PERSONALIZED CANCER IMMUNOTHERAPY

20210101993 · 2021-04-08

    Inventors

    Cpc classification

    International classification

    Abstract

    The present disclosure relates to a method for obtaining an antibody or antigen-binding fragment thereof that specifically binds to and against a tumor sample, comprising: administering autologous dendritic cells to a subject; taking immune cells and a tumor sample from the subject; constructing an antibody library of the immune cells; and screening the antibody library to obtain the antibody or a fragment thereof specifically binding to and against the tumor sample. The disclosure also relates to a method for engineering immune cells, an antibody or antigen-binding fragment thereof that specifically binds to and against a tumor sample and uses thereof.

    Claims

    1. A method for obtaining an antibody or antigen-binding fragment thereof that specifically binds to and against a tumor in a subject suffering from the tumor, comprising: taking a tumor sample from the subject; administering dendritic cells to the subject to prime anti-tumor immune response; harvesting immune cells of the subject; constructing an antibody library of the immune cells; and screening the antibody library to obtain the antibody or a fragment thereof specifically binding to and against the tumor.

    2. (canceled)

    3. The method of claim 1, wherein the subject undergoes surgical resection or simultaneous chemotherapy and radiotherapy before the administration of the dendritic cells.

    4. The method of claim 1, wherein the tumor sample is obtained before the administration of the dendritic cells.

    5. The method of claim 1, wherein the dendritic cells are autologous.

    6. (canceled)

    7. The method of claim 1, wherein the dendritic cells are administered to the subject more than one time.

    8.-11. (canceled)

    12. The method of claim 1, which comprises the following: taking a tumor sample from the subject; administering dendritic cells to the subject twice at 1 week interval to prime anti-tumor immune response after the subject undergoes surgical resection or simultaneous chemotherapy and radiotherapy; harvesting immune cells of the subject; constructing an antibody library of the immune cells; and screening the antibody library to obtain the antibody or a fragment thereof specifically binding to and against the tumor sample.

    13. The method of claim 1, wherein the dendritic cells are administered to the subject with a dose of 10.sup.4 cells/kg body weight to 10.sup.8 cells/kg body weight.

    14. (canceled)

    15. The method of claim 1, which further comprises establishing a primary tumor cell line from the tumor sample and screening the antibody library with the primary tumor cell line.

    16. The method of claim 1, wherein the antibody or a fragment thereof is a monoclonal antibody, chimeric antibody, humanized antibody, human antibody or scFv antibody or a fragment thereof.

    17. The method of claim 1, wherein the tumor is a squamous cell cancer, a lung cancer, a cancer of the peritoneum, a hepatocellular cancer, a gastric or stomach cancer including gastrointestinal cancer, a pancreatic cancer, a glioblastoma, a cervical cancer, an ovarian cancer, a liver cancer, a bladder cancer, a cancer of the urinary tract, a hepatoma, a breast cancer, a colon cancer, a rectal cancer, a colorectal cancer, an endometrial or uterine carcinoma, a salivary gland carcinoma, a kidney or a renal cancer, a prostate cancer, an vulval cancer, a thyroid cancer, a hepatic carcinoma, an anal carcinoma, a penile carcinoma, a melanoma, a multiple myeloma, B-cell lymphoma, a brain cancer, a head and neck cancer, or an associated metastases thereof.

    18. A method for engineering immune cells that specifically binds to and against a tumor sample, comprising: obtaining an antibody or antigen-binding fragment thereof that specifically binds to and against a tumor sample according to the method of claim 1; providing immune cells; and expressing the antibody or antigen-binding fragment thereof to the immune cells.

    19. An antibody or antigen-binding fragment thereof that specifically binds to and against a tumor sample, which comprises complementarity determining regions (CDRs) of a heavy chain variable region and complementarity determining regions of a light chain variable region, wherein the complementarity determining regions of the heavy chain variable region comprises CDRH1, CDRH2 and CDRH3 regions, and the complementarity determining regions of the light chain variable region comprises CDRL1, CDRL2 and CDRL3 regions, and wherein: the CDRH1 region comprises the amino acid sequence of SEQ ID NO: 1 (SYAMQ); the CDRH2 region comprises the amino acid sequence selected from the group consisting of SEQ ID NOs: 2 (GMSDDGSWTDYGAAVKG) and 3 (GVSDDGSWTGYGAAVQG); the CDRH3 region comprises the amino acid sequence selected from the group consisting of SEQ ID NOs: 4 (GAGTGYCDNRSFGCASTIDA) and 5 (GAGTGYCNNRGFGCASTIDA); and the CDRL1 region comprises the amino acid sequence of SEQ ID NO: 6 (SGSSGSYG); the CDRL2 region comprises the amino acid sequence selected from the group consisting of SEQ ID NOs: 7 (HNDKRPS) and 8 (YNDKRPS); the CDRL3 region comprises the amino acid sequence of SEQ ID NO: 9 (GSADRSGAGI).

    20. The antibody or antigen-binding fragment thereof of claim 19, wherein the CDRH1 region comprises the amino acid sequence of SEQ ID NO: 1; the CDRH2 region comprises the amino acid sequence of SEQ ID NO: 2; the CDRH3 region comprises the amino acid sequence of SEQ ID NO: 4; and the CDRL1 region comprises the amino acid sequence of SEQ ID NO: 6; the CDRL2 region comprises the amino acid sequence of SEQ ID NO: 7; the CDRL3 region comprises the amino acid sequence of SEQ ID NO: 9; or the CDRH1 region comprises the amino acid sequence of SEQ ID NO: 1; the CDRH2 region comprises the amino acid sequence of SEQ ID NO: 3; the CDRH3 region comprises the amino acid sequence of SEQ ID NO: 5; and the CDRL1 region comprises the amino acid sequence of SEQ ID NO: 6; the CDRL2 region comprises the amino acid sequence of SEQ ID NO: 8; the CDRL3 region comprises the amino acid sequence of SEQ ID NO: 9.

    21. The antibody or antigen-binding fragment thereof of claim 19, which comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 10 (AVTLDESGGGLHTPGGGLSLVCRASGFTFSSYAMQWVRQAPGKGLEWV AGMSDDGSWTDYGAAVKGRATISRDNGQSTVRLQLNNLRAEDTGTYYC AKGAGTGYCDNRSFGCASTIDAWGHGTEVIVSS); and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 11 (ALTQPSSVSANLGETVEITCSGSSGSYGWYQQKSPGSAPVTVIYHNDKRP SDIPSRFSGSKSGSTGTLTITGVQAEDEAVYYCGSADRSGAGIFGAGTTLT VL); or a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 12 (AVTLDESGGGLQTPGGGLSLVCRASGFTMTSYAMQWVRQAPGKGLEW VAGVSDDGSWTGYGAAVQGRATISRDNGQSTVRLLLNNLRAEDTATYY CVKGAGTGYCNNRGFGCASTIDAWGHGTEVIVSS); and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 13 (ALTQPSSVSANLGETVEITCSGSSGSYGWYQQKSPGSAPVTVIYYNDKRP SDIPSRFSGSKSGSTGTLTITGVQAEDEAVYYCGSADRSGAGIFGAGTTLT VL).

    22. The antibody or antigen-binding fragment thereof of claim 19, which comprises the amino acid sequence selected from the group consisting of SEQ ID NOs: 14 (ALTQPSSVSANLGETVEITCSGSSGSYGWYQQKSPGSAPVTVIYHNDKRPSDIPSRFSGSKSG STGTLTITGVQAEDEAVYYCGSADRSGAGIFGAGTTLTVLGQSSRSSGGGGSSGGGGSAVTL DESGGGLHTPGGGLSLVCRASGFTFSSYAMQWVRQAPGKGLEWVAGMSDDGSWTDYGAA VKGRATISRDNGQSTVRLQLNNLRAEDTGTYYCAKGAGTGYCDNRSFGCASTIDAWGHGTE VIVSS) and 15 (ALTQPSSVSANLGETVEITCSGSSGSYGWYQQKSPGSAPVTVIYYNDKRPSDIPSRFSGSKSG STGTLTITGVQAEDEAVYYCGSADRSGAGIFGAGTTLTVLGQSSRSSAVTLDESGGGLQTPGG GLSLVCRASGFTMTSYAMQWVRQAPGKGLEWVAGVSDDGSWTGYGAAVQGRATISRDNG QSTVRLLLNNLRAEDTATYYCVKGAGTGYCNNRGFGCASTIDAWGHGTEVIVSS).

    23. The antibody or antigen-binding fragment thereof of claim 19, wherein the antibody or a fragment thereof is a monoclonal antibody, chimeric antibody, humanized antibody, human antibody or scFv antibody or a fragment thereof.

    24. The antibody or antigen-binding fragment thereof of claim 19, which is expressed on a surface of an immune cell.

    25. A method for treating a tumor in a subject in need thereof; wherein the method comprises administering to said subject a pharmaceutical composition comprising a therapeutically effective amount of the antibody or antigen-binding fragment thereof of claim 19 and optionally a pharmaceutically acceptable carrier or excipient.

    26. The method of claim 25, wherein the pharmaceutical composition is administered intravenously, intra-peritoneally, intra-arterially, intra-thecally, intra-vesically, or intratumorally.

    27. The method of claim 25, wherein the tumor is a squamous cell cancer, a lung cancer, a cancer of the peritoneum, a hepatocellular cancer, a gastric or stomach cancer including gastrointestinal cancer, a pancreatic cancer, a glioblastoma, a cervical cancer, an ovarian cancer, a liver cancer, a bladder cancer, a cancer of the urinary tract, a hepatoma, a breast cancer, a colon cancer, a rectal cancer, a colorectal cancer, an endometrial or uterine carcinoma, a salivary gland carcinoma, a kidney or a renal cancer, a prostate cancer, an vulval cancer, a thyroid cancer, a hepatic carcinoma, an anal carcinoma, a penile carcinoma, a melanoma, a multiple myeloma, B-cell lymphoma, a brain cancer, a head and neck cancer, or an associated metastases thereof.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0055] FIG. 1 shows the results of exemplary cell-based ELISA of K562-CAIX.

    [0056] FIGS. 2A to 2C show the results of exemplary cell surface staining. 2A: unstained, control antibody (anti-CAIX); scFv L6. 2B: Long 1B, 3A, 2F, 3C antibodies. 2C: Short 1C, 1F, 1G, 2B antibodies.

    [0057] FIG. 3 shows the schematic diagram of the exemplary method for obtaining an antibody or antigen-binding fragment thereof that specifically binds to and against a tumor sample.

    [0058] FIG. 4 shows the results of exemplary cell-based ELISA of KYL's cell.

    DETAILED DESCRIPTION OF THE DISCLOSURE

    [0059] To facilitate an understanding of the present technology, a number of terms and phrases are defined below. Additional definitions are set forth throughout the detailed description.

    [0060] In addition, as used herein, the term “or” is an inclusive “or” operator and is equivalent to the term “and/or” unless the context clearly dictates otherwise. The term “based on” is not exclusive and allows for being based on additional factors not described, unless the context clearly dictates otherwise. In addition, throughout the specification, the meaning of “a”, “an”, and “the” include plural references. The meaning of “in” includes “in” and “on.

    [0061] As used herein, the term “specifically binds” means that an antibody does not cross react to a significant extent with other epitopes.

    [0062] As used herein, the term “epitope” refers to the site on the antigen to which an antibody binds to.

    [0063] As used herein, the term “antibody” refers to single chain, two-chain, and multi-chain proteins and polypeptides belonging to the classes of polyclonal, monoclonal, chimeric, and humanized antibodies; it also includes synthetic and genetically engineered variants of these antibodies. “Antibody fragment” includes Fab, Fab′, F(ab′)2, and FIT fragments, as well as any portion of an antibody having specificity toward a desired target epitope or epitopes.

    [0064] As used herein, the term “monoclonal antibody” refers to an antibody obtained from a population of substantially homogeneous antibodies. In other words, a monoclonal antibody consists of a homogeneous antibody arising from the growth of a single cell clone (for example a hybridoma, a eukaryotic host cell transfected with a DNA molecule coding for the homogeneous antibody or a prokaryotic host cell transfected with a DNA molecule coding for the homogeneous antibody). These antibodies are directed against a single epitope and are therefore highly specific.

    [0065] As used herein, the term “humanized antibody” refers to a recombinant protein in which the CDRs from an antibody from one species; e.g., a murine or a chicken antibody, are transferred from the heavy and light variable chains of the antibody from the species into human heavy and light variable domains (framework regions). The constant domains of the antibody molecule are derived from those of a human antibody. In some cases, specific residues of the framework region of the humanized antibody, particularly those that are touching or close to the CDR sequences, may be modified, for example replaced with the corresponding residues from the original murine, rodent, subhuman primate, or other antibody. The humanized antibody may be achieved by various methods including (a) grafting only the non-human CDRs onto human framework and constant regions with or without retention of critical framework residues, or (b) transplanting the entire non-human variable domains, but “cloaking” them with a human-like section by replacement of surface residues. Such methods as are useful in practicing the present disclosure include that disclosed in Padlan, Mol. Immunol., 31(3):169-217 (1994).

    [0066] As used herein, the term “chimeric antibody” refers to a recombinant protein that contains the variable domains of both the heavy and light antibody chains, including the complementarity determining regions (CDRs) of an antibody derived from one species, preferably a rodent antibody or a chicken antibody, more preferably a murine antibody, while the constant domains of the antibody molecule are derived from those of a human antibody.

    [0067] As used herein, the term “complementarity determining region” (CDR) refers to the non-contiguous antigen combining sites found within the variable region of both heavy and light chain polypeptides. CDRs have been described by Kabat et al., J. Biol. Chem. 252:6609-6616 (1977); Kabat et al., U.S. Dept. of Health and Human Services, “Sequences of proteins of immunological interest” (1991); by Chothia et al., J. Mol. Biol. 196:901-917 (1987); and MacCallum et al., J. Mol. Biol. 262:732-745 (1996), where the definitions include overlapping or subsets of amino acid residues when compared against each other.

    [0068] As applied to polypeptides, the term “substantial similarity” or “substantially similar” means that two peptide sequences, when optimally aligned, such as by the programs GAP or BESTFIT using default gap weights, share at least 95% sequence identity, even more preferably at least 98% or 99% sequence identity. Preferably, residue positions which are not identical differ by conservative amino acid substitutions. A “conservative amino acid substitution” is one in which an amino acid residue is substituted by another amino acid residue having a side chain (R group) with similar chemical properties (e.g., charge or hydrophobicity). In general, a conservative amino acid substitution will not substantially change the functional properties of a protein. In cases where two or more amino acid sequences differ from each other by conservative substitutions, the percent sequence identity or degree of similarity may be adjusted upwards to correct for the conservative nature of the substitution. Means for making this adjustment are well-known to those of skill in the art. Examples of groups of amino acids that have side chains with similar chemical properties include (1) aliphatic side chains: glycine, alanine, valine, leucine and isoleucine; (2) aliphatic-hydroxyl side chains: serine and threonine; (3) amide-containing side chains: asparagine and glutamine; (4) aromatic side chains: phenylalanine, tyrosine, and tryptophan; (5) basic side chains: lysine, arginine, and histidine; (6) acidic side chains: aspartate and glutamate, and (7) sulfur-containing side chains are cysteine and methionine. Preferred conservative amino acids substitution groups are: valine-leucine-isoleucine, phenylalanine-tyrosine, lysine-arginine, alanine-valine, glutamate-aspartate, and asparagine-glutamine. Alternatively, a conservative replacement is any change having a positive value in the PAM250 log-likelihood matrix disclosed in Gonnet et al. (1992) Science 256: 1443-1445, herein incorporated by reference. A “moderately conservative” replacement is any change having a nonnegative value in the PAM250 log-likelihood matrix.

    [0069] As used herein, the term “sample” encompasses a variety of sample types obtained from an individual, subject or patient and can be used in a diagnostic or monitoring assay. The definition encompasses blood and other liquid samples of biological origin, solid tissue samples such as a biopsy specimen or tissue cultures or cells derived therefrom and the progeny thereof.

    [0070] As used herein, the terms “treatment,” “treating,” and the like, covers any treatment of a disease in a mammal, particularly in a human, and includes: (a) preventing the disease from occurring in a subject which may be predisposed to the disease but has not yet been diagnosed as having it; (b) inhibiting the disease, i.e., arresting its development; and (c) relieving the disease, i.e., causing regression of the disease.

    [0071] As interchangeably used herein, the terms “individual,” “subject,” “host,” and “patient,” refer to a mammal, including, but not limited to, murines (rats, mice), non-human primates, humans, canines, felines, ungulates (e.g., equines, bovines, ovines, porcines, caprines), etc.

    [0072] As used herein, the term “therapeutically effective amount” or “efficacious amount” refers to the amount of an antibody that, when administered to a mammal or other subject for treating a disease, is sufficient to effect such treatment for the disease.

    [0073] The present disclosure provides a method for obtaining an antibody or antigen-binding fragment thereof that specifically binds to and against a tumor in a subject suffering from tumor, comprising: [0074] taking a tumor sample from the subject; [0075] administering dendritic cells to the subject to prime anti-tumor immune response; [0076] harvesting immune cells of the subject; [0077] constructing an antibody library of the immune cells; and [0078] screening the antibody library to obtain the antibody or a fragment thereof specifically binding to and against the tumor.

    [0079] In one embodiment, a tumor sample is taken to establish a specific primary tumor cell line. In one embodiment, the immune cells described herein are derived from peripheral blood mononuclear cells (PBMCs).

    [0080] It is believed, though not intended to be restricted by any theoretical, that dendritic cells are antigen-presenting cells of the mammalian immune system, which present antigens on the cell surface to the T cells of the immune system. Administering autologous dendritic cells before harvesting immune cells improves the specificity and effectivity of screening, facilitating obtaining the powerful antibody that specifically binds to and against a tumor sample. The autologous dendritic cells may be derived from the monocytes of the subject or provided through proliferation. Preferably, the dendritic cells are derived from the PBMCs of the subject; more preferably directly from the peripheral blood.

    [0081] In preferred embodiments, the subject is a mammal. Exemplary mammals include human, pig, sheep, goat, horse, mouse, dog, cat, cow, etc.

    [0082] Clinically, tumor patients often undergo radiation therapy, chemotherapy or surgery. In order to collect effective dendritic cells, the dendritic cells are preferably collected from the subject before the subject undergoes radiation therapy, chemotherapy or surgery. The duration between the radiation therapy, chemotherapy or surgery and collection may be 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or 14 days, preferably, 7 days.

    [0083] The administration of the dendritic cells may be performed more than one time; preferably, the dendritic cells are administrated to the subject twice in a time interval. The interval between the administrations may be 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or 14 days, preferably, 7 days.

    [0084] In another aspect, the dendritic cells are administered to the subject in an amount sufficient to exhibit antigen presentation. Preferably, the dendritic cells are administered to the subject with a dose of 10.sup.4 cells/kg body weight to 10.sup.6 cells/kg body weight.

    [0085] In situation of the subject receiving radiation therapy, chemotherapy or surgery, the dendritic cells are preferably administered to the subject after the subject undergoes radiation therapy, chemotherapy or surgery.

    [0086] The immune cells harvested may be from the lymph or blood, preferably from the peripheral blood. Preferably, the immune cells are harvested after 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or 14 days, preferably 7 days, of the administration of dendritic cells.

    [0087] Examples of the immune cells according to the disclosure include but are not limited to lymphocytes, neutrophils, monocytes and macrophages. Preferably, the immune cells are lymphocytes. Examples of the lymphocytes include but are not limited to T-cells, B-cells and NK cells. Preferably, the immune cells are B cells.

    [0088] The manner for constructing an antibody library of the immune cells may be varied. Examples of the construction include but are not limited to phage display, in vitro display, yeast display, mammalian display, and bacterial display; preferably, the antibody library is constructed by phage display.

    [0089] The tumor sample may be provided directly from the subject or processed. Preferably, the method further comprises establishing a primary tumor cell line from the tumor sample and screening the antibody library with the primary tumor cell line. Moreover, the antibody library is preferably screened by cell-based panning.

    [0090] The antibody or a fragment thereof may be a monoclonal antibody, chimeric antibody, humanized antibody, human antibody or scFv antibody or a fragment thereof; preferably scFv antibody.

    [0091] In one embodiment of the disclosure, an anti-carbonic anhydrase IX (CAIX) antibody is screened according to the disclosure.

    [0092] Tumors that may be treated with the antibody or a pharmaceutical composition thereof include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia or lymphoid malignancies. More particular examples of such cancers include squamous cell cancer (e.g., epithelial squamous cell cancer), lung cancer including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung and squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, cancer of the urinary tract, hepatoma, breast cancer, colon cancer, rectal cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, anal carcinoma, penile carcinoma, melanoma, multiple myeloma and B-cell lymphoma, brain, as well as head and neck cancer, and associated metastases.

    [0093] The present disclosure also provides a method for engineering immune cells that specifically binds to and against a tumor sample, comprising: [0094] obtaining an antibody or antigen-binding fragment thereof that specifically binds to and against a tumor sample according to the method mentioned above; [0095] providing immune cells; and [0096] expressing the antibody or antigen-binding fragment thereof to the immune cells.

    [0097] Preferably, the immune cells are chimeric antibody immune cells. In one embodiment of the disclosure, the chimeric antibody comprises an antigen recognition domain, hinge region, transmembrane domain, and intracellular T-cell signaling domain. The antibody or antigen-binding fragment thereof is as the antigen recognition domain

    [0098] The present disclosure also provides an antibody or antigen-binding fragment thereof that specifically binds to and against a tumor sample, which comprises complementarity determining regions (CDRs) of a heavy chain variable region and complementarity determining regions of a light chain variable region, wherein the complementarity determining regions of the heavy chain variable region comprises CDRH1, CDRH2 and CDRH3 regions, and the complementarity determining regions of the light chain variable region comprises CDRL1, CDRL2 and CDRL3 regions, and wherein: [0099] the CDRH1 region comprises the amino acid sequence of SEQ ID NO: 1 (SYAMQ); the CDRH2 region comprises the amino acid sequence selected from the group consisting of SEQ ID NOs: 2 (GMSDDGSWTDYGAAVKG) and 3 (GVSDDGSWTGYGAAVQG); [0100] the CDRH3 region comprises the amino acid sequence selected from the group consisting of SEQ ID NOs: 4 (GAGTGYCDNRSFGCASTIDA) and 5 (GAGTGYCNNRGFGCASTIDA); and [0101] the CDRL1 region comprises the amino acid sequence of SEQ ID NO: 6 (SGSSGSYG); [0102] the CDRL2 region comprises the amino acid sequence selected from the group consisting of SEQ ID NOs: 7 (HNDKRPS) and 8 (YNDKRPS); the CDRL3 region comprises the amino acid sequence of SEQ ID NO: 9 (GSADRSGAGI).

    [0103] Particularly, the antibody or antigen-binding fragment thereof is anti-CAIX L3A, wherein: [0104] the CDRH1 region comprises the amino acid sequence of SEQ ID NO: 1; the CDRH2 region comprises the amino acid sequence of SEQ ID NO: 2; the CDRH3 region comprises the amino acid sequence of SEQ ID NO: 4; and [0105] the CDRL1 region comprises the amino acid sequence of SEQ ID NO: 6; the CDRL2 region comprises the amino acid sequence of SEQ ID NO: 7; the CDRL3 region comprises the amino acid sequence of SEQ ID NO: 9.

    [0106] Particularly, the antibody or antigen-binding fragment thereof is anti-CAIX S1C, wherein: [0107] the CDRH1 region comprises the amino acid sequence of SEQ ID NO: 1; the CDRH2 region comprises the amino acid sequence of SEQ ID NO: 3; the CDRH3 region comprises the amino acid sequence of SEQ ID NO: 5; and [0108] the CDRL1 region comprises the amino acid sequence of SEQ ID NO: 6; the CDRL2 region comprises the amino acid sequence of SEQ ID NO: 8; the CDRL3 region comprises the amino acid sequence of SEQ ID NO: 9.

    [0109] Preferably, anti-CAIX L3A comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 10 (AVTLDESGGGLHTPGGGLSLVCRASGFTFSSYAMQWVRQAPGKGLEWVAGMSDDGS WTDYGAAVKGRATISRDNGQSTVRLQLNNLRAEDTGTYYCAKGAGTGYCDNRSFGCA STIDAWGHGTEVIVSS); and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 11 (ALTQPSSVSANLGETVEITCSGSSGSYGWYQQKSPGSAPVTVIYHNDKRPSDIPSRFSGS KSGSTGTLTITGVQAEDEAVYYCGSADRSGAGIFGAGTTLTVL).

    [0110] Preferably, anti-CAIX S1C comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 12 (AVTLDESGGGLQTPGGGLSLVCRASGFTMTSYAMQWVRQAPGKGLEWVAGVSDDGS WTGYGAAVQGRATISRDNGQSTVRLLLNNLRAEDTATYYCVKGAGTGYCNNRGFGCA STIDAWGHGTEVIVSS); and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 13 (ALTQPSSVSANLGETVEITCSGSSGSYGWYQQKSPGSAPVTVIYYNDKRPSDIPSRFSGS KSGSTGTLTITGVQAEDEAVYYCGSADRSGAGIFGAGTTLTVL).

    [0111] More preferably, anti-CAIX L3A comprises the amino acid sequence of SEQ ID NO: (ALTQPSSVSANLGETVEITCSGSSGSYGWYQQKSPGSAPVTVIYHNDKRPSDIPSRFSGS KSGSTGTLTITGVQAEDEAVYYCGSADRSGAGIFGAGTTLTVLGQSSRSSGGGGSSGGG GSAVTLDESGGGLHTPGGGLSLVCRASGFTFSSYAMQWVRQAPGKGLEWVAGMSDDG SWTDYGAAVKGRATISRDNGQSTVRLQLNNLRAEDTGTYYCAKGAGTGYCDNRSFGC ASTIDAWGHGTEVIVSS).

    [0112] More preferably, anti-CAIX S1C comprises the amino acid sequence of SEQ ID NO: (ALTQPSSVSANLGETVEITCSGSSGSYGWYQQKSPGSAPVTVIYYNDKRPSDIPSRFSGS KSGSTGTLTITGVQAEDEAVYYCGSADRSGAGIFGAGTTLTVLGQSSRSSAVTLDESGG GLQTPGGGLSLVCRASGFTMTSYAMQWVRQAPGKGLEWVAGVSDDGSWTGYGAAVQ GRATISRDNGQSTVRLLLNNLRAEDTATYYCVKGAGTGYCNNRGFGCASTIDAWGHGT EVIVSS).

    [0113] In one preferred embodiment of the disclosure, the antibody or antigen-binding fragment thereof is conjugated with a therapeutic agent. In one preferred embodiment of the disclosure, the antibody or antigen-binding fragment thereof is expressed on the surface of a cell. More preferably, the cell is an immune cell, still more preferably, NK-cell.

    [0114] The present disclosure provides a pharmaceutical composition comprising a therapeutically effective amount of the antibody or antigen-binding fragment thereof mentioned above and optionally a pharmaceutically acceptable carrier or excipient. The pharmaceutical compositions of the disclosure are formulated with suitable carriers, excipients, and other agents that provide improved transfer, delivery, tolerance, and the like. A multitude of appropriate formulations can be found in the formulary known to all pharmaceutical chemists: Remington's Pharmaceutical Sciences, Mack Publishing Company, Easton, Pa. These formulations include, for example, powders, pastes, ointments, jellies, waxes, oils, lipids, lipid (cationic or anionic) containing vesicles, DNA conjugates, anhydrous absorption pastes, oil-in-water and water-in-oil emulsions, emulsions carbowax (polyethylene glycols of various molecular weights), semi-solid gels, and semi-solid mixtures containing carbowax.

    [0115] The dose of antibody administered to a patient may vary depending upon the age and the size of the patient, target disease, conditions, route of administration, and the like. The preferred dose is typically calculated according to body weight or body surface area. When an antibody of the present disclosure is used for treating tumor in an adult patient, it may be advantageous to intravenously administer the antibody of the present disclosure. Depending on the severity of the condition, the frequency and the duration of the treatment can be adjusted. Effective dosages and schedules for administering the antibody may be determined empirically; for example, patient progress can be monitored by periodic assessment, and the dose adjusted accordingly. Moreover, interspecies scaling of dosages can be performed using well-known methods in the art.

    [0116] Various delivery systems are known and can be used to administer the pharmaceutical composition of the disclosure, e.g., encapsulation in liposomes, microparticles, microcapsules, recombinant cells capable of expressing the mutant viruses, receptor mediated endocytosis (see, e.g., Wu et al., 1987, J. Biol. Chem. 262:4429-4432). Methods of introduction include, but are not limited to, intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, intra-arterial, intra-thecal, intra-vesical, or intratumoral, epidural, and oral routes. The composition may be administered by any convenient route, for example by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (e.g., oral mucosa, rectal and intestinal mucosa, etc.) and may be administered together with other biologically active agents. Administration can be systemic or local. Preferably, the medicament is administered intravenously, intra-peritoneally, intra-arterially, intra-thecally, intra-vesically, or intratumorally.

    [0117] The present disclosure provides use of the pharmaceutical composition mentioned above in the manufacture of a medicament for treating tumor in a subject in need.

    [0118] The present disclosure provides a method for treating tumor in a subject in need comprising administering the pharmaceutical composition mentioned above.

    [0119] In one embodiment of the disclosure, wherein the administering is intravenously, intra-peritoneally, intra-arterially, intra-thecally, intra-vesically, or intratumorally.

    [0120] The following examples are provided to aid those skilled in the art in practicing the present disclosure.

    EXAMPLES

    Example 1: Expression, Purification Binding Assay of Anti-CAIX Ab

    [0121] K562 cells were taken for negative selection; meanwhile, CAIX-overexpression K562 cells were taken for positive selection. Antibody phage library was established from chickens immunized with CAIX Ag.

    [0122] The antibody libraries were established based on the previous report (Andris-Widhopf J, Rader C, Steinberger P et al. Methods for the generation of chicken monoclonal antibody fragments by phage display. J Immunol Methods 2000; 242: 159-81). Briefly, spleens harvested from chickens following the final immunization were placed immediately in Trizol (Gibco BRL., USA) for homogenization. Ten μg of total RNA was reversely transcribed into the first-strand cDNA using a SuperScript RT kit (Invitrogen, USA). After amplification using chicken-specific primers, PCR products of heavy and light chain variable (VH and VL) regions were subjected to a second round of PCR to form full-length scFv fragments with a short or long linker, which were further digested with SfiI and cloned into the pComb3X vector. Recombinant phage DNAs were transformed into E. coli ER2738 strain by electroporation (MicroPulser from Bio-Rad). The production of recombinant phages was initiated by the addition of wild-type VCS-M13 helper phage, which were subsequently precipitated with 4% polyethylene glycol 8000 and 3% NaCl (w/v), and finally re-suspended in 1× phosphate-buffered saline (PBS) containing 1% bovine serum albumin (BSA). Then, 10.sup.12-10.sup.13 plaque-forming units (pfu) of recombinant phages (50 ul) in the scFv antibody libraries were blocked with 1% BSA in PBS at 4° C. for 1 hr and then incubated with 10.sup.6 K562 cell (100 ul) at RT for 30 mins for twice (Negative selection). After the unbound phages supernatant were collected, the supernatant were incubated with CAIX-overexpression K562 cells at 4° C. for 1 hr (positive selection). Then the cells were wash with PBS for 5-8 times. Bound phages were eluted with 0.2M glycine-HCl (pH 2.2), neutralized with 1 M Tris-HCl buffer and then used to infect the E. coli ER2738 strain. The amplified phages were precipitated and recovered as described above for the next round of selection.

    [0123] The libraries with short linker and long linker were constructed as shown in Table 1. The elution titer after each panning are shown (Table 1). After three rounds of panning, the CAIX binding phage variants were greatly enriched. These results suggested the non-specific binding phage was removed throughout the panning process and the clones with specific binding affinity were enriched. The sequences were confirmed to belong to chicken immunoglobulin germline gene.

    TABLE-US-00001 TABLE 1 Long chain linker Library Round 1 Round 2 Round 3 Elution 2*10{circumflex over ( )}4 1*10{circumflex over ( )}6 4*10{circumflex over ( )}6 Amplification 2.2*10{circumflex over ( )}13 2.8*10{circumflex over ( )}13 Short chain linker Library Round 1 Round 2 Round 3 Elution 7*10{circumflex over ( )}4 1*10{circumflex over ( )}6 5*10{circumflex over ( )}6 Amplification 2*10{circumflex over ( )}13 3.8*10{circumflex over ( )}12

    [0124] To examine their binding reactivity, 50 μl of candidate phage were incubated with K562 or CAIX-overexpression K562 cells in the ELISA plate wells with shaking at 150 rpm at RT for 2 hours. After washed with PBS for 3 times, the bound scFv were detected by incubating with HRP-conjugated anti-M13 antibodies (1:5,000) at RT for 2 hours. After washed with PBS for 6 times, a tetramethylbenzidine (TMB) substrate solution (Sigma, USA) was added to the wells for color development. The reaction was stopped with 2 N H2504 and optical density was measured at 450-540 nm using an ELISA plate reader (BioTek Synergy HT). The results of cell-based ELISA are shown in FIG. 1. The candidate scFvs have higher binding activity to CAIX-overexpression K562 cells when compared to K562 cells.

    [0125] Anti-HA antibody was used to detect the binding activity of candidate phage clones. 1×10.sup.5 K562 or K562-CAIX cells and 20 μl candidate phage clone were subjected to flow cytometry assay. The results of cell surface staining are shown in FIGS. 2A to 2C. Except for anti-CAIX L1B scFv, all the scFvs could specifically bind to CAIX-overexpression cells.

    [0126] Among the antibodies, anti-CAIX L3A (Long 3A) and S1C (Short 1C) were obtained.

    Example 2: Anti-Thyroid Cancer Cell Ab in In Vivo Assay

    [0127] The schematic diagram of the method for obtaining an antibody or antigen-binding fragment thereof that specifically binds to and against a tumor sample is shown in FIG. 3.

    [0128] Dendritic cells were collected from a patient suffered from thyroid cancer. After the patient underwent surgical resection or simultaneous chemotherapy and radiotherapy, the patient received axillary lymph node (ALN) injection of 1×10.sup.4˜1×10.sup.6 cells/kg body weight of autologous DC cells twice (at week 1 and 2). Surgical resection sample was used to establish tumor cell line, and the peripheral blood collected in the 3rd week was used to establish the Ab phage library.

    [0129] Thyroid cancer cells (KYL's cells) were established from the patient and cultured in RPMI1640 medium (Hyclone, SH30027) supplemented with 1.5% PLUS' Human Plate Lysate (CPMPASS, CPS-PLS5-BAG) and 2% Penicillin-streptomycin (Life technologies, 15140) at 37° C. in humidified air with 5% CO.sub.2.

    [0130] The protocol of cell-based panning is as mentioned in Example 1.

    [0131] The phage titer was performed according to Example 1, and the results are shown in Table 2.

    TABLE-US-00002 TABLE 2 Panning Amplify Panning Amplify Panning 1 1 2 2 3 Long 1.3*10{circumflex over ( )}2 4*10{circumflex over ( )}11 1.5*10{circumflex over ( )}5 7.0*10{circumflex over ( )}11 3.7*10{circumflex over ( )}5 Chain Linker Short 1.2*10{circumflex over ( )}2 2*10{circumflex over ( )}10 1.1*10{circumflex over ( )}5 1.0*10{circumflex over ( )}12 1.22*10{circumflex over ( )}6 Chain Linker

    [0132] The protocols of phage amplification and cell-based ELISA were the same to those in Example 1. The results are shown in FIG. 4. Clone D and F have high binding activity to thyroid cancer cells.

    [0133] While the present disclosure has been described in conjunction with the specific embodiments set forth above, many alternatives thereto and modifications and variations thereof will be apparent to those of ordinary skill in the art. All such alternatives, modifications and variations are regarded as falling within the scope of the present disclosure.