METHOD OF INACTIVATING A GLUCOCORTICOID RECEPTOR GENE IN AN ISOLATED CELL
20210102222 ยท 2021-04-08
Inventors
- Andreas Reik (Brisbane, CA, US)
- Michael Jensen (Sierra Madre, CA, US)
- Michael C. Holmes (Brisbane, CA, US)
- Philip D. GREGORY (Brisbane, CA, US)
- Dale Ando (Brisbane, CA, US)
Cpc classification
A61P29/00
HUMAN NECESSITIES
C12N9/22
CHEMISTRY; METALLURGY
C12N2740/15043
CHEMISTRY; METALLURGY
A61P37/06
HUMAN NECESSITIES
G01N2333/723
PHYSICS
C07K14/721
CHEMISTRY; METALLURGY
C12N15/86
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
C12N15/86
CHEMISTRY; METALLURGY
C12N9/22
CHEMISTRY; METALLURGY
Abstract
Disclosed herein are methods and compositions for inactivation of the human glucocorticoid receptor (GR) gene by targeted cleavage of genomic DNA encoding the GR. Such methods and compositions are useful, for example, in therapeutic applications which require retention of immune function during glucocorticoid treatment.
Claims
1. A method of selecting isolated human cells comprising an exogenous sequence integrated into an endogenous GR gene, the method comprising (a) introducing into isolated human cells one or more polynucleotides encoding a pair of zinc finger nucleases and a polynucleotide comprising an exogenous sequence flanked by homology arms to the endogenous GR gene, wherein the pair of zinc finger nucleases comprises: a first zinc finger nuclease (ZFN) comprising a zinc finger DNA-binding domain comprising the following recognition helices in the following order: TABLE-US-00005 (SEQIDNO:23) TSRALTA; (SEQIDNO:17) DRANLSR; (SEQIDNO:24) RSDNLSE; and (SEQIDNO:26) ERANRNS; and a second zinc finger nuclease (ZFN) comprising a zinc finger DNA-binding domain comprising the following recognition helices in the following order: TABLE-US-00006 (SEQIDNO:32) DGWNRDC or (SEQIDNO:33) DSWNLQV; (SEQIDNO:27) RSANLTR; (SEQIDNO:30) TSGNLTR; and (SEQIDNO:31) TSGSLTR; or a first zinc finger nuclease comprising a zinc finger DNA-binding domain comprising the following recognition helices in the following order: TABLE-US-00007 (SEQIDNO:42) RSANLAR; (SEQIDNO:43) RSDNLRE; (SEQIDNO:44) QSSNLAR; and (SEQIDNO:45) QSADRTK; and a second zinc finger nuclease comprising a zinc finger DNA-binding domain comprising the following recognition helices in the following order: TABLE-US-00008 (SEQIDNO:40) RQDCLSL; (SEQIDNO:37) RNDNRKT; (SEQIDNO:38) RSDNLSR; and (SEQIDNO:39) TNQNRIT such that upon expression of the pair of ZFNs the endogenous GR gene is cleaved and the exogenous sequence into the cleaved GR gene; and (b) contacting the isolated human cells of step (a) with a corticosteroid such that cells with the exogenous sequence integrated into the GR gene are selected.
2. The method of claim 1, wherein the corticosteroid is synthetic.
3. The method of claim 2, wherein the corticosteriod is dexamethasone.
4. The method of claim 1, wherein the exogenous sequence comprises a transgene.
5. The method of claim 1, wherein the expressing step comprises contacting the cell with a viral delivery vector.
6. The method of claim 5, wherein the vector is replication-defective.
7. The method of claim 5, wherein the viral delivery vector is an adenovirus, a hybrid adenovirus or a non-integrating lentivirus.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
DETAILED DESCRIPTION
[0067] Disclosed herein are compositions and methods useful for altering the primary sequence of the gene encoding the glucocorticoid receptor (GR), utilizing fusion proteins comprising an engineered zinc finger DNA-binding domain and a cleavage domain (or cleavage half-domain), referred to herein as zinc finger nucleases. Such sequence alterations can result in inactivation of human GR function. As is known in the art, zinc finger DNA-binding domains can be engineered, by selection methods or using techniques of rational design, to bind any target DNA sequence of choice. Fusion of engineered zinc finger DNA-binding domains to various types of functional domain, including transcriptional activation domains, transcriptional repression domains and nuclease domains, has also been described. See, for example, U.S. Pat. Nos. 6,534,261 and 6,933,113 and U.S. Patent Publication No. 2005/0064474; the disclosures of which are incorporated by reference in their entireties. Thus, by fusion of an engineered zinc finger binding domain to a nuclease domain, also known as a cleavage domain (i.e., a polypeptide domain with the ability to cleave double-stranded DNA), a custom endonuclease, having cleavage specificity for a sequence of choice, can be constructed. In certain embodiments, an engineered zinc finger DNA-binding domain is fused to a cleavage half-domain (i.e., a polypeptide domain which, when dimerized, possesses double-stranded DNA cleavage activity) and a pair of such fusion proteins is used for targeted DNA cleavage.
[0068] Cleavage of genomic DNA can result in the induction of a cellular repair mechanism known as non-homologous end joining (NHEJ). In the process of rejoining broken DNA ends, NHEJ often introduces mutations into the sequence at or around the site of the DNA break. The error-prone nature of the repair process, coupled with the ability of the zinc finger nuclease(s) to continue to bind and cleave their target sequence(s) until error-prone repair causes an alteration of the target sequence(s), results in the accumulation of mutations at or near the site of cleavage at a high frequency. Accordingly, targeted cleavage of endogenous genomic DNA sequences with zinc finger nucleases can be used to induce sequence changes (i.e., mutations) at or around the site of targeted cleavage. If such changes in nucleotide sequence occur in a region of the genome that encodes a protein, they usually result in alterations of the amino acid sequence of the encoded protein. For example, alteration of reading frame can result in production of a truncated protein due to premature translation termination. Alternatively, incorrect amino acids may be encoded. In either case, a non-functional polypeptide is produced. An additional consequence of sequence alteration following NHEJ is nonsense-mediated decay of mRNA encoded by the altered sequence. Thus, targeted DNA cleavage using zinc finger nucleases can be used to inactivate the function of a gene of choice. Inactivation can be achieved either by mutagenesis of both alleles or by mutagenesis of a single allele to generate a dominant negative mutant protein.
[0069] Targeted cleavage at a predetermined site in endogenous chromosomal DNA can also be used to facilitate integration of exogenous sequences at or near the site of cleavage, by both homology-directed and homology-independent mechanisms. For homology-dependent integration, a donor sequence, containing sequences homologous to genomic sequences on both sides of the targeted cleavage site, is provided to cells in addition to the zinc finger nuclease(s). Such a donor sequence can also contain sequences that are nonhomologous to genomic sequences in the vicinity of the targeted cleavage site, optionally disposed between two stretches of homologous sequence. See, for example, U.S. Patent Publication No. 2005/0064474 (Mar. 24, 2005) and U.S. Patent Publication No. 2007/0134796 (Jun. 14, 2007), the disclosures of which are incorporated by reference in their entireties for all purposes. If integration of exogenous sequences occurs within the transcribed region of a gene, at both alleles, inactivation of the gene can result. Finally, targeted cleavage at two or more sites in endogenous chromosomal DNA can result in deletion of genomic sequences between the cleavage sites. See U.S. Patent Publication No. 2006/0188987 (Aug. 24, 2006), the disclosure of which is incorporated by reference in its entirety for all purposes. Thus, gene function can be inactivated by any of the foregoing mechanisms, all of which depend upon targeted cleavage of endogenous chromosomal DNA with one or more zinc finger nucleases.
[0070] The present disclosure provides methods and compositions for mutating the human glucocorticoid receptor (GR) gene. Such mutations can cause loss of GR function and result in modulation of immune function in a subject. In certain embodiments, mutation of the GR gene results from zinc finger nuclease-mediated integration of exogenous sequences into the human GR locus. In additional embodiments, the exogenous sequences comprise sequences encoding a modified receptor molecule.
[0071] The methods and compositions disclosed herein allow permanent abolition of glucocorticoid receptor function in a specified population of cells. This makes it possible, for example, to treat patients with immunosuppressant glucocorticoid hormones, while allowing those patients to retain a subset of immune cells able to effect specific immune responses.
[0072] Also provided are methods and compositions which facilitate the use of the GR locus as a defined integration site for therapeutic transgenes.
General
[0073] Practice of the methods, as well as preparation and use of the compositions disclosed herein employ, unless otherwise indicated, conventional techniques in molecular biology, biochemistry, chromatin structure analysis, computational chemistry, cell culture, recombinant DNA and related fields as are within the skill of the art. These techniques are fully explained in the literature. See, for example, Sambrook et al. MOLECULAR CLONING: A LABORATORY MANUAL, Cold Spring Harbor Laboratory Press, Second edition, 1989, Third edition, 2001; Ausubel et al., CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, New York, 1987 and periodic updates; and the series METHODS IN ENZYMOLOGY, Academic Press, San Diego.
Definitions
[0074] The terms nucleic acid, polynucleotide, and oligonucleotide are used interchangeably and refer to a deoxyribonucleotide or ribonucleotide polymer, in linear or circular conformation, and in either single- or double-stranded form. For the purposes of the present disclosure, these terms are not to be construed as limiting with respect to the length of a polymer. The terms can encompass known analogues of natural nucleotides, as well as nucleotides that are modified in the base, sugar and/or phosphate moieties (e.g., phosphorothioate backbones). In general, an analogue of a particular nucleotide has the same base-pairing specificity; i.e., an analogue of A will base-pair with T.
[0075] The terms polypeptide, peptide and protein are used interchangeably to refer to a polymer of amino acid residues. The term also applies to amino acid polymers in which one or more amino acids are chemical analogues or modified derivatives of a corresponding naturally-occurring amino acids.
[0076] Binding refers to a sequence-specific, non-covalent interaction between macromolecules (e.g., between a protein and a nucleic acid). Not all components of a binding interaction need be sequence-specific (e.g., contacts with phosphate residues in a DNA backbone), as long as the interaction as a whole is sequence-specific. Such interactions are generally characterized by a dissociation constant (Kd) of 10-6 M-1 or lower. Affinity refers to the strength of binding: increased binding affinity being correlated with a lower Kd.
[0077] A binding protein is a protein that is able to bind non-covalently to another molecule. A binding protein can bind to, for example, a DNA molecule (a DNA-binding protein), an RNA molecule (an RNA-binding protein) and/or a protein molecule (a protein-binding protein). In the case of a protein-binding protein, it can bind to itself (to form homodimers, homotrimers, etc.) and/or it can bind to one or more molecules of a different protein or proteins. A binding protein can have more than one type of binding activity. For example, zinc finger proteins have DNA-binding, RNA-binding and protein-binding activity.
[0078] A zinc finger DNA binding protein (or binding domain) is a protein, or a domain within a larger protein, that binds DNA in a sequence-specific manner through one or more zinc fingers, which are regions of amino acid sequence within the binding domain whose structure is stabilized through coordination of a zinc ion. The term zinc finger DNA binding protein is often abbreviated as zinc finger protein or ZFP.
[0079] Zinc finger binding domains can be engineered to bind to a predetermined nucleotide sequence. Non-limiting examples of methods for engineering zinc finger proteins are design and selection. A designed zinc finger protein is a protein not occurring in nature whose design/composition results principally from rational criteria. Rational criteria for design include application of substitution rules and computerized algorithms for processing information in a database storing information of existing ZFP designs and binding data. See, for example, U.S. Pat. Nos. 6,140,081; 6,453,242; and 6,534,261; see also International Patent Publication Nos. WO 98/53058; WO 98/53059; WO 98/53060; WO 02/016536 and WO 03/016496.
[0080] A selected zinc finger protein is a protein not found in nature whose production results primarily from an empirical process such as phage display, interaction trap or hybrid selection. See e.g., U.S. Pat. Nos. 5,789,538; 5,925,523; 6,007,988; 6,013,453 and 6,200,759; and International Patent Publication Nos. WO 95/19431; WO 96/06166; WO 98/53057; WO 98/54311; WO 00/27878; WO 01/60970; WO 01/88197 and WO 02/099084.
[0081] The term sequence refers to a nucleotide sequence of any length, which can be DNA or RNA; can be linear, circular or branched and can be either single-stranded or double stranded. The term donor sequence refers to a nucleotide sequence that is inserted into a genome. A donor sequence can be of any length, for example between 2 and 10,000 nucleotides in length (or any integer value therebetween or thereabove), preferably between about 100 and 1,000 nucleotides in length (or any integer therebetween), more preferably between about 200 and 500 nucleotides in length.
[0082] A homologous, non-identical sequence refers to a first sequence which shares a degree of sequence identity with a second sequence, but whose sequence is not identical to that of the second sequence. For example, a polynucleotide comprising the wild-type sequence of a mutant gene is homologous and non-identical to the sequence of the mutant gene. In certain embodiments, the degree of homology between the two sequences is sufficient to allow homologous recombination therebetween, utilizing normal cellular mechanisms. Two homologous non-identical sequences can be any length and their degree of non-homology can be as small as a single nucleotide (e.g., for correction of a genomic point mutation by targeted homologous recombination) or as large as 10 or more kilobases (e.g., for insertion of a gene at a predetermined ectopic site in a chromosome). Two polynucleotides comprising the homologous non-identical sequences need not be the same length. For example, an exogenous polynucleotide (i.e., donor polynucleotide) of between 20 and 10,000 nucleotides or nucleotide pairs can be used.
[0083] Techniques for determining nucleic acid and amino acid sequence identity are known in the art. Typically, such techniques include determining the nucleotide sequence of the mRNA for a gene and/or determining the amino acid sequence encoded thereby, and comparing these sequences to a second nucleotide or amino acid sequence. Genomic sequences can also be determined and compared in this fashion. In general, identity refers to an exact nucleotide-to-nucleotide or amino acid-to-amino acid correspondence of two polynucleotides or polypeptide sequences, respectively. Two or more sequences (polynucleotide or amino acid) can be compared by determining their percent identity. The percent identity of two sequences, whether nucleic acid or amino acid sequences, is the number of exact matches between two aligned sequences divided by the length of the shorter sequences and multiplied by 100. An approximate alignment for nucleic acid sequences is provided by the local homology algorithm of Smith and Waterman, Advances in Applied Mathematics 2:482-489 (1981). This algorithm can be applied to amino acid sequences by using the scoring matrix developed by Dayhoff, Atlas of Protein Sequences and Structure, M. O. Dayhoff ed., 5 suppl. 3:353-358, National Biomedical Research Foundation, Washington, D.C., USA, and normalized by Gribskov, Nucl. Acids Res. 14(6):6745-6763 (1986). An exemplary implementation of this algorithm to determine percent identity of a sequence is provided by the Genetics Computer Group (Madison, Wis.) in the BestFit utility application. The default parameters for this method are described in the Wisconsin Sequence Analysis Package Program Manual, Version 8 (1995) (available from Genetics Computer Group, Madison, Wis.). A preferred method of establishing percent identity in the context of the present disclosure is to use the MPSRCH package of programs copyrighted by the University of Edinburgh, developed by John F. Collins and Shane S. Sturrok, and distributed by IntelliGenetics, Inc. (Mountain View, Calif.). From this suite of packages the Smith-Waterman algorithm can be employed where default parameters are used for the scoring table (for example, gap open penalty of 12, gap extension penalty of one, and a gap of six). From the data generated the Match value reflects sequence identity. Other suitable programs for calculating the percent identity or similarity between sequences are generally known in the art, for example, another alignment program is BLAST, used with default parameters. For example, BLASTN and BLASTP can be used using the following default parameters: genetic code=standard; filter=none; strand=both; cutoff=60; expect=10; Matrix=BLOSUM62; Descriptions=50 sequences; sort by=HIGH SCORE; Databases=non-redundant, GenBank+EMBL+DDBJ+PDB+GenBank CDS translations+Swiss protein+Spupdate+PIR. Details of these programs can be found at the following internet address: http://www.ncbi.nlm.gov/cgi-bin/BLAST. With respect to sequences described herein, the range of desired degrees of sequence identity is approximately 80% to 100% and any integer value therebetween. Typically the percent identities between sequences are at least 70-75%, preferably 80-82%, more preferably 85-90%, even more preferably 92%, still more preferably 95%, and most preferably 98% sequence identity.
[0084] Alternatively, the degree of sequence similarity between polynucleotides can be determined by hybridization of polynucleotides under conditions that allow formation of stable duplexes between homologous regions, followed by digestion with single-stranded-specific nuclease(s), and size determination of the digested fragments. Two nucleic acid, or two polypeptide sequences are substantially homologous to each other when the sequences exhibit at least about 70%-75%, preferably 80%-82%, more preferably 85%-90%, even more preferably 92%, still more preferably 95%, and most preferably 98% sequence identity over a defined length of the molecules, as determined using the methods above. As used herein, substantially homologous also refers to sequences showing complete identity to a specified DNA or polypeptide sequence. DNA sequences that are substantially homologous can be identified in a Southern hybridization experiment under, for example, stringent conditions, as defined for that particular system. Defining appropriate hybridization conditions is within the skill of the art. See, e.g., Sambrook et al., supra; Nucleic Acid Hybridization: A Practical Approach, editors B. D. Hames and S. J. Higgins, (1985) Oxford; Washington, DC; IRL Press).
[0085] Selective hybridization of two nucleic acid fragments can be determined as follows. The degree of sequence identity between two nucleic acid molecules affects the efficiency and strength of hybridization events between such molecules. A partially identical nucleic acid sequence will at least partially inhibit the hybridization of a completely identical sequence to a target molecule. Inhibition of hybridization of the completely identical sequence can be assessed using hybridization assays that are well known in the art (e.g., Southern (DNA) blot, Northern (RNA) blot, solution hybridization, or the like, see Sambrook, et al., Molecular Cloning: A Laboratory Manual, Second Edition, (1989) Cold Spring Harbor, N.Y.). Such assays can be conducted using varying degrees of selectivity, for example, using conditions varying from low to high stringency. If conditions of low stringency are employed, the absence of non-specific binding can be assessed using a secondary probe that lacks even a partial degree of sequence identity (for example, a probe having less than about 30% sequence identity with the target molecule), such that, in the absence of non-specific binding events, the secondary probe will not hybridize to the target.
[0086] When utilizing a hybridization-based detection system, a nucleic acid probe is chosen that is complementary to a reference nucleic acid sequence, and then by selection of appropriate conditions the probe and the reference sequence selectively hybridize, or bind, to each other to form a duplex molecule. A nucleic acid molecule that is capable of hybridizing selectively to a reference sequence under moderately stringent hybridization conditions typically hybridizes under conditions that allow detection of a target nucleic acid sequence of at least about 10-14 nucleotides in length having at least approximately 70% sequence identity with the sequence of the selected nucleic acid probe. Stringent hybridization conditions typically allow detection of target nucleic acid sequences of at least about 10-14 nucleotides in length having a sequence identity of greater than about 90-95% with the sequence of the selected nucleic acid probe. Hybridization conditions useful for probe/reference sequence hybridization, where the probe and reference sequence have a specific degree of sequence identity, can be determined as is known in the art (see, for example, Nucleic Acid Hybridization: A Practical Approach, editors B. D. Hames and S. J. Higgins, (1985) Oxford; Washington, D.C.; IRL Press).
[0087] Conditions for hybridization are well-known to those of skill in the art. Hybridization stringency refers to the degree to which hybridization conditions disfavor the formation of hybrids containing mismatched nucleotides, with higher stringency correlated with a lower tolerance for mismatched hybrids. Factors that affect the stringency of hybridization are well-known to those of skill in the art and include, but are not limited to, temperature, pH, ionic strength, and concentration of organic solvents such as, for example, formamide and dimethylsulfoxide. As is known to those of skill in the art, hybridization stringency is increased by higher temperatures, lower ionic strength and lower solvent concentrations.
[0088] With respect to stringency conditions for hybridization, it is well known in the art that numerous equivalent conditions can be employed to establish a particular stringency by varying, for example, the following factors: the length and nature of the sequences, base composition of the various sequences, concentrations of salts and other hybridization solution components, the presence or absence of blocking agents in the hybridization solutions (e.g., dextran sulfate, and polyethylene glycol), hybridization reaction temperature and time parameters, as well as, varying wash conditions. The selection of a particular set of hybridization conditions is selected following standard methods in the art (see, for example, Sambrook, et al., Molecular Cloning: A Laboratory Manual, Second Edition, (1989) Cold Spring Harbor, N.Y.).
[0089] Recombination refers to a process of exchange of genetic information between two polynucleotides. For the purposes of this disclosure, homologous recombination (HR) refers to the specialized form of such exchange that takes place, for example, during repair of double-strand breaks in cells. This process requires nucleotide sequence homology, uses a donor molecule to template repair of a target molecule (i.e., the one that experienced the double-strand break), and is variously known as non-crossover gene conversion or short tract gene conversion, because it leads to the transfer of genetic information from the donor to the target. Without wishing to be bound by any particular theory, such transfer can involve mismatch correction of heteroduplex DNA that forms between the broken target and the donor, and/or synthesis-dependent strand annealing, in which the donor is used to resynthesize genetic information that will become part of the target, and/or related processes. Such specialized HR often results in an alteration of the sequence of the target molecule such that part or all of the sequence of the donor polynucleotide is incorporated into the target polynucleotide.
[0090] Cleavage refers to the breakage of the covalent backbone of a DNA molecule. Cleavage can be initiated by a variety of methods including, but not limited to, enzymatic or chemical hydrolysis of a phosphodiester bond. Both single-stranded cleavage and double-stranded cleavage are possible, and double-stranded cleavage can occur as a result of two distinct single-stranded cleavage events. DNA cleavage can result in the production of either blunt ends or staggered ends. In certain embodiments, fusion polypeptides are used for targeted double-stranded DNA cleavage.
[0091] A cleavage domain comprises one or more polypeptide sequences which possesses catalytic activity for DNA cleavage. A cleavage domain can be contained in a single polypeptide chain or cleavage activity can result from the association of two (or more) polypeptides. A cleavage half-domain is a polypeptide sequence which, in conjunction with a second polypeptide (either identical or different) forms a complex having cleavage activity (preferably double-strand cleavage activity). The terms first and second cleavage half-domains; + and cleavage half-domains and right and left cleavage half-domains are used interchangeably to refer to pairs of cleavage half-domains that dimerize.
[0092] An engineered cleavage half-domain is a cleavage half-domain that has been modified so as to form obligate heterodimers with another cleavage half-domain (e.g., another engineered cleavage half-domain). See, also, U.S. Patent Publication Nos. 2005/0064474 and 2006/0188987 and U.S. Provisional Application No. 60/808,486 (filed May 25, 2006), incorporated herein by reference in their entireties.
[0093] Chromatin is the nucleoprotein structure comprising the cellular genome. Cellular chromatin comprises nucleic acid, primarily DNA, and protein, including histones and non-histone chromosomal proteins. The majority of eukaryotic cellular chromatin exists in the form of nucleosomes, wherein a nucleosome core comprises approximately 150 base pairs of DNA associated with an octamer comprising two each of histones H2A, H2B, H3 and H4; and linker DNA (of variable length depending on the organism) extends between nucleosome cores. A molecule of histone H1 is generally associated with the linker DNA. For the purposes of the present disclosure, the term chromatin is meant to encompass all types of cellular nucleoprotein, both prokaryotic and eukaryotic. Cellular chromatin includes both chromosomal and episomal chromatin.
[0094] A chromosome is a chromatin complex comprising all or a portion of the genome of a cell. The genome of a cell is often characterized by its karyotype, which is the collection of all the chromosomes that comprise the genome of the cell. The genome of a cell can comprise one or more chromosomes.
[0095] An episome is a replicating nucleic acid, nucleoprotein complex or other structure comprising a nucleic acid that is not part of the chromosomal karyotype of a cell. Examples of episomes include plasmids and certain viral genomes.
[0096] An accessible region is a site in cellular chromatin in which a target site present in the nucleic acid can be bound by an exogenous molecule which recognizes the target site. Without wishing to be bound by any particular theory, it is believed that an accessible region is one that is not packaged into a nucleosomal structure. The distinct structure of an accessible region can often be detected by its sensitivity to chemical and enzymatic probes, for example, nucleases.
[0097] A target site or target sequence is a nucleic acid sequence that defines a portion of a nucleic acid to which a binding molecule will bind, provided sufficient conditions for binding exist. For example, the sequence 5 GAATTC 3 is a target site for the Eco RI restriction endonuclease.
[0098] An exogenous molecule is a molecule that is not normally present in a cell, but can be introduced into a cell by one or more genetic, biochemical or other methods. Normal presence in the cell is determined with respect to the particular developmental stage and environmental conditions of the cell. Thus, for example, a molecule that is present only during embryonic development of muscle is an exogenous molecule with respect to an adult muscle cell. Similarly, a molecule induced by heat shock is an exogenous molecule with respect to a non-heat-shocked cell. An exogenous molecule can comprise, for example, a functioning version of a malfunctioning endogenous molecule or a malfunctioning version of a normally-functioning endogenous molecule.
[0099] An exogenous molecule can be, among other things, a small molecule, such as is generated by a combinatorial chemistry process, or a macromolecule such as a protein, nucleic acid, carbohydrate, lipid, glycoprotein, lipoprotein, polysaccharide, any modified derivative of the above molecules, or any complex comprising one or more of the above molecules. Nucleic acids include DNA and RNA, can be single- or double-stranded; can be linear, branched or circular; and can be of any length. Nucleic acids include those capable of forming duplexes, as well as triplex-forming nucleic acids. See, for example, U.S. Pat. Nos. 5,176,996 and 5,422,251. Proteins include, but are not limited to, DNA-binding proteins, transcription factors, chromatin remodeling factors, methylated DNA binding proteins, polymerases, methylases, demethylases, acetylases, deacetylases, kinases, phosphatases, integrases, recombinases, ligases, topoisomerases, gyrases and helicases.
[0100] An exogenous molecule can be the same type of molecule as an endogenous molecule, e.g., an exogenous protein or nucleic acid. For example, an exogenous nucleic acid can comprise an infecting viral genome, a plasmid or episome introduced into a cell, or a chromosome that is not normally present in the cell. Methods for the introduction of exogenous molecules into cells are known to those of skill in the art and include, but are not limited to, lipid-mediated transfer (i.e., liposomes, including neutral and cationic lipids), electroporation, direct injection, cell fusion, particle bombardment, calcium phosphate co-precipitation, DEAE-dextran-mediated transfer and viral vector-mediated transfer.
[0101] By contrast, an endogenous molecule is one that is normally present in a particular cell at a particular developmental stage under particular environmental conditions. For example, an endogenous nucleic acid can comprise a chromosome, the genome of a mitochondrion, chloroplast or other organelle, or a naturally-occurring episomal nucleic acid. Additional endogenous molecules can include proteins, for example, transcription factors and enzymes.
[0102] A fusion molecule is a molecule in which two or more subunit molecules are linked, preferably covalently. The subunit molecules can be the same chemical type of molecule, or can be different chemical types of molecules. Examples of the first type of fusion molecule include, but are not limited to, fusion proteins (for example, a fusion between a ZFP DNA-binding domain and a cleavage domain) and fusion nucleic acids (for example, a nucleic acid encoding the fusion protein described supra). Examples of the second type of fusion molecule include, but are not limited to, a fusion between a triplex-forming nucleic acid and a polypeptide, and a fusion between a minor groove binder and a nucleic acid.
[0103] Expression of a fusion protein in a cell can result from delivery of the fusion protein to the cell or by delivery of a polynucleotide encoding the fusion protein to a cell, wherein the polynucleotide is transcribed, and the transcript is translated, to generate the fusion protein. Trans-splicing, polypeptide cleavage and polypeptide ligation can also be involved in expression of a protein in a cell. Methods for polynucleotide and polypeptide delivery to cells are presented elsewhere in this disclosure.
[0104] A gene, for the purposes of the present disclosure, includes a DNA region encoding a gene product (see infra), as well as all DNA regions which regulate the production of the gene product, whether or not such regulatory sequences are adjacent to coding and/or transcribed sequences. Accordingly, a gene includes, but is not necessarily limited to, promoter sequences, terminators, translational regulatory sequences such as ribosome binding sites and internal ribosome entry sites, enhancers, silencers, insulators, boundary elements, replication origins, matrix attachment sites and locus control regions.
[0105] Gene expression refers to the conversion of the information, contained in a gene, into a gene product. A gene product can be the direct transcriptional product of a gene (e.g., mRNA, tRNA, rRNA, antisense RNA, ribozyme, structural RNA or any other type of RNA) or a protein produced by translation of a mRNA. Gene products also include RNAs which are modified, by processes such as capping, polyadenylation, methylation, and editing, and proteins modified by, for example, methylation, acetylation, phosphorylation, ubiquitination, ADP-ribosylation, myristilation, and glycosylation.
[0106] Modulation of gene expression refers to a change in the activity of a gene. Modulation of expression can include, but is not limited to, gene activation and gene repression.
[0107] Eucaryotic cells include, but are not limited to, fungal cells (such as yeast), plant cells, animal cells, mammalian cells and human cells (e.g., T-cells).
[0108] A region of interest is any region of cellular chromatin, such as, for example, a gene or a non-coding sequence within or adjacent to a gene, in which it is desirable to bind an exogenous molecule. Binding can be for the purposes of targeted DNA cleavage and/or targeted recombination. A region of interest can be present in a chromosome, an episome, an organellar genome (e.g., mitochondrial, chloroplast), or an infecting viral genome, for example. A region of interest can be within the coding region of a gene, within transcribed non-coding regions such as, for example, leader sequences, trailer sequences or introns, or within non-transcribed regions, either upstream or downstream of the coding region. A region of interest can be as small as a single nucleotide pair or up to 2,000 nucleotide pairs in length, or any integral value of nucleotide pairs.
[0109] The terms operative linkage and operatively linked (or operably linked) are used interchangeably with reference to a juxtaposition of two or more components (such as sequence elements), in which the components are arranged such that both components function normally and allow the possibility that at least one of the components can mediate a function that is exerted upon at least one of the other components. By way of illustration, a transcriptional regulatory sequence, such as a promoter, is operatively linked to a coding sequence if the transcriptional regulatory sequence controls the level of transcription of the coding sequence in response to the presence or absence of one or more transcriptional regulatory factors. A transcriptional regulatory sequence is generally operatively linked in cis with a coding sequence, but need not be directly adjacent to it. For example, an enhancer is a transcriptional regulatory sequence that is operatively linked to a coding sequence, even though they are not contiguous.
[0110] With respect to fusion polypeptides, the term operatively linked can refer to the fact that each of the components performs the same function in linkage to the other component as it would if it were not so linked. For example, with respect to a fusion polypeptide in which a ZFP DNA-binding domain is fused to a cleavage domain, the ZFP DNA-binding domain and the cleavage domain are in operative linkage if, in the fusion polypeptide, the ZFP DNA-binding domain portion is able to bind its target site and/or its binding site, while the cleavage domain is able to cleave DNA in the vicinity of the target site.
[0111] A functional fragment of a protein, polypeptide or nucleic acid is a protein, polypeptide or nucleic acid whose sequence is not identical to the full-length protein, polypeptide or nucleic acid, yet retains the same function as the full-length protein, polypeptide or nucleic acid. A functional fragment can possess more, fewer, or the same number of residues as the corresponding native molecule, and/or can contain one or more amino acid or nucleotide substitutions. Methods for determining the function of a nucleic acid (e.g., coding function, ability to hybridize to another nucleic acid) are well-known in the art. Similarly, methods for determining protein function are well-known. For example, the DNA-binding function of a polypeptide can be determined, for example, by filter-binding, electrophoretic mobility-shift, or immunoprecipitation assays. DNA cleavage can be assayed by gel electrophoresis. See Ausubel et al., supra. The ability of a protein to interact with another protein can be determined, for example, by co-immunoprecipitation, two-hybrid assays or complementation, both genetic and biochemical. See, for example, Fields et al. (1989) Nature 340:245-246; U.S. Pat. No. 5,585,245 and International Patent Publication No. WO 98/44350.
Design of Zinc Finger DNA-Binding Domains
[0112] Construction of zinc finger nucleases is described, for example, in U.S. Patent Publication Nos. 2003/0232410, 2005/0026157, 2005/0064474 and 2005/0208489, the disclosures of which are incorporated by reference in their entireties. Briefly, a non-naturally-occurring zinc finger DNA-binding domain, comprising 2, 3, 4, 5, 6 or more zinc fingers, is engineered to bind to a predetermined target nucleotide sequence. The engineered zinc finger binding domain is fused to a nuclease domain, a cleavage domain or a cleavage half-domain to form a zinc finger nuclease capable of DNA cleavage at or near the target nucleotide sequence. In certain embodiments, following conceptual design of the zinc finger DNA-binding domain, a polynucleotide encoding the zinc finger nuclease is constructed, using standard molecular biological methods.
[0113] Zinc finger nucleases, for facilitating mutagenesis of the human glucocorticoid receptor gene, are designed and synthesized as follows. The nucleotide sequences of relevant portions of the human glucocorticoid receptor gene are obtained. The sequences thus obtained are scanned, optionally using a computer program containing a listing of individual zinc fingers and their target sites and/or a listing of two-finger modules and their target sites, for a pair of target sequences, separated by 5-6 nucleotide pairs, wherein each target sequence can be bound by a 3-, 4-, 5- or 6-finger zinc finger protein. See, for example, U.S. Pat. No. 6,785,613; International Patent Publications Nos. WO 98/53057 and WO 01/53480 and U.S. Patent Publication No. 2003/0092000. Additional methods for ZFP design are disclosed, for example, in U.S. Pat. Nos. 5,789,538; 6,013,453; 6,410,248; 6,733,970; 6,746,838; 6,785,613; 6,866,997 and 7,030,215; International Patent Publications Nos. WO 01/088197; WO 02/099084; and U.S. Patent Publication Nos. 2003/0044957; 2003/0108880; 2003/0134318 and 2004/0128717.
[0114] For each target sequence identified in the previous step, a gene encoding a fusion between a FokI cleavage half-domain and a zinc finger protein that binds to the target sequence is synthesized. See, for example, U.S. Pat. No. 5,436,150; International Patent Publication No. WO 2005/084190 and U.S. Patent Publication No. 2005/0064474. Each fusion protein can be tested for the affinity with which it binds to its target sequence, using an ELISA assay as described, for example, by Bartsevich et al. (2003) Stem Cells 21:632-637. Proteins having target sequence binding affinities which exceed a predetermined threshold value can subjected to further testing in a cell-based reporter assay.
[0115] Optionally, the binding specificity of one or more fusion proteins as described above can be assessed and, if necessary, improved, by alteration (including randomization) of one or more amino acid residues followed by a phage display assay against the target sequence (see, for example, International Patent Publication No. WO 96/06166), and/or by methods of iterative optimization described in U.S. Pat. No. 6,794,136.
[0116] Cell-based testing is conducted as described, for example, in Urnov et al. (2005) Nature 435:646-651 and U.S. Patent Publication No. 2005/0064474. Briefly, a target sequence pair, identified as described above, is inserted into a defective chromosomal green fluorescent protein (GFP) gene, under the transcriptional control of a doxycycline-inducible promoter, in an appropriate cell line. Cells are transfected with nucleic acids encoding two zinc finger/FokI fusion proteins (each of which binds to one of the target sequences) and with a nucleic acid containing sequences that, if they serve as template for homology-directed repair of the defective chromosomal GFP gene, will reconstitute a functional GFP gene. Cells in which homology-directed repair has occurred can be identified and quantitated by fluorescence-activated cell sorting, following induction with doxycycline.
Zinc Finger Binding Domains Targeted to the Human Glucocorticoid Receptor Gene
[0117] Methods for inactivation of GR disclosed herein utilize zinc finger nucleases, comprising (1) a zinc finger DNA-binding domain which has been engineered to bind a target sequence of choice and (2) a cleavage domain or cleavage half-domain. Any such zinc finger nuclease having a target site in a human GR gene can be used in the disclosed methods. Alternatively, any pair of zinc finger nucleases, each comprising a cleavage half-domain, whose target sequences are separated by the appropriate number of nucleotides, can also be used. See, for example, U.S. Patent Publication No. 2005/0064474; Smith et al. (2000) Nucleic Acids Res. 28:3361-3369 and Bibikova et al. (2001) Mol. Cell. Biol. 21:289-297.
[0118] Exemplary zinc finger binding domains having target sites in the human GR gene are disclosed in Tables 1 and 2. Table 1 provides the target sequences of the exemplary binding domains and the location of those target sites in the GR gene. Table 2 shows the amino acid sequences of the engineered recognition regions (responsible for DNA-binding specificity) of these binding domains. Zinc finger sequences are shown in amino-to-carboxy order, with F1 denoting the zinc finger nearest the amino terminus of the protein.
TABLE-US-00001 TABLE1 TargetSequencesforGR-TargetedZFNs Name.sup.1 TargetSequence.sup.2 Location.sup.3 8718,9967 GACCTGtTGATAG nt778-790sense(exon2) (SEQIDNO:1) 8893 GACCTGtTGATAGATG nt778-793sense(exon2) (SEQIDNO:2) 8719,10415,10404 TCCAAGGACTCT nt761-772antisense(exon2) (SEQIDNO:3) 8667,9666 CAACAGGACCAC nt1370-1381sense(exon3) (SEQIDNO:4) 8668,8669,9671,9674, GTTGAGGAGCTG nt1353-1364antisense(exon3) 10201,10205 (SEQIDNO:5) 8531,9737,9846 AATGAGTAAGTTG nt2020-2023sense(exon6)+ (SEQIDNO:6) first9ntinintron6 8653 TCAGATCAGGAG nt2003-2014antisense(exon6) (SEQIDNO:7) .sup.1Each zinc finger binding domain is represented by a four- or five-digit number. Relevant amino acid sequences of these binding domains are shown in Table 2. .sup.2Nucleotides in uppercase represent those present in target subsites bound by individual zinc fingers; nucleotides indicated in lowercase are not present in a subsite. See U.S. Pat. No. 6,453,242 and U.S. Patent Publication No. 2005-0064474 (both incorporated by reference) for a description of target subsites. .sup.3Locations in the human glucocorticoid receptor locus are given with respect to the published sequence of the GRmRNA. Hollenberg, S.M. et al. (1985). Nature 318(6047): 635-41; GenBank accession number X03225.
TABLE-US-00002 TABLE2 AminoAcidSequencesofRecognitionRegionsofGR-TargetedZFNs Name F1 F2 F3 F4 F5 Exon2 8718 RSDYLST QNAHRKT RSDVLSA DRSNRIK (SEQID (SEQID (SEQID (SEQID NO:8) NO:9) NO:10) NO:11) 9967 RSDYLST QRSHRNT RSDVLSA DRSNRIK (SEQID (SEQID (SEQID (SEQID NO:8) NO:12) NO:10) NO:11) 8893 RSDALTQ RSDYLST QNAHRKT RSDVLSE DRSNLTR (SEQID (SEQID (SEQID (SEQID (SEQID NO:13) NO:8) NO:9) NO:14) NO:15) 8719 DSDHLTE DRANLSR RSDNLSN TNSNRIK (SEQID (SEQID (SEQID (SEQID NO:16) NO:17) NO:18) NO:19) 10404 TSSDRKK DRANLSR RSDTLRC TNSNRIK (SEQID (SEQID (SEQID (SEQID NO:20) NO:17) NO:21) NO:19) 10415 TSSDRKK DRANLSR RSDNLSN ERRSLRY (SEQID (SEQID (SEQID (SEQID NO:20) NO:17) NO:18) NO:22) Exon3 8667 TSRALTA DRANLSR RSDNLSE QNANRKT (SEQID (SEQID (SEQID (SEQID NO:23) NO:17) NO:24) NO:25) 9666 TSRALTA DRANLSR RSDNLSE ERANRNS (SEQID (SEQID (SEQID (SEQID NO:23) NO:17) NO:24) NO:26) 8668 RSDVLSE RSANLTR RSDNLST HSHARIK (SEQID (SEQID (SEQID (SEQID NO:14) NO:27) NO:28) NO:29) 8669 RSDVLSE RSANLTR TSGNLTR TSGSLTR (SEQIDNO:14) (SEQIDNO:27) (SEQIDNO:30) (SEQIDNO:31) 9671 DGWNRDC RSANLTR TSGNLTR TSGSLTR (SEQIDNO:32) (SEQIDNO:27) (SEQIDNO:30) (SEQIDNO:31) 9674 DSWNLQV RSANLTR TSGNLTR TSGSLTR (SEQIDNO:33) (SEQIDNO:27) (SEQIDNO:30) (SEQIDNO:31) 10201 TNRDLND DRANLSR RSDNLSE ERANRNS (SEQIDNO:34) (SEQIDNO:17) (SEQIDNO:24) (SEQIDNO:26) 10205 NRKNLRQ DRANLSR RSDNLSE ERANRNS (SEQIDNO:35) (SEQIDNO:17) (SEQIDNO:24) (SEQIDNO:26) Exon6 8531 RSDSLSA RNDNRKT RSDNLSR TNQNRIT (SEQIDNO:36) (SEQIDNO:37) (SEQIDNO:38) (SEQIDNO:39) 9737 RQDCLSL RNDNRKT RSDNLSR TNQNRIT (SEQIDNO:40) (SEQIDNO:37) (SEQIDNO:38) (SEQIDNO:39) 9846 HKHVLDN RNDNRKT RSDNLSR TNQNRIT (SEQIDNO:41) (SEQIDNO:37) (SEQIDNO:38) (SEQIDNO:39) 8653 RSANLAR RSDNLRE QSSNLAR QSADRTK (SEQIDNO:42) (SEQIDNO:43) (SEQIDNO:44) (SEQIDNO:45)
Cleavage Domains
[0119] Any zinc finger that binds to a target site in a GR gene can be combined with a nuclease to form a zinc finger nuclease. As noted above, any cleavage domain or cleavage half-domain can be used in the zinc finger nucleases described herein. See, U.S. Patent Publication No. 2005/0064474. Thus, the cleavage domain portion of the fusion proteins disclosed herein can be obtained from any endo- or exonuclease. Exemplary endonucleases from which a cleavage domain can be derived include, but are not limited to, restriction endonucleases and homing endonucleases. See, for example, 2002-2003 Catalogue, New England Biolabs, Beverly, Mass.; and Belfort et al. (1997) Nucleic Acids Res. 25:3379-3388. Additional enzymes which cleave DNA are known (e.g., 51 Nuclease; mung bean nuclease; pancreatic DNase I; micrococcal nuclease; yeast HO endonuclease; see also Linn et al. (eds.) Nucleases, Cold Spring Harbor Laboratory Press, 1993). One or more of these enzymes (or functional fragments thereof) can be used as a source of cleavage domains and cleavage half-domains. In certain embodiments, the cleavage domain is obtained from a nuclease that has separable binding and cleavage domains, for example a yeast HO endonuclease.
[0120] Exemplary cleavage half-domains can be obtained from any endonuclease. In certain embodiments, the cleavage half-domain is obtained from a nuclease that has separable binding and cleavage domains, for example a Type IIS restriction endonuclease such as FokI. In addition, engineered cleavage half-domains (also referred to as dimerization domain mutants) that minimize or prevent homodimerization are described, for example, in U.S. Patent Publication Nos. 2005/0064474 and 2006/0188987, incorporated by reference in their entireties herein. Amino acid residues at positions 446, 447, 479, 483, 484, 486, 487, 490, 491, 496, 498, 499, 500, 531, 534, 537, and 538 of Fok I are all targets for influencing dimerization of the FokI cleavage half-domains.
[0121] Described herein are additional engineered cleavage half-domains of FokI that form an obligate heterodimer. The first cleavage half-domain includes mutations at amino acid residues at positions 490 (E in the wild-type sequence, underlined below) and 538 (I in the wild-type sequence, underlined below) of FokI and the second cleavage half-domain includes mutations at amino acid residues 486 (Q in the wild-type sequence, underlined below) and 499 (I in the wild-type sequence, underlined below).
TABLE-US-00003 WildtypeFokIcleavagehalfdomain (SEQIDNO:46) QLVKSELEEKKSELRHKLKYVPHEYIELIEIARNSTQDRILEMKVMEFFM KVYGYRGKHLGGSRKPDGAIYTVGSPIDYGVIVDTKAYSGGYNLPIGQAD EMQRYVEENQTRNKHINPNEWWKVYPSSVTEFKFLFVSGHFKGNYKAQLT RLNHITNCNGAVLSVEELLIGGEMIKAGTLTLEEVRRKFNNGEINF E490K:I538Kdimerizationmutant (SEQIDNO:47) QLVKSELEEKKSELRHKLKYVPHEYIELIEIARNSTQDRILEMKVMEFFM KVYGYRGKHLGGSRKPDGAIYTVGSPIDYGVIVDTKAYSGGYNLPIGQAD EMQRYVKENQTRNKHINPNEWWKVYPSSVTEFKFLFVSGHFKGNYKAQLT RLNHKTNCNGAVLSVEELLIGGEMIKAGTLTLEEVRRKFNNGEINF Q486E:I499Ldimerizationmutant (SEQIDNO:48) QLVKSELEEKKSELRHKLKYVPHEYIELIEIARNSTQDRILEMKVMEFFM KVYGYRGKHLGGSRKPDGAIYTVGSPIDYGVIVDTKAYSGGYNLPIGQAD EMERYVEENQTRNKHLNPNEWWKVYPSSVTEFKFLFVSGHFKGNYKAQLT RLNHITNCNGAVLSVEELLIGGEMIKAGTLTLEEVRRKFNNGEINF
[0122] As shown above, the mutation at 490 replaces Glu (E) with Lys (K); the mutation at 538 replaces Ile (I) with Lys (K); the mutation at 486 replaces Gln (Q) with Glu (E); and the mutation at position 499 replaces Ile (I) with Leu (L). Specifically, the engineered cleavage half-domains described herein were prepared by mutating positions 490 (E.fwdarw.K) and 538 (I.fwdarw.K) in one cleavage half-domain to produce an engineered cleavage half-domain designated E490K:I538K as shown above, and by mutating positions 486 (Q.fwdarw.E) and 499 (I.fwdarw.L) in another cleavage half-domain to produce an engineered cleavage half-domain designated Q486E:I499L as shown above. These mutations result in a diminished ability of two cleavage half-domains containing the E490K:I538K mutations to form a homodimer, (compared to wild-type FokI cleavage half-domains); similarly, two cleavage half-domains containing the Q486E:I499L mutations are also unable to form a homodimer. However, a cleavage half-domain containing the E490K:I538K mutation is capable of forming a heterodimer with a cleavage half-domain containing the Q486E:I499L mutations to reconstitute a functional cleavage domain capable of double-strand DNA cleavage. Furthermore, heterodimerization between E490K:I538K- and Q486E:I499L-containing cleavage half-domains occurs with an efficiency similar to that of dimerization between wild-type FokI cleavage half-domains. Thus, the engineered cleavage half-domains described herein are obligate heterodimer mutants in which aberrant cleavage is minimized or abolished.
[0123] Engineered cleavage half-domains described herein can be prepared using any suitable method, for example, by site-directed mutagenesis of wild-type cleavage half-domains (e.g., FokI) as described in U.S. Patent Publication No. 2005/0064474 (Example 5) and U.S. Patent Publication No. 2007/0134796 (Example 38), incorporated by reference in their entireties herein.
Methods of Treatment
[0124] In certain types of cancer immunotherapy, T-cells are engineered to express cell-surface proteins that recognize tumor cell-specific antigens, and these engineered T-cells are introduced into a subject. For example, glioblastoma patients, who have tumor cells that overexpress an IL-13 receptor on their surface, can be treated, following surgical resection of the tumor(s), with cytolytic T-cells that express a zetakine tethered to their cell surface. Zetakines are chimeric transmembrane immunoreceptors, comprised of an extracellular domain comprising a soluble receptor ligand linked to a support region capable of tethering the extracellular domain to a cell surface, a transmembrane region and an intracellular signaling domain. When expressed on the surface of T lymphocytes, such chimeric receptors direct T cell activity to those specific cells expressing a receptor for which the soluble receptor ligand is specific.
[0125] For treatment of gliomas and glioblastomas, zetakines are targeted to cells expressing IL-13 receptors. Thus, a zetakine can constitute a glioma-specific immunoreceptor comprising the extracellular targeting domain of the IL-13Ralpha.2-specific IL-13 mutant IL-13(E13Y) linked to the Fc region of IgG, the transmembrane domain of human CD4, and the human CD3 zeta chain. T-cells expressing such a zetakine are able to detect and kill IL-13-overexpressing glioma and glioblastoma tumor cells remaining after surgical tumor resection. See, for example, Kahlon, K. S. et al. (2004) Cancer Res. 64:9160-9166 and U.S. Patent Publication Nos. 2006/0067920; 2005/0129671 and 2003/0171546, the disclosures of which are incorporated by reference in their entireties for all purposes.
[0126] However, the clinical use of this approach is hampered by the fact that brain tumor patients must also be treated with glucocorticoid hormones following tumor resection, to prevent inflammation and swelling of the brain. This glucocorticoid treatment inhibits activation of the zetakine-containing T-cells, thus preventing their cell-killing activity.
[0127] The methods and compositions disclosed herein make it possible to eradicate GR function in the zetakine-containing T-cells, thereby making them resistant to the inhibitory effect of glucocorticoids. Accordingly, by use of the disclosed methods and compositions, the post-surgical glioblastoma patient can be treated both with glucocorticoids (to prevent swelling and inflammation) and with the zetakine-containing T-cells, to remove residual tumor cells. Indeed, inactivation of the GR gene in the T-cells can be accomplished by targeted integration of a sequence encoding the zetakine into the GR locus, accomplishing both objectives in a single step.
[0128] Accordingly, in certain embodiments, GR-targeted zinc finger nucleases are expressed in T-cells and cleave at a site in the GR locus. Cells containing GR-targeted zinc finger nucleases are optionally contacted with a donor DNA molecule which encodes a zetakine, such that the zetakine-encoding sequences are integrated into the GR locus, thereby inactivating GR function in those cells.
Additional Applications
[0129] Treatment of patients with engineered T-cells or isolated T-cells is compromised if these patients are also treated with immune-suppressant drugs such as decadrone. However, modification of such therapeutic immune cells, using ZFNs targeting the GR locus to inactivate GR function as disclosed herein, allows generation of a population of immune cells that is not subject to glucocorticoid-mediated immune suppression. The high efficiency of the methods described herein allows simultaneous disruption of both alleles of the GR gene in the absence of a selection marker, which is not possible with any other technique. The speed with which mutations in both alleles of the GR gene (including homozygous deletions) can be obtained is also an important consideration since T-cells, like all primary cells, have a limited replication potential and therefore a finite lifespan.
[0130] The methods disclosed herein for modification of the sequence of the GR locus in human cells allow generation of pools of cells containing a substantial number of cells lacking GR function and also allow isolation of clonal cell lines lacking GR activity. Such cells include but are not limited to T-cells and other cells of the immune system (e.g., B-cells, NK cells, memory cells, macrophages) all of which are normally prevented from undergoing proper activation in the presence of glucocorticoid hormones, due to the action of the glucocorticoid receptor.
[0131] As discussed above, one application of these methods is the use of ZFNs to render zetakine expressing T-cells, which target brain tumor cells, non-responsive to glucocorticoids. Other examples include ZFN-mediated inactivation of GR in T-cells used for treating opportunistic infections, e.g., in transplant patients receiving immunosuppressants, or in other immunocompromised patients.
[0132] Additional clinical complications of undesired GR activity can also be alleviated by inactivation of GR activity in a specific target cell population. In this context, it is noted that the pleiotropic activity of the GR is based, in part, on the existence of multiple receptor isoforms generated from the same gene. See, for example, Zhou, J. et al. (2005) Steroids 70:407-417. The single nucleotide-level resolution of ZFN-mediated GR gene modifications described herein, in combination with tissue-specific ZFN expression, (see, for example, U.S. Pat. No. 6,534,261 and U.S. Patent Publication No. 2005/0064474, both incorporated by reference) together enable disruption of specific receptor isoforms in specific tissues: an approach that is not possible with any other technology. In addition, alteration of the sequence of the GR gene using ZFNs can be used to replace the wild-type GR with an isoform that is regulated exclusively by a specific ligand of choice.
[0133] Conversely, in patients with mutations in the GR locus, ZFN-mediated genome editing can be used to restore GR activity in a target tissue of choice, either through correction of the mutation itself or by targeted insertion of a sequence (e.g., cDNA) encoding a functional GR.
[0134] The methods and compositions disclosed herein can also be used to generate cell lines for research applications, drug screening and target validation. For instance, abolishing GR function in a cell line of choice, using ZFNs as disclosed herein, allows generation of a matched pair of isogenic cell lines that differ only in the presence or absence of GR function. As another example, insertion of a reporter gene into the GR locus, or fusion of a reporter to the GR protein, will facilitate high-resolution studies of the properties and regulation of the glucocorticoid receptor. Such lines can be used for research purposes, as well as for industrial applications such as target validation and drug screening. Similarly, ZFN-mediated gene correction can be used to introduce specific changes into the GR locus to generate cell lines for studying the function of various receptor domains or isoforms.
[0135] Finally, in cases in which inactivation of the GR locus is not the main purpose of the intervention, but would have no negative effects on the modified cells, the GR locus can be used as a safe harbor integration site for any transgene in any gene therapy application. Thus, the disclosure also provides methods of selection for cells into which an exogenous sequence has been integrated into a GR gene. The methods involve cleaving an endogenous GR gene in a cell with ZFNs as described herein and introducing an exogenous sequence (e.g., transgene), typically on a donor construct with GR-homology arms, into the cells under conditions such that the exogenous sequence is integrated into the GR gene. Cells with the integrated exogenous sequence can then be selected for by exposing the cells to a naturally occurring or synthetic corticosteriod (e.g., cortisol, dexamethasone, etc.), which kills cells without the integrated sequence (cells with normal GR expression). See, also, Example 4.
Vectors for Delivery of Zinc Finger Nucleases and Donor DNA Sequences
[0136] Any vector can be used for delivery, to a cell, of DNA sequences encoding zinc finger nucleases and/or delivery of donor DNA. Exemplary viral vectors include adenoviruses, adeno-associated viruses, poxviruses, herpesviruses, papovaviruses, retroviruses and lentiviruses. DNA can also be delivered to cells by transfection, electroporation, lipid-mediated methods, biolistics and calcium phosphate-mediated transfer.
[0137] Because the methods and compositions disclosed herein utilize a transient event (ZFN-mediated double-strand cleavage) to effect a permanent genomic alteration (e.g., targeted mutation or targeted integration of exogenous sequences), it is not necessary to use a delivery vector that persists in the cells. Accordingly, non-replicating viral vectors can be used as delivery vehicles. Thus, replication-defective adenoviruses, hybrid adenoviruses (e.g., Ad 5/35) and non-integrating lentivirus vectors are all suitable as delivery vehicles.
[0138] Non-limiting examples of adenovirus (Ad) vectors that can be used in the present application include recombinant (such as E1 deleted), conditionally replication competent (such as oncolytic) and/or replication competent Ad vectors derived from human or non-human serotypes (e.g., Ad5, Ad11, Ad35, or porcine adenovirus-3); chimeric Ad vectors (such as Ad5/35) or tropism-altered Ad vectors with engineered fiber knob proteins (such as peptide insertions within the HI loop of the knob protein); and/or gutless Ad vectors, e.g., an Ad vector in which all adenovirus genes from the Ad genome have been removed to reduce immunogenicity and to increase the size of the DNA payload to allow simultaneous delivery of both ZFNs and donor molecule, especially large transgenes to be integrated via targeted integration.
[0139] Replication-deficient recombinant adenoviral vectors (Ad) can be produced at high titer and readily infect a number of different cell types. Most adenovirus vectors are engineered such that a transgene replaces the Ad E1a, E1b, and/or E3 genes; subsequently the replication defective vector is propagated in human 293 cells that supply deleted gene function in trans. Ad vectors can transduce multiple types of tissues in vivo, including nondividing, differentiated cells such as those found in liver, kidney and muscle. Conventional Ad vectors have a large carrying capacity. An example of the use of an Ad vector in a clinical trial involved polynucleotide therapy for antitumor immunization with intramuscular injection. Sterman et al. (1998) Hum. Gene Ther. 7:1083-1089.
[0140] Additional examples of the use of adenovirus vectors for gene transfer in clinical trials include Welsh et al. (1995) Hum. Gene Ther. 2:205-218; Rosenecker et al. (1996) Infection 24:5-10; Alvarez et al. (1997) Hum. Gene Ther. 5:597-613 and Topf et al. (1998) Gene Ther. 5:507-513.
[0141] In certain embodiments, the Ad vector is chimeric adenovirus vector, containing sequences from two or more different adenovirus genomes. For example, the Ad vector can be an Ad5/35 vector. Ad5/35 is created by replacing the fiber protein of Ad5 with the fiber protein from B group Ad35. The Ad5/35 vector and characteristics of this vector are described, for example, in Ni et al. (2005) Hum. Gene Ther. 16:664-677; Nilsson et al. (2004) Mol. Ther. 9:377-388; Nilsson et al. (2004) J. Gene. Med. 6:631-641; Schroers et al. (2004) Exp. Hematol. 32:536-546; Seshidhar et al. (2003) Virology 311:384-393; Shayakhmetov et al. (2000) J. Virol. 74:2567-2583 and Sova et al. (2004) Mol. Ther. 9:496-509.
EXAMPLES
[0142] The following examples are presented as illustrative of, but not limiting, the claimed subject matter.
Example 1: Construction of Plasmid Delivery Vehicles Encoding Zinc Finger Nucleases Targeted to a Human GR Gene
[0143] Target sites for zinc finger DNA-binding domains were selected by scanning the sequence of the human glucocorticoid receptor (GR) gene, optionally using a computer program containing a listing of individual zinc fingers and their target sites and/or a listing of two-finger modules and their target sites, for a pair of target sequences, separated by 5-6 nucleotide pairs, wherein each target sequence can be bound by a 3-, 4-, 5- or 6-finger zinc finger protein. See, for example, U.S. Pat. No. 6,785,613; International Patent Publication Nos. WO 98/53057 and WO 01/53480 and U.S. Patent Publication No. 2003/0092000. Additional methods for ZFP design are disclosed, for example, in U.S. Pat. Nos. 5,789,538; 6,013,453; 6,410,248; 6,733,970; 6,746,838; 6,785,613; 6,866,997 and 7,030,215; International Patent Publication Nos. WO 01/088197; WO 02/099084; and U.S. Patent Publication Nos. 2003/0044957; 2003/0108880; 2003/0134318 and 2004/0128717.
[0144] For certain of the target sequences identified in the previous step, a gene encoding a fusion between a FokI cleavage half-domain and a zinc finger protein that binds to the target sequence was synthesized. See, for example, U.S. Pat. No. 5,436,150; International Patent Publication No. WO 2005/084190 and U.S. Patent Publication No. 2005/0064474.
[0145] Standard molecular biological methods were used to construct such fusion genes and introduce them into plasmids. Exemplary expression constructs are shown in
Example 2: Targeted Cleavage of a Human GR Gene Using Engineered Zinc Finger Nucleases
[0146] K562 cells (ATCC No. CCL243) were cultured in RPMI medium (Invitrogen, Carlsbad, Calif.). At a density of 110.sup.6 cells/ml, 210.sup.6 cells were pelleted and transfected with 2.5 g each of two ZFN expression vectors, using an Amaxa nucleofection device (Amaxa, Gaithersburg, Md.). One set of cells was transfected with plasmids encoding zinc finger nucleases comprising the exon 3-targeted 9666 and 9674 binding domains (see Tables 1 and 2). A second set of cells was transfected with plasmids encoding zinc finger nucleases comprising the exon 6-targeted 8653 and 9737 binding domains (see Tables 1 and 2). Controls included cells transfected with a plasmid encoding green fluorescent protein (GFP) and untransfected cells.
[0147] Three days after transfection, DNA was isolated from the cells using a DNeasy kit (Qiagen, Valencia, Calif.). This DNA (100 ng) was used as template for PCR amplification using primers specific for either exon 3 or exon 6 of the GR locus (see Table 3). The amplification products were denatured, then reannealed; and the reannealed products were exposed to the mismatch-specific nuclease Cel-I (Transgenomic, Omaha, Nebr.). Products of Cel-I treatment were analyzed on a 10% polyacrylamide gel. If the population of amplification products is homogeneous with respect to nucleotide sequence, perfectly-matched duplexes, that are resistant to Cel-I cleavage, should be produced following denaturation and reannealing. If, on the other hand, the amplification products are heterogeneous due to the presence of insertions, deletions and/or mismatches in some of the amplification products, reannealing will generate some duplexes containing sequence mismatches, susceptible to Cel-1 cleavage. As a result, products smaller than the amplification product will be detected on the gel.
TABLE-US-00004 TABLE3 PCRprimersinthehumanGRlocus Exon3sense TCATAACACTGTTCTTCCCCTTCTTTAGCC (SEQIDNO:49) Exon3antisense TCAAAACACACACTACCTTCCACTGCTC (SEQIDNO:50) Exon6sense ACACCTGGATGACCAAATGACCCTAC (SEQIDNO:51) Exon6antisense CCTAGATACCTAGTAGGATTGTTTCAGTCCTG (SEQIDNO:52)
[0148] The results are shown in
Example 3: Nature of Mutations Induced by Targeted Cleavage in a Human GR Gene
[0149] CEM14 cells (a glucocorticoid-sensitive lymphoid cell line obtained from M. Jensen, City of Hope Medical Center, Duarte, Calif.) were cultured in RPMI medium. At a density of 110.sup.6 cells/ml, 210.sup.6 cells were pelleted and transfected with plasmids encoding ZFNs with the exon 3-targeted 8667 and 8668 DNA-binding domains (see Tables 1 and 2), using an Amaxa nucleofection device. 2.5 g of each plasmid was used. Cells lacking GR function were selected by exposure to 10.sup.5 M dexamethasone for 14 days; and DNA isolated from dexamethasone-resistant cells was amplified by PCR using GR exon 3-specific primers (see Table 3). The amplification reaction mixture was fractionated on an agarose gel and a band corresponding in size to the expected amplification product (based on the location of the primer sequences in the GR gene) was excised from the gel. DNA in this band was cloned using a Topo cloning kit (Invitrogen, Carlsbad, Calif.) and nucleotide sequences of individual clones was determined.
[0150] In one clone, sequence analysis revealed the presence of a two-nucleotide deletion near the site of targeted cleavage. In a second clone, an 11-nucleotide deletion was detected. A third clone comprised a mixture of sequences: one of which was a duplication of four nucleotides, the other of which was a 19-nucleotide deletion.
[0151] These results show that targeted cleavage of the GR gene, using zinc finger nucleases, induced both insertion and deletion mutations in the gene, all of which resulted in a change in the translational reading frame.
[0152] RNA analysis in these dexamethasone-resistant cells revealed lower levels of GR mRNA, compared to untransfected cells; indicative of nonsense-mediated decay of aberrant GR transcripts.
Example 4: Introduction of a Transgene Into the Human GR Locus
[0153] Glucocorticoid hormones trigger apoptosis or slow down cell growth in many primary cells and cell lines. Glucocorticoid hormone treatment can therefore be used in combination with ZFNs targeting the GR locus to select or enrich for a) cells containing a ZFN mediated biallelic mutation of the GR locus, b) cells containing ZFN mediated targeted integration of donor DNA sequences into both alleles of the GR locus, resulting in the inactivation of GR function or c) cells containing a ZFN mediated GR mutation on one allele of the GR locus and ZFN mediated targeted integration on the other allele.
[0154] Sequences that can be integrated into the GR locus in this manner include but are not limited to expression cassettes with any transgene of choice. Potential benefits of using integration into the GR locus include but are not limited to a) avoiding the use of a selection marker on the donor molecule, b) long term stability of the expression of the transgene from a locus compatible with high level gene expression and not subjected to silencing, c) avoiding insertional mutagensis events that can occur upon random integration of transgenes. The following experiments were conducted using a zetakine transgene.
[0155] CEM14 cells were cultured in RPMI medium and transfected (as described in previous examples), in separate experiments, with 25 g of an expression construct encoding the GR-targeted ZFNs 9666 and 9674 and a zetakine transgene. The zetakine-donor ZFN construct was transfected into CEM14 cells and an aliquot of the transfected cells was incubated with dexamethasone (which kills cells having normal GR function) for 2 weeks, while the remaining cells were left untreated. Untransfected cells were used as controls and treated identically. After dexamethasone treatment, targeted integration of the zetakine transgene into the GR locus was detected by PCR (
[0156] These results demonstrated that targeted integration of a donor sequence in the human GR gene was accomplished, that integration of the donor sequence inactivated GR function, and that normal function of a transgene contained in the donor sequence was obtained.
Example 5: GR Polypeptide Production After Targeted Integration of an Exogenous Sequence in the GR Gene
[0157] CEM14 cells were cultured in RPMI medium and transfected as above with 25 g of an expression vector containing a zetakine cassette and encoding the GR exon 3-targeted ZFN pair 8667 and 8669, flanked by regions of homology to the GR gene. Two days after transfection, 10.sup.6M dexamethasone was added to the growth medium, and glucocorticoid-resistant clones were obtained after two weeks of selection.
[0158] Protein extracts from transfected cells that survived the dexamethasone treatment were prepared by whole cell lysis, and Western Blot analysis was performed using an antibody to the human GR (Catalog number 611226, BD BioSciences Pharmingen, San Jose Calif.). Results are shown in
Example 6: Targeted Cleavage of a Human GR Gene in CD8.SUP.+ T-Cells
[0159] Fresh human peripheral blood CD8.sup.+ T-Cells were obtained from AllCells (Berkeley, Calif.). 210.sup.6 cells were transfected, using an Amaxa nucleofection device and protocol, with 5 g of an expression plasmid encoding two zinc finger nucleases targeting exon 3 of the human GR locus, in which the ZFN coding sequences were separated by a 2A sequence. Two exon 3-targeted ZFN pairs (9666-9671 and 9666-9674) were tested in separate transfections. Controls were untransfected cells and cells transfected with a plasmid encoding green fluorescent protein (GFP).
[0160] Transfected CD8.sup.+ cells were cultured for 48 hours in X-VIVO15 medium containing 5% human serum (both purchased from Cambrex, Walkersville, Md.). Thereafter, DNA was isolated and Cel I analysis was performed as described in Example 2 above, using exon 3-specific amplification primers, except that 5 Ci each of -.sup.32P-dCTP and -.sup.32P-dATP (Perkin-Elmer, Boston, Mass.) were added to the PCR reaction.
[0161] Following Cel I treatment, digestion products were fractionated on a 10% acrylamide gel. An autoradiographic image of the gel was developed using a Storm Phosphorlmager (GE Healthcare, Piscataway, N.J.). Results are shown in
Example 7: Analysis of GR-ZFN-Treated CD-8.SUP.+ T-Cells
[0162] A. ZFNs Generate Mutations at GR Locus
[0163] Fifty million human CD8+ T-cells cells expressing a zetakine transgene (IL-13 ZK Pool) were stimulated at day 0 and infected at day 7 with Ad5/F35 expressing the ZFN pair 9666 and 9674 at the following multiplicity of infections (mois): 10 (ZFN10-), 30 (ZFN30-) and 100 (ZFN100-). As a control, CD8+ cells were also infected with a GFP expressing Ad5/F35 virus at the same mois (GFP10-, GFP30-, GFP100-).
[0164] Cells were grown as described above and 7 days post-infection cells were treated for 6 days with the glucocorticoid hormone dexamethasone at a concentration of 10.sup.4M in the absence of cytokines. The resulting cell pools (ZFN10ZFN30, ZFN100 and GFP10, GFP30, GFP100, respectively) were restimulated and 12 days after restimulation cells were harvested. DNA was isolated and analyzed for modification of the GR locus by PCR of the ZFN target region followed by the Cel I Surveyor endonuclease assay as described in Example 2 above. As shown in
[0165] The PCR products were also subcloned into the PCR4 TOPO vector and the insert sequence analyzed using the T7 primer. Sequencing of the ZFN target region in exon 3 of the GR locus in cells pool ZFN100 demonstrated that 70% of the GR alleles contained mutations in the ZFN binding region. By contrast, no mutations were found in the GR alleles when cells had been infected with the GFP100 control virus.
[0166] Glucocorticoid hormone resistance of the CD8+ cell pools was also determined by comparing cell viability before and after a second treatment with 10-4M Dexamethasone for 8 days. Viability was measured using the Guava cell analyzer. As shown in
[0167] B. GR Protein Expression in ZFN-Modified CD8+ T-Cells
[0168] ZFN-treated CD8+ T-cells were also tested for the presence of full-length GR protein.
[0169] In one experiment, protein extract from CD8+ cell pools described above and from the zetakine expressing CD8+ cell pool that was used for the virus transduction (IL-13 ZK pool) were analyzed by Western Blotting using GR (BD BioSciences) and TFIIB (Santa Cruz Antibodies) antibodies. In addition a subclone (10A1) of the ZFN 100 pool was analyzed alongside the cell pools. As shown in
[0170] In a separate experiment, expression of GR was also assessed in ZFN treated CMV-targeted CD8+subclones. In particular, GR-negative CD8+ cells that target CMV were generated using ZFNs as described herein. Single cell derived subclones of these cells were isolated and protein extracts were obtained from these clones as described above. Genotyping of 26 subclones identified 2 wildtype clones and 24 clones with mutations in the GR locus comprising the ZFN binding regions. As above, protein extracts were analyzed by Western Blotting with a human GR antibody (BD BioSciences). As shown in
[0171] Thus, ZFNs as described herein can reduce or eliminate GR protein expression in primary cells.
[0172] C. RT-PCR
[0173] In addition, GR-negative (ZFN-treated) CD8+ T-cells were analyzed by RT-PCR to determine the effect of glucocorticoid addition on the expression of known GR target genes. Results are shown in
[0174] D. Cytokine Release
[0175] Cytokine release from ZFN-treated CD8+ T-Cells stimulated with glioma cells was also evaluated. GFP100, ZFN100 and untreated CD8+ T-cell pools were cultured alone or in the presence of U87MG glioblastoma stimulator cells. Subsequently, 10.sup.6M dexamethasone was added to the culture. After 20 hrs, cell culture supernatants were harvested and IFN- levels analyzed using a commercially available ELISA kit (R&D systems).
[0176] As shown in
[0177] E. Chromium Release Assay For Cytolytic Activity
[0178] To analyze the cytolytic activity of ZFN treated CD8+ T-cells chromium release assays were conducted at various ratios of effector (ZFN-treated or control CD8+ T-cells) to target cells (IL13R2 positive cell lines and control cell line).
[0179] As shown in
Example 8: In Vivo Administration of ZFN-Treated, GR-Negative CD8+ T-Cells
[0180] ZFN-treated GR-negative CD8+ T-cells were also analyzed for tumor cell killing activity in vivo. Tumor cell cyotoxicity was measured in an orthotopic glioblastoma mouse model using luciferase labeled U87MG cells injected into the brain at day 0. At day 5, controls or ZFN-treated CD8+ T-cells were injected into the brain and tumor volumes were determined by measuring luciferase activity up to day 24.
[0181] As shown in
Example 9: Analysis of GR ZFN Specificity
[0182] To analyze the specificity of the GR ZFNs 9666 and 9674 in cells, we first determined consensus DNA binding site for both the 9666 and the 9674 ZFNs in vitro using an affinity-based target site selection procedure (SELEX). See, also, U.S. Pat. No. 7,951,925. An experimental overview is provided in
[0183] A consensus based on the site selection data was used to guide a genome-wide bioinformatic prediction of the most similar putative off-target sites in the human genome. The resulting list of potential cleavage sites was then ranked to give priority to those sites with the highest similarity to the experimentally derived binding site preferences.
[0184] NR3C1 (the GR locus) contains the best match to the binding site preferences determined in the site selection experiments. Of the 15 potential off-target sites, 10 fall within annotated genes, and only 2 occur within exonic sequences. For none of these ten genes, has mutation or disruption been associated with any known pathology in CD8+ T cells.
[0185] Genotyping of clone 10A1 (a T cell derived clone) confirmed that none of the 15 sites with highest similarity to the consensus were modified under conditions that resulted in bi-allelic modification of the GR (on-target) locus.
[0186] All patents, patent applications and publications mentioned herein are hereby incorporated by reference in their entirety.
[0187] Although disclosure has been provided in some detail by way of illustration and example for the purposes of clarity of understanding, it will be apparent to those skilled in the art that various changes and modifications can be practiced without departing from the spirit or scope of the disclosure. Accordingly, the foregoing descriptions and examples should not be construed as limiting.