is believed to be a signal peptide.

[0280] In this heavy chain variable region, CDR1 (IMGT definition) has an amino acid sequence GYTFTSYW (SEQ ID NO: 22). CDR2 (IMGT definition) has an amino acid sequence INPSNGGT (SEQ ID NO: 23), and CDR3 (IMGT definition) has an amino acid sequence of ARGGIYYGNYDYYAMDY (SEQ ID NO: 24), respectively.

[0281] The light chain variable region of antibody J has the amino acid sequence that is represented by SEQ ID NO: 9.

[0282] When counting is made from the N-terminal side, the region composed of 20 amino acid residues starting from the methionine residue at position 6 to the glycine residue at position 25 in the amino acid sequence is believed to be a signal peptide.

[0283] In this light chain variable region, CDR1 (IMGT definition) has an amino acid sequence of KSLLHSNGNTY (SEQ ID NO: 25), CDR2 (IMGT definition) has an amino acid sequence of RVS (SEQ ID NO: 26), and CDR3 (IMGT definition) has an amino acid sequence of MQHLEYPFT (SEQ ID NO: 27), respectively.

(4) Summary of Results and Discussion

[0284] It is evident from the sequence information that antibodies A, B, C, D, E, F, G, H, J, and K are different antibodies, each derived from an independent clone.

[0285] Several of the antibodies were shown to bind specifically to both the mouse AQP3 and human AQP3 as an antigen (in particular, they can bind to a peptide fragment composed of the amino acid sequence of SEQ ID NO: 1, which is included in loop C). In addition, several of the antibodies were shown to be an inhibitory anti AQP3 mAb. Inhibitory anti AQP3 antibodies of the present invention have at least one suppressive activity selected from suppressing the function of permeating a low molecular weight molecule, which is responsible by AQP3 (for example, function of permeating hydrogen peroxide), suppressing the cellular function of AQP3-expressing cells (for example, function of cell proliferation), and suppressing an inflammatory response or a disorder response that is associated with AQP3.

[0286] Successful obtainment of multiple inhibitory antibodies derived from independent clones means that the epitope constituted with a region composed of the amino acid sequence of SEQ ID NO: 1, which is included in loop C as one of the extracellular domains of AQP3, is important, and, by selecting an anti AQP3 antibody that can specifically recognize the epitope, even more independent inhibitory anti AQP3 antibodies can be selected. The present invention provides an antibody which recognizes the extracellular domain of AQP3 and can directly bind to AQP3 from the outside of a cell, and it can also provide an anti AQP3 mAb which has not been known in a related art. In addition, without being limited thereto, the present invention provides plural molecules of an inhibitory anti AQP3 antibody, and gives clear information about the epitope included in the extracellular domain of AQP3, thus allowing new obtainment of an inhibitory anti AQP3 antibody.

INDUSTRIAL APPLICABILITY

[0287] The anti AQP3 monoclonal antibodies of the present invention specifically recognizing the extracellular domain of AQP3 enables highly-sensitive detection of AQP3, and from the viewpoint that it can be also used for identification, separation, and purification of living cells which express AQP3, it allows various analyses relating to AQP3, and thus has an industrial applicability. Furthermore, because anti AQP3 monoclonal antibodies of the present invention can have an inhibitory activity on at least one function of AQP3 like inhibiting the function of permeating a low molecular weight molecule that is responsible by AQP3, inhibiting the cellular function of AQP3-expressing cells (cell proliferation or the like), and inhibiting an occurrence of an inflammatory response in liver or the like, they can be used for prevention or treatment of various disorders, and thus have an industrial applicability.

Specific Embodiments

[0288] While various specific embodiments have been illustrated and described, it will be appreciated that various changes can be made without departing from the spirit and scope of the disclosure(s). The present disclosure is exemplified by the numbered embodiments set forth below.

[0289] 1. An anti AQP3 antibody or a functional fragment thereof that specifically binds to an oligopeptide whose amino acid sequence consists of ATYPSGHLDM (SEQ ID NO:1).

[0290] 2. The antibody or functional fragment thereof according to embodiment 1, which specifically binds to human AQP3.

[0291] 3. The antibody or functional fragment thereof according to embodiment 1 or embodiment 2, which specifically binds to mouse AQP3.

[0292] 4. An anti AQP3 antibody or a functional fragment thereof that specifically binds to the extracellular domain of human AQP3 and/or the extracellular domain of mouse AQP3.

[0293] 5. The antibody or functional fragment thereof according to any one of embodiments 1 to 3, which specifically binds to the extracellular domain of human AQP3 and/or the extracellular domain of mouse AQP3.

[0294] 6. The antibody or functional fragment thereof according to embodiment 4 or embodiment 5, which specifically binds to the extracellular domain of human AQP3.

[0295] 7. The antibody or functional fragment thereof according to any one of embodiments 4 to 6, which specifically binds to the extracellular domain of mouse AQP3.

[0296] 8. The antibody or functional fragment thereof according to any one of embodiments 4 to 7, which specifically binds to the extracellular domain of AQP3 expressed on the surface of PAM212 cells.

[0297] 9. The antibody or functional fragment thereof according to any one of embodiments 4 to 8, which specifically binds to the extracellular domain of AQP3 expressed on the surface of mouse macrophages.

[0298] 10. The antibody or functional fragment thereof according to any one of embodiments 3 to 9, which specifically binds to the extracellular domain of AQP3 expressed on the surface of HEK293 cells.

[0299] 11. The antibody or functional fragment thereof according to any one of embodiments 1 to 10 having an inhibitory activity on at least one function of human AQP3.

[0300] 12. The antibody or functional fragment thereof according to any one of embodiments 1 to 11 having an inhibitory activity on at least one function of mouse AQP3.

[0301] 13. The antibody or functional fragment thereof according to any one of embodiments 1 to 12, which inhibits proliferation of one or more of PAM212 cells, HaCaT cells, and A431 cells.

[0302] 14. The antibody or functional fragment thereof according to embodiment 13, which inhibits proliferation of PAM212 cells.

[0303] 15. The antibody or functional fragment thereof according to embodiment 13 or embodiment 14, which inhibits proliferation of HaCaT cells.

[0304] 16. The antibody or functional fragment thereof according to any one of embodiments 13 to 15, which inhibits proliferation of A431 cells.

[0305] 17. The antibody or functional fragment thereof according to any one of embodiments 13 to 16, wherein proliferation is measured according to the assay described in Example 5.

[0306] 18. The antibody or functional fragment thereof according to any one of embodiments 13 to 17, which inhibits proliferation by at least 10% relative to an IgG control antibody that does not specifically bind AQP3.

[0307] 19. The antibody or functional fragment thereof according to embodiment 18, which inhibits proliferation by at least 20% relative to an IgG control antibody that does not specifically bind AQP3.

[0308] 20. The antibody or functional fragment thereof according to embodiment 19, which inhibits proliferation by at least 30% relative to an IgG control antibody that does not specifically bind AQP3.

[0309] 21. The antibody or functional fragment thereof according to embodiment 18, which inhibits proliferation by about 10% to about 30% relative to an IgG control antibody that does not specifically bind AQP3.

[0310] 22. The antibody or functional fragment thereof according to any one of embodiments 1 to 21, which inhibits H.sub.2O.sub.2 transport.

[0311] 23. The antibody or functional fragment thereof according to embodiment 22, wherein inhibition of H.sub.2O.sub.2 transport is measured according to the assay described in Example 6.

[0312] 24. The antibody or functional fragment thereof according to embodiment 22 or embodiment 23, which inhibits H.sub.2O.sub.2 transport by at least 10% relative to an IgG control antibody that does not specifically bind AQP3.

[0313] 25. The antibody or functional fragment thereof according to embodiment 24, which inhibits H.sub.2O.sub.2 transport by at least 20% relative to an IgG control antibody that does not specifically bind AQP3.

[0314] 26. The antibody or functional fragment thereof according to embodiment 24, which inhibits H.sub.2O.sub.2 transport by at least 30% relative to an IgG control antibody that does not specifically bind AQP3.

[0315] 27. The antibody or functional fragment thereof according to embodiment 24, which inhibits H.sub.2O.sub.2 transport by about 10% to about 30% relative to an IgG control antibody that does not specifically bind AQP3.

[0316] 28. The antibody or functional fragment thereof according to any one of embodiments 1 to 27, which inhibits phosphorylation of p65.

[0317] 29. The antibody or functional fragment thereof according to embodiment 28, wherein inhibition of phosphorylation of p65 is measured according to the assay described in Example 7.

[0318] 30. The antibody or functional fragment thereof according to any one of embodiments 1 to 29, which inhibits a liver inflammatory response in mice treated with carbon tetrachloride.

[0319] 31. The antibody or function fragment thereof according to embodiment 30, wherein the liver inflammatory response in mice treated with carbon tetrachloride is measured according to the assay described in Example 8.

[0320] 32. An anti AQP3 antibody or a functional fragment thereof comprising a heavy chain complementarity determining region 1 (HCDR1), a heavy chain complementarity determining region 2 (HCRD2), a heavy chain complementarity determining region 3 (HCDR3), a light chain complementarity determining region 1 (LCDR1), a light chain complementarity determining region 2 (LCDR2), and a light chain complementarity determining region 3 (LCDR3) comprising amino acid sequences selected from the sequences set forth in one of Tables 2A-5E.

[0321] 33. The antibody or functional fragment thereof according to embodiment 32, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 sequences as set forth in Table 2A.

[0322] 34. The antibody or functional fragment thereof according to embodiment 32, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 sequences as set forth in Table 2B.

[0323] 35. The antibody or functional fragment thereof according to embodiment 32, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 sequences as set forth in Table 2C.

[0324] 36. The antibody or functional fragment thereof according to embodiment 32, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 sequences as set forth in Table 2D.

[0325] 37. The antibody or functional fragment thereof according to embodiment 32, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 sequences as set forth in Table 2E.

[0326] 38. The antibody or functional fragment thereof according to embodiment 32, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 sequences as set forth in Table 3A.

[0327] 39. The antibody or functional fragment thereof according to embodiment 32, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 sequences as set forth in Table 3B.

[0328] 40. The antibody or functional fragment thereof according to embodiment 32, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 sequences as set forth in Table 3C.

[0329] 41. The antibody or functional fragment thereof according to embodiment 32, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 sequences as set forth in Table 3D.

[0330] 42. The antibody or functional fragment thereof according to embodiment 32, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 sequences as set forth in Table 3E.

[0331] 43. The antibody or functional fragment thereof according to embodiment 32, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 sequences as set forth in Table 4A.

[0332] 44. The antibody or functional fragment thereof according to embodiment 32, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 sequences as set forth in Table 4B.

[0333] 45. The antibody or functional fragment thereof according to embodiment 32, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 sequences as set forth in Table 4C.

[0334] 46. The antibody or functional fragment thereof according to embodiment 32, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 sequences as set forth in Table 4D.

[0335] 47. The antibody or functional fragment thereof according to embodiment 32, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 sequences as set forth in Table 4E.

[0336] 48. The antibody or functional fragment thereof according to embodiment 32, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 sequences as set forth in Table 5A.

[0337] 49. The antibody or functional fragment thereof according to embodiment 32, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 sequences as set forth in Table 5B.

[0338] 50. The antibody or functional fragment thereof according to embodiment 32, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 sequences as set forth in Table 5C.

[0339] 51. The antibody or functional fragment thereof according to embodiment 32, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 sequences as set forth in Table 5D.

[0340] 52. The antibody or functional fragment thereof according to embodiment 32, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 sequences as set forth in Table 5E.

[0341] 53. The antibody or functional fragment thereof according to embodiment 32, comprising complementarity determining region (CDR) sequences of antibody A, antibody B, antibody C, antibody D, antibody E, antibody F, antibody G, antibody H, antibody J, or antibody K.

[0342] 54. The antibody or functional fragment thereof according to embodiment 53, comprising CDR sequences of antibody A.

[0343] 55. The antibody or functional fragment thereof according to embodiment 53, comprising CDR sequences of antibody B.

[0344] 56. The antibody or functional fragment thereof according to embodiment 53, comprising CDR sequences of antibody C.

[0345] 57. The antibody or functional fragment thereof according to embodiment 53, comprising CDR sequences of antibody D.

[0346] 58. The antibody or functional fragment thereof according to embodiment 53, comprising CDR sequences of antibody E.

[0347] 59. The antibody or functional fragment thereof according to embodiment 53, comprising CDR sequences of antibody F.

[0348] 60. The antibody or functional fragment thereof according to embodiment 53, comprising CDR sequences of antibody G.

[0349] 61. The antibody or functional fragment thereof according to embodiment 53, comprising CDR sequences of antibody H.

[0350] 62. The antibody or functional fragment thereof according to embodiment 53, comprising CDR sequences of antibody J.

[0351] 63. The antibody or functional fragment thereof according to embodiment 53, comprising CDR sequences of antibody K.

[0352] 64. The antibody or functional fragment thereof according to any one of embodiments 53 to 63, wherein the CDR sequences are defined by IMGT numbering, as set forth in Tables 1A-1J.

[0353] 65. The antibody or functional fragment thereof according to any one of embodiments 53 to 63, wherein the CDR sequences are defined by Kabat numbering, as set forth in Tables 1A-1J.

[0354] 66. The antibody or functional fragment thereof according to any one of embodiments 53 to 63, wherein the CDR sequences are defined by Chothia numbering, as set forth in Tables 1A-1J.

[0355] 67. The antibody or functional fragment thereof according to any one of embodiments 53 to 63, wherein the CDR sequences are defined by the IMGT, Kabat, and Chothia common sequences, as set forth in Tables 1A-1J.

[0356] 68. The antibody or functional fragment thereof according to any one of embodiments 53 to 63, wherein the CDR sequences are defined by the IMGT, Kabat, and Chothia combined overlap sequences, as set forth in Tables 1A-1J.

[0357] 69. The antibody or functional fragment thereof according to embodiment 32, comprising variable heavy (VH) and variable light (VH) chain sequences of antibody A, antibody B, antibody C, antibody D, antibody E, antibody F, antibody G, antibody H, antibody J, or antibody K.

[0358] 70. The antibody or functional fragment thereof according to embodiment 69, which comprises the VH and VL sequence of antibody A, as set forth in Table 1A.

[0359] 71. The antibody or functional fragment thereof according to embodiment 69, which comprises the VH and VL sequence of antibody B, as set forth in Table 1B.

[0360] 72. The antibody or functional fragment thereof according to embodiment 69, which comprises the VH and VL sequence of antibody C, as set forth in Table 10.

[0361] 73. The antibody or functional fragment thereof according to embodiment 69, which comprises the VH and VL sequence of antibody D, as set forth in Table 1D.

[0362] 74. The antibody or functional fragment thereof according to embodiment 69, which comprises the VH and VL sequence of antibody E, as set forth in Table 1E.

[0363] 75. The antibody or functional fragment thereof according to embodiment 69, which comprises the VH and VL sequence of antibody F, as set forth in Table 1F.

[0364] 76. The antibody or functional fragment thereof according to embodiment 69, which comprises the VH and VL sequence of antibody G, as set forth in Table 1G.

[0365] 77. The antibody or functional fragment thereof according to embodiment 69, which comprises the VH and VL sequence of antibody H, as set forth in Table 1H.

[0366] 78. The antibody or functional fragment thereof according to embodiment 69, which comprises the VH and VL sequence of antibody J, as set forth in Table 11.

[0367] 79. The antibody or functional fragment thereof according to embodiment 69, which comprises the VH and VL sequence of antibody K, as set forth in Table 1J.

[0368] 80. An antibody or functional fragment thereof that competes with the antibody or functional fragment thereof according to any one of embodiments 1 to 79 for binding to human AQP3.

[0369] 81. The antibody or functional fragment thereof according to embodiment 80, wherein the competition is for binding to cell surface expressed human AQP3.

[0370] 82. The antibody or functional fragment thereof according to embodiment 80, wherein the competition is for binding to human AQP3 expressed on the surface of HEK293 cells.

[0371] 83. An antibody or functional fragment thereof that competes with the antibody or functional fragment thereof according to any one of embodiments 1 to 79 for binding to mouse AQP3.

[0372] 84. The antibody or functional fragment thereof according to embodiment 83, wherein the competition is for binding to cell surface expressed mouse AQP3.

[0373] 85. The antibody or functional fragment thereof according to embodiment 84, wherein the competition is for binding to mouse AQP3 expressed on the surface of HEK293 cells.

[0374] 86. The antibody or functional fragment thereof according to embodiment 84, wherein the competition is for binding to mouse AQP3 expressed on the surface of PAM212 cells.

[0375] 87. The antibody or functional fragment thereof according to embodiment 84, wherein the competition is for binding to mouse AQP3 expressed on the surface of mouse macrophage cells.

[0376] 88. The antibody or functional fragment thereof according to any one of embodiments 1 to 87, which does not specifically bind to one or more human aquaporins other than AQP3 (“non-AQP3 aquaporins”).

[0377] 89. The antibody or functional fragment thereof according to embodiment 88, wherein the non-AQP3 aquaporins are selected from AQP0, APQ1, AQP2, AQP4, AQP5, AQP6, AQP7, AQP8, AQP9, AQP10, AQP11, and AQP12.

[0378] 90. The antibody or functional fragment thereof according to embodiment 89, wherein the one or more non-AQP3 aquaporins comprises AQP0.

[0379] 91. The antibody or functional fragment thereof according to any one of embodiments 88 to 90, wherein the one or more non-AQP3 aquaporins comprises AQP1.

[0380] 92. The antibody or functional fragment thereof according to any one of embodiments 88 to 91, wherein the one or more non-AQP3 aquaporins comprises AQP2.

[0381] 93. The antibody or functional fragment thereof according to any one of embodiments 88 to 92, wherein the one or more non-AQP3 aquaporins comprises AQP4.

[0382] 94. The antibody or functional fragment thereof according to any one of embodiments 88 to 93, wherein the one or more non-AQP3 aquaporins comprises AQP5.

[0383] 95. The antibody or functional fragment thereof according to any one of embodiments 88 to 94, wherein the one or more non-AQP3 aquaporins comprises AQP6.

[0384] 96. The antibody or functional fragment thereof according to any one of embodiments 88 to 95, wherein the one or more non-AQP3 aquaporins comprises AQP7.

[0385] 97. The antibody or functional fragment thereof according to any one of embodiments 88 to 96, wherein the one or more non-AQP3 aquaporins comprises AQP8.

[0386] 98. The antibody or functional fragment thereof according to any one of embodiments 88 to 97, wherein the one or more non-AQP3 aquaporins comprises AQP9.

[0387] 99. The antibody or functional fragment thereof according to any one of embodiments 88 to 98, wherein the one or more non-AQP3 aquaporins comprises AQP10.

[0388] 100. The antibody or functional fragment thereof according to any one of embodiments 88 to 99, wherein the one or more non-AQP3 aquaporins comprises AQP11.

[0389] 101. The antibody or functional fragment thereof according to any one of embodiments 88 to 100, wherein the one or more non-AQP3 aquaporins comprises AQP12.

[0390] 102. The antibody or functional fragment thereof according to any one of embodiments 1 to 101, wherein the antibody is an immunoglobulin molecule of IgG.

[0391] 103. The antibody or functional fragment thereof according to any one of embodiments 1 to 102, wherein the antibody is a monoclonal antibody.

[0392] 104. The antibody or functional fragment thereof according to any one of embodiments 1 to 103, wherein the antibody or functional fragment thereof is a chimeric antibody or a humanized antibody having a constant region of a human antibody.

[0393] 105. The antibody or functional fragment thereof according to embodiment 104, wherein the antibody or functional fragment thereof is a chimeric antibody.

[0394] 106. The antibody or functional fragment thereof according to embodiment 104, wherein the antibody or functional fragment thereof is a humanized antibody having a constant region of a human antibody.

[0395] 107. The antibody or functional fragment thereof according to any one of embodiments 1 to 106, which is an antibody.

[0396] 108. The antibody or functional fragment thereof according to embodiment 107, which is a monospecific antibody.

[0397] 109. The antibody or functional fragment thereof according to embodiment 107, which is a multispecific antibody.

[0398] 110. The antibody or functional fragment thereof according to any one of embodiments 1 to 106, which is a functional fragment of an antibody.

[0399] 111. The antibody or functional fragment thereof according to embodiment 110, which is a functional fragment selected from F(ab′)2, Fab, Fab′ and Fv.

[0400] 112. The antibody or functional fragment thereof according to any one of embodiments 1 to 111, which is labeled with a reporter material.

[0401] 113. The antibody or a functional fragment thereof according to any one of embodiments 1 to 112, which is immobilized on a solid support.

[0402] 114. An antibody drug conjugate (ADC) comprising the antibody or a functional fragment thereof according to any one of embodiments 1 to 111 conjugated to a cytotoxic agent.

[0403] 115. The ADC of embodiment 114, wherein the cytotoxic agent comprises an alkylating agent.

[0404] 116. The ADC of embodiment 115, wherein the alkylating agent comprises cisplatin, carboplatin, oxaliplatin, mechlorethamine, cyclophosphamide, melphalan, chlorambucil, ifosfamide busulfan, N-Nitroso-N-methylurea (MNU), carmustine (BCNU), lomustine (CCNU), semustine (MeCCNU), fotemustine, streptozotocin, dacarbazine, mitozolomide, temozolomide, thiotepa, mytomycin, diaziquone (AZQ), procarbazine or hexamethylmelamine.

[0405] 117. The ADC of embodiment 114, wherein the cytotoxic agent comprises an antimetabolite.

[0406] 118. The ADC of embodiment 117, wherein the antimetabolite comprises methotrexate, pemetrexed, capecitabine, cytarabine, gemcitabine, decitabine, azacitidine, fludarabine, nelarabine, cladribine, clofarabine, or pentostatin.

[0407] 119. The ADC of embodiment 114, wherein the cytotoxic agent comprises an antimicrotubule agent.

[0408] 120. The ADC of embodiment 119, wherein the antimicrotubule agent comprises paclitaxel, docetaxel, vincristine, vinorelbine, vinblastine, vindesine, vinflunine, monomethyl auristatin E, or monomethyl auristatin F.

[0409] 121. The ADC of embodiment 114, wherein the cytotoxic agent comprises a topoisomerase inhibitor.

[0410] 122. The ADC of embodiment 121, wherein the topoisomerase inhibitor comprises irinotecan, topotecan, etoposide, doxorubicin, mitoxantrone, teniposide, novobiocin, merbarone, or aclarubicin.

[0411] 123. The ADC of embodiment 114, wherein the cytotoxic agent comprises a cytotoxic antibiotic.

[0412] 124. The ADC of embodiment 123, wherein the cytotoxic antibiotic comprises doxorubicin, daunorubicin, epirubicin idarubicin, pirarubicin, aclarubicin, mitoxantrone, or bleomycin.

[0413] 125. A composition comprising the antibody or fragment thereof according to any one of embodiments 1 to 113.

[0414] 126. The composition according to embodiment 125, which is a reagent for detecting AQP3.

[0415] 127. The composition according to embodiment 125, which is a reagent for identifying, separating, or purifying AQP3-expressing cells.

[0416] 128. The composition according to embodiment 125 or 126, which is a reagent for measuring an expression amount of AQP3.

[0417] 129. A kit comprising the composition according to any one of embodiments 126 to 128.

[0418] 130. A composition comprising the monoclonal antibody or fragment thereof according to any one of embodiments 1 to 112, wherein the monoclonal antibody or a functional fragment thereof has an inhibitory activity on at least one function of AQP3.

[0419] 131. The composition according to embodiment 130, which is a pharmaceutical composition further including a pharmaceutically acceptable carrier.

[0420] 132. A composition comprising the ADC according to any one of embodiments 114 to 124 and a pharmaceutically acceptable carrier.

[0421] 133. The composition according to embodiment 131 or embodiment 132 for use in treating cancer.

[0422] 134. The composition according to embodiment 133, wherein the cancer is cancer selected from the group consisting of colorectal cancer, cervical cancer, liver cancer, lung cancer, esophageal cancer, kidney cancer, stomach cancer, tongue cancer, skin cancer, and breast cancer.

[0423] 135. The composition according to embodiment 131, for use in preventing and/or treating a skin disorder.

[0424] 136. The composition according to embodiment 135, wherein the skin disorder is selected from the group consisting of psoriasis, actinic keratosis, ichthyosis, and seborrheic dermatitis.

[0425] 137. The composition according to embodiment 131 for use in preventing and/or treating an inflammatory disorder.

[0426] 138. The composition according to embodiment 137, wherein the inflammatory disorder is selected from the group consisting of atopic dermatitis, psoriasis, asthma, chronic obstructive pulmonary disease, and hepatitis.

[0427] 139. A method for detecting AQP3 comprising a step of contacting a sample with the antibody or fragment thereof according to any one of embodiments 1 to 113, or with the composition according to embodiment 125 or 126.

[0428] 140. A method for separating and/or purifying AQP3-expressing cells comprising a step of contacting a sample including cells with the antibody or a functional fragment thereof according to any one of embodiments 1 to 113, or with the composition according to any one of embodiments 125 to 127.

[0429] 141. A method for measuring AQP3 comprising a step of contacting a sample with the antibody or a functional fragment thereof according to any one of embodiments 1 to 113, or with the composition according to embodiment 125, 126, or 128.

[0430] 142. A method for inhibiting at least one function of AQP3 comprising a step of contacting a sample including AQP3 with the antibody or a functional fragment thereof according to any one of embodiments 1 to 113, or with the composition according to embodiment 130.

[0431] 143. A method for inhibiting transport of a low molecular weight material across a membrane comprising a step of contacting a sample having a membrane including AQP3 with the antibody or a functional fragment thereof according to any one of embodiments 1 to 113, or with the composition according to embodiment 130.

[0432] 144. A method of treating a subject having cancer comprising administering a therapeutically effective amount of the antibody or functional fragment thereof according to any one of embodiments 1 to 112, the ADC of any one of embodiments 114 to 124, or the composition of embodiment 131 or embodiment 132 to the subject.

[0433] 145. The method according to embodiment 144, wherein the cancer is cancer selected from the group consisting of colorectal cancer, cervical cancer, liver cancer, lung cancer, esophageal cancer, kidney cancer, stomach cancer, tongue cancer, skin cancer, and breast cancer.

[0434] 146. A method of preventing and/or treating a skin disorder in a subject comprising administering a therapeutically effective amount of the antibody or functional fragment thereof according to any one of embodiments 1 to 112 or the composition of embodiment 131 to the subject.

[0435] 147. The method of embodiment 146, wherein the skin disorder is selected from the group consisting of psoriasis, actinic keratosis, ichthyosis, and seborrheic dermatitis.

[0436] 148. The method of embodiment 146 or embodiment 147, which is a method of treating a skin disorder.

[0437] 149. A method of preventing and/or treating an inflammatory disorder in a subject comprising administering a therapeutically effective amount of the antibody or functional fragment thereof according to any one of embodiments 1 to 112 or the composition of embodiment 131 to the subject.

[0438] 150. The method according to embodiment 149, wherein the inflammatory disorder is selected from the group consisting of atopic dermatitis, psoriasis, asthma, chronic obstructive pulmonary disease, and hepatitis.

[0439] 151. The method of embodiment 149 or embodiment 150, which is a method of treating an inflammatory disorder.

[0440] 152. A method for generating an anti AQP3 antibody, comprising immunizing a non-human mammal with a combination of (i) a peptide whose amino acid sequence consists of the amino acid sequence of SEQ ID NO:1 and (ii) AQP3 overexpressing cells.

[0441] 153. The method of embodiment 152, wherein the mammal is a mouse.

[0442] 154. The method of embodiment 152 or embodiment 153, wherein the AQP3 overexpressing cells comprise HaCaT cells, PAM212 cells, mouse macrophages, or HEK293 cells overexpressing AQP3 or a combination thereof.

[0443] 155. The method of embodiment 152 or embodiment 153, wherein the AQP3 overexpressing cells comprise CHO cells overexpressing AQP3.

[0444] 156. The method of embodiment 155, wherein the CHO cells overexpressing AQP3 comprise CHO cells overexpressing mouse AQP3.

[0445] 157. The method of embodiment 156, wherein the mouse AQP3 is expressed in the CHO cells using a CMV promoter.

[0446] 158. The method of any one of embodiments 155 to 157, wherein the CHO cells overexpressing AQP3 comprise CHO cells overexpressing human AQP3.

[0447] 159. The method of embodiment 158, wherein the human AQP3 is expressed in the CHO cells using a CMV promoter.

[0448] 160. The method of any one of embodiments 152 to 159, which further comprises collecting immune cells from the immunized mammal, generating an antibody library using mRNA from the immune cells, and identifying one or more anti AQP3 antibodies from the antibody library.

[0449] The present disclosure if further exemplified by the additional numbered embodiments set forth below.

[0450] 1′. An anti AQP3 antibody specifically recognizing the extracellular domain of aquaporin 3 (AQP3) or a functional fragment thereof.

[0451] 2′. The antibody or functional fragment thereof according to embodiment 1′, wherein the extracellular domain is loop C.

[0452] 3′. The antibody or functional fragment thereof according to embodiment 1′ or 2′ specifically binding to an oligopeptide composed of ten amino acid residues at the C-terminal side of loop C that are adjacent to the boundary to the transmembrane region IV.

[0453] 4′. The antibody or functional fragment thereof according to any one of embodiments 1′ to 3′, which is labeled with a reporter material.

[0454] 5′. The antibody or a functional fragment thereof according to any one of embodiments 1′ to 4′, which is immobilized on a solid support.

[0455] 6′. The antibody or functional fragment thereof according to any one of embodiments 1′ to 5′ specifically binding to AQP3 derived from a human and/or a mouse.

[0456] 7′. The antibody or functional fragment thereof according to any one of embodiments 1′ to 6′, wherein the antibody is an immunoglobulin molecule of IgG.

[0457] 8′. The antibody or functional fragment thereof according to any one of embodiments 1′ to 7′ having an inhibitory activity on at least one function of AQP3.

[0458] 9′. The antibody or functional fragment thereof according to any one of embodiments 1′ to 8′, wherein the antibody is a monoclonal antibody.

[0459] 10′. The monoclonal antibody according to embodiment 9′, wherein the antibody or functional fragment thereof is a chimeric antibody or a humanized antibody having a constant region of a human antibody.

[0460] 11′. A composition comprising the antibody or fragment thereof according to any one of embodiments 1′ to 10′.

[0461] 12′. The composition according to embodiment 11′, which is a reagent for detecting AQP3.

[0462] 13′. The composition according to embodiment 11′, which is a reagent for identifying, separating, or purifying AQP3-expressing cells.

[0463] 14′. The composition according to embodiment 11′ or 12′, which is a reagent for measuring an expression amount of AQP3.

[0464] 15′. A kit comprising the composition according to any one of embodiments 12′ to 14′.

[0465] 16′. A composition comprising the monoclonal antibody or fragment thereof according to embodiment 9′ or 10′, wherein the monoclonal antibody or a functional fragment thereof has an inhibitory activity on at least one function of AQP3.

[0466] 17′. The composition according to embodiment 16′, which is a pharmaceutical composition further including a pharmaceutically acceptable carrier.

[0467] 18′. The composition according to embodiment 17′ for use in treating cancer.

[0468] 19′. The composition according to embodiment 18′, wherein the cancer is cancer selected from the group consisting of colorectal cancer, cervical cancer, liver cancer, lung cancer, esophageal cancer, kidney cancer, stomach cancer, tongue cancer, skin cancer, and breast cancer.

[0469] 20′. The composition according to embodiment 16′, wherein it is used for preventing and/or treating a skin disorder.

[0470] 21′. The composition according to embodiment 20′, wherein the skin disorder is selected from the group consisting of psoriasis, actinic keratosis, ichthyosis, and seborrheic dermatitis.

[0471] 22′. The composition according to embodiment 16′ for use in preventing and/or treating an inflammatory disorder.

[0472] 23′. The composition according to embodiment 22′, wherein the inflammatory disorder is selected from the group consisting of atopic dermatitis, psoriasis, asthma, chronic obstructive pulmonary disease, and hepatitis.

[0473] 24′. A method for detecting AQP3 comprising a step of contacting a sample with the antibody or fragment thereof according to any one of embodiments 1′ to 10′, or with the composition according to embodiment 11′ or 12′.

[0474] 25′. A method for separating and/or purifying AQP3-expressing cells comprising a step of contacting a sample including cells with the antibody or a functional fragment thereof according to any one of embodiments 1′ to 10′, or with the composition according to embodiment 11′ or 12′.

[0475] 26′. A method for measuring AQP3 comprising a step of contacting a sample with the antibody or a functional fragment thereof according to any one of embodiments 1′ to 10′, or with the composition according to embodiment 11′, 12′, or 14′.

[0476] 27′. A method for inhibiting at least one function of AQP3 comprising a step of contacting a sample including AQP3 with the antibody or a functional fragment thereof according to any one of embodiments 1′ to 10′, or with the composition according to embodiment 16′.

[0477] 28′. A method for inhibiting transport of a low molecular weight material across a membrane comprising a step of contacting a sample having a membrane including AQP3 with the antibody or a functional fragment thereof according to any one of embodiments 1′ to 10′, or with the composition according to embodiment 16′.