ANTIBODY-DRUG CONJUGATE COMPRISING ANTIBODY AGAINST HUMAN ROR1 AND USE FOR THE SAME

Abstract

The present invention relates to new antibody-drug conjugates (ADCs) targeting ROR1, active metabolites of such ADCs, methods for preparation of such ADCs, uses for such ADCs in treatment and/or prevention of illnesses, and uses for such ADCs in production of drugs for treatment and/or prevention of diseases, more specifically diseases associated with over-expression of ROR1, for example cancer. More specifically, the present invention relates to an antibody-drug conjugate comprising an antibody that binds to ROR1 or an antigen-binding fragment thereof, and a pharmaceutical composition comprising the same.

Claims

1-139. (canceled)

140. An antibody-drug conjugate represented by I or a pharmaceutically acceptable salt thereof:
Ab(X).sub.y[Formula I] wherein Ab is an anti-ROR1 antibody comprising a heavy chain variable region comprising a CDRH1, a CDRH2, and a CDRH3; and a light chain variable region comprising a CDRL1, a CDRL2 and a CDRL3; wherein CDRH1 comprises the amino acid sequence of SEQ ID NOs: 4; CDRH2 comprises the amino acid sequence of SEQ ID NOs: 11; CDRH3 comprises the amino acid sequence of SEQ ID NOs: 19; CDRL1 comprises the amino acid sequence of SEQ ID NOs: 27; CDRL1 comprises the amino acid sequence of SEQ ID NOs: 35; CDRL1 comprises the amino acid sequence of SEQ ID NOs: 42; X is ##STR00059## custom-character is bonded to Ab; and y is 2.

141. The antibody-drug conjugate of claim 140, wherein the antibody comprises a heavy chain variable region having either: i) a sequence according to SEQ ID NO: 48; or ii) a sequence having at least 90% or at least 95% or more homology to the amino acid sequence of SEQ ID NO: 48.

142. The antibody-drug conjugate of claim 140, wherein the antibody comprises a light chain variable region having either: i) a sequence according to SEQ ID NO: 56; or ii) a sequence having at least 90% or at least 95% or more homology to the amino acid sequence of SEQ ID NO: 56.

143. The antibody-drug conjugate of claim 140, wherein the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 48 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 56.

144. The antibody-drug conjugate of claim 140, wherein the antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 64 and a light chain comprising the amino acid sequence of SEQ ID NO: 72.

145. The antibody-drug conjugate of claim 140, wherein: the antibody is an IgG1 fully human monoclonal antibody and the ROR1 is human ROR1 or mouse ROR1.

146. The antibody-drug conjugate of claim 140, wherein the antibody is bonded to X via a thioether bond; the thioether bond includes a sulfur atom of the cysteine of the antibody; and the antibody comprises an amino acid motif which can be recognized by isoprenoid transferase at the C-terminus of the antibody.

147. The antibody-drug conjugate of claim 146, wherein the amino acid motif has the sequence of CVIM.

148. The antibody-drug conjugate of claim 140, wherein the antibody-drug conjugate has a structure according to: ##STR00060## or a pharmaceutically acceptable salt thereof.

149. A method of treating a disease or disorder associated with the over-expression of ROR1 in a subject, comprising administering an antibody-drug conjugate of claim 140.

150. The method of claim 149, wherein the disease is cancer.

151. The method of claim 150, wherein the cancer is chronic lymphocytic leukemia (CLL), B-cell leukemia, lymphoma, acute myeloid leukemia (AML), Burkitt lymphoma, mantle cell lymphoma (MCL), acute lymphoblastic leukemia (ALL), Diffuse large B-cell lymphoma (DLBCL), follicular lymphoma (FL) and marginal zone lymphoma (MZL), breast cancer, renal cancer, ovarian cancer, gastric cancer, liver cancer, lung cancer, colorectal cancer, pancreatic cancer, skin cancer, bladder cancer, testicular cancer, uterine cancer, prostate cancer, non-small cell lung cancer (NSCLC), neuroblastoma, brain cancer, colon cancer, squamous cell carcinoma, melanoma, myeloma, cervical cancer, thyroid cancer, head and neck cancer or adrenal cancer.

152. The pharmaceutical composition according to claim 149, wherein the pharmaceutical composition further comprises a pharmaceutically efficacious amount of a chemotherapeutic agent.

153. A method of treating cancer in a subject, comprising administering an antibody drug conjugate of claim 149 to the subject.

154. The method of claim 153, wherein the cancer is chronic lymphocytic leukemia (CLL), B-cell leukemia, lymphoma, acute myeloid leukemia (AML), Burkitt lymphoma, mantle cell lymphoma (MCL), acute lymphoblastic leukemia (ALL), Diffuse large B-cell lymphoma (DLBCL), follicular lymphoma (FL) and marginal zone lymphoma (MZL), breast cancer, renal cancer, ovarian cancer, gastric cancer, liver cancer, lung cancer, colorectal cancer, pancreatic cancer, skin cancer, bladder cancer, testicular cancer, uterine cancer, prostate cancer, non-small cell lung cancer (NSCLC), neuroblastoma, brain cancer, colon cancer, squamous cell carcinoma, melanoma, myeloma, cervical cancer, thyroid cancer, head and neck cancer or adrenal cancer.

155. The pharmaceutical composition according to claim 154, wherein the pharmaceutical composition further comprises a pharmaceutically efficacious amount of a chemotherapeutic agent.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0471] FIG. 1 shows results of analyzing (ELISA) the binding capacity of an anti-ROR1 monoclonal phage antibody prepared according to one example of the present invention to ROR1 antigen. It is shown that the respective anti-ROR1 monoclonal antibodies specifically bind to extracellular domain ROR1 antigen. BCMA-Fc is a negative control group, and it is shown that the respective anti-ROR1 monoclonal antibodies specifically bind only to ROR1 antigen, and do not bind to the BCMA protein or the Fc used as a tag.

[0472] FIG. 2 shows results of measuring (FACS) the binding capacity of an anti-ROR1 monoclonal phage antibody according to one example of the present invention to cell surface-expressed ROR1 antigen, and a JeKo-1 cell line was used as the cell expressing ROR1 on the cell surface. It is shown that each anti-ROR1 monoclonal antibody binds specifically to the ROR1 expressed on the cell surface.

[0473] FIGS. 3A & B show the results of analyzing (ELISA) the binding capacity of an anti-ROR1 IgG antibody prepared according to an example of the present invention to human ROR1 antigen. It is shown that the respective antibodies bind to human ROR1 antigen in a concentration-dependent manner. The results show that binding capacity to ROR1 is maintained even after a monoclonal phage antibody is changed to an IgG form.

[0474] FIG. 4 shows results of analyzing (ELISA) the binding capacity of an anti-ROR1 IgG antibody prepared according to one example of the present invention to mouse ROR1 antigen. It is shown that each antibody binds to mouse ROR1 antigen in a concentration-dependent manner. Through this experiment, it was confirmed that the anti-ROR1 antibody of the present invention has cross-reactivity with mouse ROR1. As for the 2A2 antibody used as a reference group, it was found that whereas it had cross-reactivity with mouse ROR1, the degree of binding was relatively weak compared to the anti-ROR1 antibody of the present invention.

[0475] FIG. 5 shows results of measuring (FACS) the binding capacity of an anti-ROR1 antibody prepared according to one example of the present invention to cell surface-expressed ROR1 antigen, where human ROR1 is artificially over-expressed in the CHO-human ROR1 cell line, human ROR2 is over-expressed in CHO-human ROR2, and mouse ROR1 is over-expressed in CHO-mouse ROR1. It was shown that the respective antibodies specifically bind to human ROR1 expressed on the cell surface, and not to the family protein human ROR2. Further, by confirming binding to a cell line wherein mouse ROR1 was artificially over-expressed, it was confirmed that the anti-ROR1 antibody of the present invention has inter-species cross-reactivity to mouse ROR1. As for the 2A2 antibody used as a reference group, it was found that whereas it had cross-reactivity with mouse ROR1, the degree of binding was relatively weak compared to the anti-ROR1 antibody of the present invention.

[0476] FIG. 6 shows results of measuring (FACS) the binding capacity of an anti-ROR1 antibody prepared according to one example of the present invention to cell surface-expressed ROR1 antigen, using the JeKo-1 and Mino cell lines as the ROR1 expression positive cell lines and the MCF7 cell line as the ROR1 negative cell line. The respective antibodies were found to specifically bind to ROR1 expressed on the cell surface, and not to bind to MCF7, a cell line which does not express ROR1.

[0477] FIG. 7 shows results of measuring (FACS) the binding capacity of an anti-ROR1 antibody prepared according to one example of the present invention to cell surface-expressed ROR1 antigen. An MC38 human ROR1 cell line, where human ROR1 was artificially over-expressed on the mouse colon cancer cell line MC38, was used. The respective antibodies were found to bind to the cell line with human ROR1 over-expression in a concentration-dependent manner.

[0478] FIG. 8 shows results of measuring (FACS) the binding capacity of an anti-ROR1 antibody prepared according to one example of the present invention to cell surface-expressed ROR1 antigen in various cancer cell lines.

[0479] FIGS. 9A & B show the results of analyzing the cancer suppression efficacy of an anti-ROR1 antibody according to one example of the present invention in a mouse tumor xenograft model.

[0480] FIG. 10 shows results of analyzing the mechanism of action of an anti-ROR1 antibody prepared according to one example of the present invention. Suppression of cancer growth by the antibody may manifest in the form of, for example, inducing autophagic cell death, suppression cancer cell division, suppressing tumor angiogenesis, and/or immune cell activation, and identical or different mechanisms of action may be exhibited according to the antibody. In FIG. 10, whether or not cell death occurred was analyzed using a single mechanism of action where possible. It was found in the results of treating a cell line expressing ROR1 with an anti-ROR1 antibody according to the present invention that the antibody formed a multimer and was able to induce cell death. As for the 2A2 antibody used as a reference group, it was found that cell death was not induced even in cases where a multimer was formed.

[0481] FIG. 11a is a drawing showing the characteristics of an anti-ROR1 antibody-MMAE conjugate (DAR4) prepared according to one example of the present invention.

[0482] FIG. 11b is a drawing showing the characteristics of an anti-ROR1 antibody-dPBD conjugate (DAR2) prepared according to one example of the present invention.

[0483] FIG. 12 shows results of analyzing the cancer suppression efficacy of an anti-ROR1 antibody-dPBD conjugate (DAR2) prepared according to one example of the present invention in an MDA-MB-468 breast cancer cell line transplanted mouse model. It is shown that the anti-ROR1 antibody-dPBD conjugate (DAR2) according to the present invention is effective in carcinoma elimination in an ROR1-expressing breast cancer cell line transplanted mouse model.

[0484] FIG. 13 shows results of analyzing the cancer suppression efficacy of an anti-ROR1 antibody-dPBD conjugate (DAR2) prepared according to one example of the present invention in an MDA-MB-231 breast cancer cell line transplanted mouse model. It is shown that the anti-ROR1 antibody-dPBD conjugate (DAR2) according to the present invention is effective in carcinoma elimination in an ROR1-expressing breast cancer cell line transplanted mouse model.

[0485] FIG. 14 shows results of analyzing the cancer suppression efficacy of an anti-ROR1 antibody-dPBD conjugate (DAR2) prepared according to one example of the present invention in an HCC1187 lung cancer cell line transplanted mouse model. It is shown that the anti-ROR1 antibody-dPBD conjugate (DAR2) according to the present invention is effective in carcinoma elimination in an ROR1-expressing lung cancer cell line transplanted mouse model.

[0486] FIG. 15 shows results of analyzing the cancer suppression efficacy of an anti-ROR1 antibody-dPBD conjugate (DAR2) and anti-ROR1 antibody-MMAE conjugate (DAR4) prepared according to one example of the present invention in a Calu-3 breast cancer cell line transplanted mouse model. It is shown that the anti-ROR1 antibody-dPBD conjugate (DAR2) and anti-ROR1 antibody-MMAE conjugate (DAR4) according to the present invention are effective in carcinoma elimination in an ROR1-expressing breast cancer cell line transplanted mouse model.

[0487] FIG. 16 shows results of comparing the cancer suppression efficacy of anti-ROR1 anti-drug conjugates according to the present invention in a Jeko-1 mantle cell lymphoma cell line transplanted mouse model.

[0488] FIG. 17 shows results of the anti-ROR1 antibody-dPBD conjugate (DAR2) and anti-ROR1 antibody-MMAE conjugate (DAR4) according to the present invention. It is shown that the anti-ROR1 antibody-dPBD conjugate (DAR2) and anti-ROR1 antibody-MMAE conjugate (DAR4) according to the present invention are effective in carcinoma elimination in an ROR1-expressing mantle cell lymphoma cell line transplanted mouse model.

[0489] The present invention is based on the development of antibodies able to specifically bind to ROR1.

[0490] The titles used under this section are used for convenience in stating the specification, and the present invention is not limited thereto.

[0491] Unless otherwise defined In the present disclosure, scientific and technical terms used in the present invention shall be defined as ordinarily understood by a skilled person of the present technical field. Further, unless specifically required in context, singular expressions include plural expressions, and plural expressions include singular expressions.

Definitions

[0492] The following definitions apply in the present specification:

[0493] In the present specification, conjugates refers to cell binding agents that are covalently linked to one or more molecules of a cytotoxic compound. Here, cell binding agent is a molecule having affinity for a biological target, for example, a ligand, protein, antibody, specifically a monoclonal antibody, protein or antibody fragment, and the binding agent serves to direct the biologically active compound to the biological target. In some embodiments, the conjugate may be designed to target tumor cells through cell surface antigens. The antigen may be a cell surface antigen that is overexpressed or expressed in an abnormal cell type. Specifically, the target antigen may be expressed only on proliferative cells (e.g., tumor cells). Target antigens may be selected based on different expression, usually between proliferative and normal tissues. In the present disclosure, a ligand is bonded to a linker.

[0494] In the present disclosure, a variant of a polypeptide such as an antigen-binding fragment, protein or antibody is a polypeptide where, compared to another polypeptide sequence, insertion, deletion, addition and/or substitution has occurred in at least one amino acid residue, including fused polypeptides. Further, protein variants include those which have been modified by proteolytic cleavage, phosphorylation or other post-translational modification, but maintain the biological activity of the antibody disclosed, for example binding and specificity to ROR1. The variant may be approximately 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, 85%, 84%, 83%, 82%, 81% or 80% identical to the sequence of the antibody or antigen-binding fragment thereof disclosed in the present invention. Percent identity (%) or homology may be calculated with reference to the following.

[0495] In one example, percent identity of peptide sequences can be calculated, for example, as 100[(identical positions)/min(TG.sub.A, TG.sub.B)], where TG.sub.A and TG.sub.B are the sum of the number of residues and internal gap positions in peptide sequences A and B in the alignment that minimizes TG.sub.A and TG.sub.B. (Russell et al., J. Mol Biol., 244: 332-350 (1994)).

[0496] In the present disclosure, conservative amino acid substitution refers to a substitution which does not significantly impact the activity or antigenicity of the polypeptide. A polypeptide may include one or more conservative substitutions. Non-limiting examples are disclosed in Table 3 below.

[0497] In the present disclosure, a derivative of a polypeptide refers to a polypeptide wherein at least one residue has been chemically modified through conjugation with another chemical moiety, and is different from an insertion, deletion, addition or substitution variant.

[0498] In the present disclosure, the term found in nature used in relation to polypeptide, nucleic acid and host cells, etc. means that the materials exist naturally.

[0499] The ROR1 (Receptor Tyrosine Kinase-Like Orphan Receptor) recognized by the antibody according the present invention refers to a transmembrane protein of the RTK (Receptor Tyrosine Kinase) family. In one example, the extracellular domain is recognized in particular. The ROR1 recognized by the antibody according to the present invention may be an extracellular domain which exists on the cell membrane or does not exist on the cell membrane. The human protein of ROR1 is comprised of 937 amino acids, where the amino acid sequence is NCBI Reference Sequence ID: NP_005003.2 and the nucleic acid sequence is NM_005012.3. Unless clear from the context used In the present disclosure, ROR1 designates hROR1, but the antibody according to the present invention also has mouse ROR1-specific binding capacity. The Mouse ROR1 amino acid is GenBank: BAA75480.1.

[0500] In the present disclosure, identity means sequence similarity of two or more polypeptides or two or more polynucleotides, as determined by aligning and comparing two or more polypeptides or two or more polynucleotide sequences. Such intersequence identity is generally expressed as percent identity, which means the same amino acid or nucleotide ratio between molecules being compared and is calculated based on the smallest molecule of the molecules being compared. Methods that can be used to align nucleic acids or polypeptides to calculate multimolecular identity are known in the art.

[0501] In the present disclosure, affinity or [affinity] is the strength of interaction between an antibody or its antigen-binding fragment and an antigen, and it is determined by properties of the antigen such as size, shape and/or charge of antigen, and CDR sequences of the antibody or antigen-binding fragment. The methods for determining the affinity are known in the art, and the following may be used as references.

[0502] The antibody or its antigen-binding fragment is called specifically binding to its target such as an antigen, when a dissociation constant (K D) is <10.sup.6 M. The antibody specifically binds to a target with high affinity when K D is <1x.sup.8 M.

[0503] As used in the present disclosure, antigen-binding fragment of a chain (heavy chain or light chain) of an antibody or immunoglobulin includes a part of an antibody which lacks some amino acids compared to a full-length chain, but can specifically bind to an antigen. This fragment can be considered as having biological activity, in that it can specifically bind to a target antigen, or can compete with other antibodies or an antigen binding fragment to bind to a specific epitope. In some embodiments, this fragment comprises at least one CDR present in a full-length light chain or heavy chain, and in some examples, it includes a short-chain heavy chain and/or light chain, or part thereof. This biological active fragment may be produced by a recombinant DNA technique or may be produced, for example, by cutting an intact antibody enzymatically or chemically. An immunologically functional immunoglobulin fragment includes Fab, Fab, F(ab)2, scFab, dsFv, Fv, scFV, scFV-Fc, diabody, minibody, scAb, and dAb, but not limited thereto, and may be derived from any mammal, including, but not limited to, human, mouse, rat, camelid or rabbit. The functional parts of antibodies such as the one or more CDRs disclosed in the present invention may be linked with a secondary protein or a small molecular compound by a covalent bond, and thereby used as a targeted therapeutic agent for a specific target.

[0504] In the present disclosure, Fc region comprises two heavy chain fragments comprising CH2 and CH3 domains of an antibody. These 2 heavy chain fragments are combined each other by hydrophobic interaction of two or more of disulfide bonds and a CH3 domain.

[0505] In the present disclosure, Fab fragment consists of 1 light chain and 1 heavy chain comprising a variable region and CH1 only. The heavy chain of a Fab molecule cannot form a disulfide bond with another heavy chain molecule. In an scFab, two molecules of Fab are linked by a flexible linker.

[0506] In the present disclosure, Fab fragment includes a Fab fragment and additionally a region between CH1 and CH2 domains of a heavy chain. A disulfide bond may form between two heavy chains of Fab fragments of two molecules, forming a F(ab).sub.2 molecule.

[0507] In the present disclosure, as aforementioned, F(ab).sub.2 fragment comprises two light chains and two heavy chains comprising a variable region CH1 and part of a constant region between the CH1 and CH2 domains, with an inter-chain disulfide bond formed between the two heavy chains. Accordingly, a F(ab).sub.2 fragment consists of two Fab fragments, and the two Fab fragments are joined to each other by the disulfide bond between them.

[0508] In the present disclosure, Fv region is a fragment of an antibody which comprises each variable region of a heavy chain and a light chain, but does not comprise constant regions. In an sdFV, a heavy chain and a light chain are linked by a disulfide bond. In an scFc, the Fv is linked by a flexible linker. In an scFv-Fc, an Fc is linked to an scFV. In a minibody, CH3 is linked to an scFV. A diabody comprises the scFVs of two molecules.

[0509] In the present disclosure, single chain Fv or scFv antibody fragment includes the VH and VL domains of an antibody, these domains existing within a single polypeptide chain. An Fv polypeptide may additionally comprise a polypeptide linker between a Vh domain which enables the scFv to form the target structure for antigen binding, and a VL domain.

[0510] In the present disclosure, short-chain antibody (scAb) is a single polypeptide chain comprising one light chain constant region or one constant region of a heavy chain, wherein heavy chain and light chain variable regions are linked by a flexible linker. A reference for a short-chain antibody may be found in U.S. Pat. No. 5,260,203, disclosed in the present invention by reference.

[0511] In the present disclosure, domain antibody (dAb) is an immunologically functional immunoglobulin fragment comprising only a variable region of a heavy chain or a variable region of a light chain. In one embodiment, two or more VH regions are linked by a covalent bond by a peptide linker, to form a bivalent domain antibody. Two VH regions of this bivalent domain antibody may target the same or different antigen.

[0512] In the present disclosure, complementarity determining region (CDR; that is, CDR1, CDR2 and CDR3) denotes amino acid residues of the variable domain of an antibody, which are necessary for binding to antigen. Each variable domain typically has three CDR domains, identified as CDR1, CDR2 and CDR3.

[0513] In the present disclosure, framework region (FR) refers to variable domain residues other than the CDR residues. Each variable domain typically has four FRs, identified as FR1, FR2, FR3 and FR4.

[0514] In the present disclosure, bivalent antigen-binding protein or bivalent antibody comprises 2 antigen-binding sites. The two antigen-binding sites included in a bivalent antibody may have the same antigen specificity, or the antibody may be a dual-specific antibody where the antigen-biding sites bind to different antigens.

[0515] In the present disclosure, multi-specific antigen-binding protein or multi-specific antibody targets two or more of antigens or epitopes.

[0516] In the present disclosure, linker refers to a compound which covalently bonds a cytotoxic compound to a ligand or antibody. In some embodiments, the linker disclosed in PCT/US2016/063564 and PCT/US2016/063595 may be used, both of which are hereby incorporated by reference herein in their entireties, and particularly for the linkers disclosed therein.

[0517] In the present disclosure, non-substituted or substituted is used to refer to a group which may be non-substituted or substituted; substituted refers to a group having at least one substituent group; and substituent group refers to a chemical part covalently bonded to or joined with a parent group. It is understood that substituents and substitution patterns on the compounds of the present invention can be selected by one of ordinary skilled person in the art to result in chemically stable compounds which can be readily synthesized by techniques known in the art, as well as those methods set forth below, from readily available starting materials. If a substituent is itself substituted with more than one group, it is understood that these multiple groups may be on the same carbon or on different carbons, so long as a stable structure results. For example, the substituent may be, but is not limited to, hydroxyl, hydroxyalkyl, alkoxy, halogen, alkyl, nitro, silyl, acyl, acyloxy, aryl, cycloalkyl, heterocyclyl, amino, aminoalkyl, cyano, haloalkyl, haloalkoxy, OCOCH.sub.2O-alkyl, OP(O)(O-alkyl).sub.2 or CH.sub.2OP(O)(O-alkyl).sub.2. In certain embodiments, groups (e.g., alkyl, cycloalkyl, heteroaryl, heterocyclyl, or aryl groups) referred to in the structural formulae herein are optionally substituted, i.e., are non-substituted or substituted. In certain embodiments, groups (e.g., alkyl, cycloalkyl, heteroaryl, heterocyclyl, or aryl groups) referred to in the structural formulae herein are unsubstituted.

[0518] As used herein, the terms optionally substituted or non-substituted or substituted refer to the replacement of one to six hydrogen radicals in a given structure with the radical of a specified substituent including, but not limited to: hydroxyl, hydroxyalkyl, alkoxy, halogen, alkyl, nitro, silyl, acyl, acyloxy, aryl, cycloalkyl, heterocyclyl, amino, aminoalkyl, cyano, haloalkyl, haloalkoxy, OCOCH.sub.2O-alkyl, OP(O)(O-alkyl).sub.2 or CH.sub.2OP(O)(O-alkyl).sub.2. Preferably, optionally substituted or non-substituted or substituted refer to the replacement of one to four hydrogen radicals in a given structure with the substituents mentioned above. More preferably, one to three hydrogen radicals are replaced by the substituents as mentioned above. It is understood that the substituent can be further substituted.

[0519] In the present disclosure, halo refers to fluorine, chlorine, bromine or iodine, etc. In certain embodiments of the present disclosure, alkyl is a monovalent moiety obtained by removing a hydrogen atom from a carbon atom of an aliphatic or alicyclic, saturated or unsaturated (unsaturated, fully unsaturated) hydrocarbon compound. Examples of saturated alkyls include methyl, ethyl, Butyl, n-pentyl (amyl), n-hexyl, n-heptyl and the like, saturated cyclic alkyl groups such as methyl, ethyl, Isopropyl, isobutyl, sec-butyl, tert-butyl, isopentyl and neopentyl, etc.

[0520] In other embodiments of the present disclosure, the term alkyl refers to saturated aliphatic groups, including straight-chain alkyl groups, branched-chain alkyl groups, cycloalkyl (alicyclic) groups, alkyl-substituted cycloalkyl groups, and cycloalkyl-substituted alkyl groups. In preferred embodiments, a straight chain or branched chain alkyl has 30 or fewer carbon atoms in its backbone (e.g., C.sub.1-30 for straight chains, C.sub.3-30 for branched chains), and more preferably 20 or fewer.

[0521] In both of the above embodiments and throughout the specification, examples, and claims, alkyl is intended to include both unsubstituted and substituted alkyl groups, the latter of which refers to alkyl moieties having substituents replacing a hydrogen on one or more carbons of the hydrocarbon backbone, including haloalkyl groups such as trifluoromethyl and 2,2,2-trifluoroethyl, etc.

[0522] In the present disclosure, alkoxy refers to OR where R is an alkyl group, and examples include methoxy, ethoxy, n-propoxy, isopropoxy, n-butoxy, sec-butoxy, isobutoxy and tert-butoxy, etc.

[0523] In the present disclosure, alkenyl is an alkyl having at least one carbon-carbon double bond. Examples of unsaturated alkenyl groups are ethenyl (vinyl, CHCH.sub.2), 1-propenyl (CHCHCH.sub.3), 2-propenyl, isopropenyl, butenyl, pentenyl and hexenyl, etc.

[0524] In the present disclosure, alkynyl is an alkyl group having at least one carbon-carbon triple bond, and examples of unsaturated alkynyl group include ethynyl and 2-propynyl, etc.

[0525] In the present disclosure, carboxy refers to C(O)OH.

[0526] In the present disclosure, formyl refers to C(O)H.

[0527] In the certain embodiments of the present disclosure, aryl refers to a monovalent moiety obtained by removing a hydrogen atom from an aromatic ring atom of an aromatic compound. For example, C.sub.5-7 aryl is a moiety having from 5 to 7 ring atoms, which is a monovalent moiety obtained by removing a hydrogen atom from the aromatic ring atoms of an aromatic compound, and C.sub.5-10 aryl is a moiety having from 5 to 10 ring atoms, which is a monovalent moiety obtained by removing a hydrogen atom from the aromatic ring atoms of an aromatic compound. Here, the prefixes (C.sub.5-7, C.sub.5-10, etc.) refer to the number of ring atoms or a range for the number of ring atoms, regardless of whether they are carbon atoms or hetero atoms. For example, C.sub.5-6 aryl relates to an aryl group having 5 or 6 ring atoms. Here, the ring atoms may be all carbon atoms as in a carboaryl group. Examples of a carboaryl group include, but are not limited to, those derived from benzene, naphthalene, azulene, anthracene, phenanthrene, naphthacene and pyrene. Examples of aryl groups that include a fused ring wherein at least one is an aromatic ring include, but are not limited to, groups derived from indane, indene, isoindene, tetralin, acenaphthene, fluorene, phenalene, acesphenanthrene and aseantrene. Alternatively, the ring atoms may contain one or more heteroatoms as in a heteroaryl group.

[0528] In other embodiments of the present disclosure, aryl as used herein include substituted or unsubstituted single-ring aromatic groups in which each atom of the ring is carbon. Preferably the ring is a 5- to 7-membered ring, more preferably a 6-membered ring. The term aryl also includes polycyclic ring systems having two or more cyclic rings in which two or more carbons are common to two adjoining rings wherein at least one of the rings is aromatic, e.g., the other cyclic rings can be cycloalkyls, cycloalkenyls, cycloalkynyls, aryls, heteroaryls, and/or heterocyclyls. Aryl groups include benzene, naphthalene, phenanthrene, phenol, aniline, and the like.

[0529] In the present disclosure, heteroaryl refers to aryl containing one or more heteroatoms, such as pyridine, pyrimidine, benzothiophene, furyl, dioxolanyl, pyrrolyl, oxazolyl, pyridyl, pyridazinyl, More specifically benzofuran, isobenzofuran, indole, isoindole, indolizine, indolin, isoindoline, purine (adenine or guanine), benzimidazole, indazole, benzoxazole, benzisoxazole, benzodioxole, benzofuran, benzotriazole, benzothiofuran, benzothiazole, C.sub.9 having two fused rings derived from benzothiazole, chromene, iso-chromene, chroman, iso-chroman, benzodioxane, quinoline, isoquinoline, quinolizine, benzoxazine, benzodiazine, pyridopyridine, quinoxaline, quinazoline, cinnoline, phthalazine, naphthyridine, C.sub.10 having two fused rings derived from pteridin, C.sub.11 having two fused rings derived from benzodiazepine, carbazole, dibenzofuran, dibenzothiophene, carboline, pyrimidine, C.sub.13 having three fused rings derived from pyridoindole, acridine, xanthene, thioxanthene, phenoxathiine, phenazine, phenoxazine, phenothiazine, thianthrene, phenanthridine, phenanthroline, and C.sub.14 having three fused rings derived from phenazine.

[0530] In the present disclosure, cycloalkyl refers to an alkyl group which is a cycloalkyl group, and relates to a monovalent moiety obtained by removing a hydrogen atom from an alicyclic ring atom of a cyclic hydrocarbon compound. Examples of cycloalkyl groups include, but are not limited to, those derived from:

[0531] Saturated single ring hydrocarbon compounds, such as: cyclopropane, cyclobutane, cyclopentane, cyclohexane, cycloheptane, methylcyclopropane, dimethylcyclopropane, methylcyclobutane, dimethylcyclobutane, methylcyclopentane, dimethylcyclopentane and methylcyclohexane; or

[0532] Unsaturated single ring hydrocarbon compounds, such as: cyclopropene, cyclobutene, cyclopentene, cyclohexene, methylcyclopropene, dimethylcyclopropene, methylcyclobutene, dimethylcyclobutene, methylcyclopentene, dimethylcyclopentene and methylcyclohexene; and saturated heterocyclic hydrocarbon compounds: norcaran, norphenen, and norbornene.

[0533] In the present disclosure, heterocyclyl refers to a monovalent moiety obtained by removing a hydrogen atom from a ring atom of a heterocyclic compound.

[0534] In the present disclosure, the prefixes (e.g., C.sub.1-12, C.sub.3-8, etc.) refer to the number of ring atoms or a range for the number of ring atoms, regardless of whether they are carbon atoms or hetero atoms. For example, the term C.sub.3-6 heterocyclyl used in the present specification relates to a heterocyclyl group having 3 to 6 ring atoms.

[0535] Examples of single ring heterocyclyl groups include, but are not limited to, those derived from: [0536] 1N: aziridine, azetidine, pyrrolidine, pyrroline, 2H- or 3H-pyrrole, piperidine, dihydropyridine, tetrahydropyridine, azepine; [0537] 2N: imidazolidine, pyrazolidine, imidazoline, pyrazoline, piperazine; [0538] 1O: oxirane, oxetane, oxolane, oxol, oxane, dihydropyran, pyran, oxepine; [0539] 2O: dioxolane, dioxane and dioxepane; [0540] 3O: trioxane; [0541] 1N1O: tetrahydrooxazole, dihydrooxazole, tetrahydroisoxazole, dihydroisoxazole, morpholine, tetrahydrooxazine, dihydrooxazine, [0542] 1S: thiirane, thietane, thiolane, thiane, thiepane; [0543] 1N.sub.1S: thiazoline, thiazolidine, thiomorpholine; [0544] 2N1O: oxadiazine; [0545] 1O1S: oxathiol, oxathiane; and [0546] 1N1O1S: oxathiazine.

[0547] In the present disclosure, prodrug refers to compounds which, under in vivo physiological conditions (e.g. enzymatic oxidation, reduction and/or hydrolysis), may, by action of enzyme or gastric acid, be converted directly or indirectly into a pyrrolobenzodiazepine drug.

[0548] In the present disclosure, pharmaceutically acceptable salt may be an acid addition salt formed by pharmaceutically acceptable free acid, where the free acid is an organic acid or an inorganic acid.

[0549] The organic acids include, but are not limited to, citric, acetic, lactic, tartaric, maleic, fumaric, formic, propionic, oxalic, trifluoroacetic, benzoic, gluconic, methane sulfonic, glycolic, succinic, glutamic and aspartic acid. Also, the inorganic acids include, but are not limited to, hydrochloric acid, bromic acid, sulfuric acid and phosphoric acid.

[0550] For example, if the compound has a functional group which is an anion or may be an inion (e.g. COOH may be COO), a suitable cation may be used for forming a salt. Examples of suitable inorganic cations include, but are not limited to, Na.sup.+ and K.sup.+ alkaline earth cations such as Ca.sup.2+ and Mg.sup.2+ and other cations such as Al.sup.3+ Examples of suitable organic cations include, but are not limited to, ammonium ion (i.e., NH.sub.4.sup.+) and substituted ammonium ions (e.g. NH.sub.3R.sup.+, NH.sub.2R.sub.2.sup.+, NHR.sub.3.sup.+, NR.sub.4.sup.+).

[0551] Some examples of suitable substituted ammonium ions are derived from the following: ethylamine, diethylamine, dicyclohexylamine, triethylamine, butylamine, ethylenediamine, ethanolamine, diethanolamine, piperazine, benzylamine, phenylbenzylamine, choline, meglumine and tromethamine, as well as amino acids such as lysine and arginine. An example of a typical quaternary ammonium ion is N(CH.sub.3).sup.4+.

[0552] If the compound has a functional group which may be a cation or a cation (e.g., NH.sub.2 may be NH.sub.3.sup.+), a salt may be formed with a suitable anion. Examples of suitable inorganic anions include, but are not limited to, those derived from the following inorganic acids: hydrochloric acid, hydrobromic acid, hydroiodic acid, sulfuric acid, sulfuric acid, nitric acid, nitrous acid, phosphoric acid and phosphorous acid.

[0553] Examples of suitable organic anions include, but are not limited to, those derived from organic acids such as: 2-acetoxybenzoic acid, acetic acid, ascorbic acid, aspartic acid, benzoic acid, camphorsulfonic acid, cinnamic acid, citric acid, disulfonic acid, ethanesulfonic acid, fumaric acid, glutaronic acid, gluconic acid, glutamic acid, glycolic acid, hydroxymaleic acid, hydroxynaphthalenecarboxylic acid, isethionic acid, lactic acid, But are not limited to, malic acid, methanesulfonic acid, mucilous acid, oleic acid, oxalic acid, palmitic acid, pamic acid, pantothenic acid, phenylacetic acid, phenylsulfonic acid, propionic acid, pyruvic acid, salicylic acid, stearic acid, succinic acid, sulfanilic acid and tartaric acid, etc. Examples of suitable multimeric organic anions include, but are not limited to, those derived from the following multimeric acids: tannic acid, carboxymethylcellulose, etc.

[0554] In the present disclosure, solvate refers to a molecular complex between a compound according to the present invention and solvent molecules, examples of which include but are not limited to water, isopropanol, ethanol, methanol, dimethylsulfoxide, ethyl acetate, acetic acid, ethanolamine or the compound according to the present invention bonded to a mixed solvent thereof.

[0555] It may be convenient or desirable to prepare, purify and/or handle solvates corresponding to active compounds. In the present specification, the term solvate is used in its conventional sense to refer to solutes (e.g., active compounds and salts of active compounds) and complexes of solvents. When the solvent is water, the solvate may conveniently be referred to as a hydrate, such as monohydrate, dihydrate or trihydrate, etc.

[0556] In the present disclosure, effective dose or effective therapeutic dose refers to a dose necessary to achieve the target therapeutic effect (with respect to administration dose, administration period and means). An effective dose is a minimum amount of activating agent necessary to give an object a minimum therapeutic benefit, and is less than a toxic dose. For example, the administration dose may be in a range of approximately 100 ng to approximately 100 mg/kg per patient, more typically in a range of approximately 1 g/kg to approximately 10 mg/kg. In a case where the activating compound is a salt, ester, amide or prodrug, etc., the administration dose is calculated based on the parent compound, and therefore the actual mass used increases proportionally. The pyrrolobenzodiazepine compound according to the present invention may be formulated to include 0.1 mg to 3000 mg, 1 mg to 2000 mg, or 10 mg to 1000 mg active ingredient per unit dosage form, but is not limited thereto.

[0557] The active ingredient may be administered to obtain a peak plasma concentration of active compound of approximately 0.05 M to 100 M, 1 M to 50 M, or 5 M to 30 M. For example, a solution of 0.1 w/v % to 5 w/v % active ingredient in saline solution, arbitrarily, may be administered by intravenous injection.

[0558] The concentration of an active compound in a pharmaceutical composition may be determined by the absorption, inactivation and excretion rate of the drug, and other factors known to those skilled in the art. The administration dose may differ according to the severity of the symptoms or illness. Further, the dose and method of administration for a given patient may be adjusted according to the professional judgment of the administration supervisor, giving general consideration to the degree of symptoms/illness of the patient, necessity, age, and reactivity to the drug, etc., and the range of concentrations stated in the present invention are only exemplary, and are not intended to limit the present invention to the examples presented of the composition claimed. Further, the active ingredient may be administered in one administration, or smaller doses may be administered over multiple administrations.

Antibody or Antigen-Binding Fragment

[0559] The present invention discloses an antibody which binds specifically to the extracellular domain of ROR1 protein. As disclosed in the present disclosure, the antibody according to the present invention is a polypeptide comprising six complementarity-determining area or region (CDR).

[0560] In some examples, the CDR is included in a framework region, and the framework orients the CDR(s) so that the CDR(s) may have the appropriate antigen-binding properties.

[0561] The antibody according to the present invention specifically binds to the extracellular domain of human and mouse-derived ROR1, and can specifically bind to extracellular domain in isolated form, or to the extracellular domain of ROR1 expressed at the cell surface.

[0562] The antibody disclosed in the present invention binds to ROR1, specifically human ROR1 and mouse ROR1. The antibody disclosed in the present disclosure, able to specifically bind to human or mouse-derived ROR1 extracellular domain or to ROR1 expressed at the cell surface, can be useful in targeted treatment of cancer targeting ROR1. For example, the antibody according to the present invention maybe bonded to an anti-cancer medicine and used for treatment of specific cancers.

[0563] Further, as the antibody binds to mouse ROR1, on-target tox can be verified through mouse testing, and in vivo efficacy can be verified through a syngeneic model using a mouse cancer cell line overexpressing mouse ROR1. As such, the antibody can be useful in development of various drugs associated with ROR1.

[0564] The antibody may include, but not limited to, a monoclonal antibody, dual-specific antibody, double antibody, multi-specific antibody, multiple antibody, minibody, domain antibody, antibody mimetic (or synthetic antibody), chimeric antibody or antibody fusion (or antibody conjugate) and fragment thereof, and includes various forms of antibodies disclosed herein.

[0565] In some embodiments, the antibody fragment of the antibody disclosed in the present invention may include Fab, Fab, F(ab).sub.2, scFab, Fv, dsFv, scFV, scFV-Fc, minibody, diabody, scAb or dAb.

[0566] In some embodiments, the antibody disclosed in the present invention may consist of a polypeptide of only light chains or only heavy chains comprising the variable regions disclosed in Table 2a and Table 2b.

[0567] One antibody disclosed in the present invention may share a specific region or sequence with another antibody disclosed in the present invention. In some embodiments, it may share a constant region of the antibody or antigen-binding fragment. In some embodiments, it may share an Fc region. In some embodiments, it may share a frame of a variable region.

[0568] In some embodiments, the antibody has a typical structure of an antibody found in nature. Camelid animals produce an antibody consisting of a single heavy chain, but the structural unit of this antibody commonly comprises a tetrameric polypeptide, where the tetramer comprises a pair of two polypeptide chain bodies consisting of different 2 polypeptide chains. In a typical antibody, the one pair of polypeptide chain body comprises one full-length light chain (approximately 25 kDa) and one full-length heavy chain (approximately 50 to 70 kDa). Each chain shows a characteristic folding pattern, and consists of several immunoglobulin domains, consisting of about 90 to 110 amino acids. These domains are basic units making up an antibody polypeptide. The amino-terminal part of each chain typically comprises a part called a variable region or V region that recognizes an antigen. The carboxy-terminal part is conserved evolutionarily more so than the amino-terminal, and includes a part called a constant region or C region. The human light chain is commonly classified as a kappa () or lambda () light chain, and these comprise one variable region and one constant region, respectively.

[0569] A heavy chain is typically classified as a mu (), delta (), gamma (), alpha () or epsilon () chain, and these are defined as IgM, IgD, IgG, IgA and IgE isotypes, respectively. IgG has a multiplicity of subtypes, including but not limited to IgG1, IgG2, IgG3 and IgG4. IgM subtypes include IgM and IgM2. IgA subtypes include IgA1 and IgA2. In humans, IgA and IgD isotypes comprise 4 heavy chains and 4 light chains;

[0570] IgG and IgE isotypes comprise 2 heavy chains and 2 light chains, and the IgM isotype comprises 5 heavy chains and 5 light chains. The heavy chain constant region typically includes at least one domain exhibiting an effector function. The number of heavy chain constant region domains varies depending on the isotype. An IgG heavy chain, for example, comprises 3 C region domains known as CH.sub.1, CH.sub.2 and CH.sub.3, respectively. The antibody disclosed in the present invention may be any one of these isotypes and subtypes. In some embodiments, the antibody is an IgG1, IgG2a, IgG2b, IgG3 or IgG4 subtype. In some embodiments, the antibody of the present invention is an IgG1- or IgG2-type. In a further embodiment, the antibody of the present invention is an IgG1-type.

[0571] The heavy chain variable region and light chain variable region according to the present invention may be linked to at least a part of a human constant region. The selection of a constant region may be determined in part by whether or not antibody-dependent cell-mediated cytotoxicity, antibody-dependent cell phagocytosis, and/or complement-dependent cytotoxicity is required. For example, human isotypes IgG land IgG3 have complement-dependent cytotoxicity and human isotypes IgG2 and IgG4 do not have this cytotoxicity. In addition, human IgG land IgG3 induce a cell-mediated effector function stronger than that of human IgG2 and IgG4. The light chain constant region may be lambda or kappa.

[0572] In some embodiments, the antibody may be a human antibody, and the heavy chain constant region may be an IgG1-, IgG2- IgG3- or IgG4-type. In some embodiments, the antibody of the present invention is an IgG1- or IgG2-type.

[0573] In some embodiments, the antibody is a human antibody, and recognizes mouse ROR1 specifically.

[0574] In a full-length light chain and heavy chain, a variable region and a constant region are linked by a region J that is about 12 or more amino acids in length, and the heavy chain comprises a D region of about 10 or more of amino acids. For example, see Fundamental Immunology, 2nd ed., Ch. 7 (Paul, W., ed.) 1989, New York: Raven Press. Typically, a variable region of a light chain/heavy chain pair of an antibody forms an antigen-binding site.

[0575] A variable region of an immunoglobulin chain generally has the same overall structure, and comprises a comparatively conserved framework region (FR) connected by 3 hypervariable regions called complementarity determining sites or regions or domains or CDRs (Complementarity Determining Region). The CDR of a variable region derived from each chain comprising a heavy chain/light chain pair is typically arranged by a framework region to form a structure specifically binding to a specific epitope of a target protein (ROR1). These factors of naturally occurring light chain and heavy chain regions are typically comprised from the N-terminal to the C-terminal in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4. The position of amino acid sequences corresponding to each variable region may be determined by Kabat. The CDRs determined by each definition, when compared against each other, may be subsets which overlap or where one includes another. However, in the present disclosure, all CDRs to be defined by each of the above methods are included in the scope of the invention. Those skilled in the art will be readily able to easily select CDR sequences according to the definitions above, given a variable region sequence of an antibody.

[0576] CDR sequences which may be included in heavy chain and light chain variable regions of the antibody or antigen-binding fragment according to some embodiments of the present invention are disclosed in Table 1a to Table 1f, respectively.

TABLE-US-00001 TABLE1a HeavyChainCDR1 Sequence SEQIDNO SYDMS 1 DYYMS 2 NYDMS 3 NYAMS 4 DYDMS 5

TABLE-US-00002 TABLE1b HeavyChainCDR2 Sequence SEQIDNO WISPDSGSIYYADSVKG 6 SISPDGSNTYYADSVKG 7 WISPGGGSKYYADSVKG 8 AIYHSGSSKYYADSVKG 9 GISHGSGNKYYADSVKG 10 SISHNSGSTYYADSVKG 11 VISPDGGSIYYADSVKG 12 SISPSSGSSIYYADSVKG 13 SISPDASNTYYADSVKG 96

TABLE-US-00003 TABLE1c CDR3ofVH Sequence SEQIDNO PTGRFDY 14 NLRAFDY 15 VNGRFDY 16 GGNGAWDTGFDY 17 RLSLRRRPSYYSDNAMDV 18 FISARKSLGRSYSNGMDV 19 DVVECNMNPCSYDNAMDV 20 APGWCQAPSCYYDNAMDV 21 GGNAAWDTGFDY 97

TABLE-US-00004 TABLE1d LightChainCDR1 Sequence SEQIDNO SGSSSNIGNNNVN 22 SGSSSNIGSNTVY 23 SGSSSNIGNNNVS 24 SGSSSNIGSNDVS 25 TGSSSNIGNNAVN 26 TGSSSNIGSNDVT 27 SGSSSNIGSNYVS 28 SGSSSNIGNNDVS 29

TABLE-US-00005 TABLE1e LightChainCDR2 Sequence SEQIDNO YDNKRPS 30 ANSQRPS 31 ADSHRPS 32 YDNNRPS 33 YDSNRPS 34 ADSKRPS 35 DDSHRPS 36 DDSQRPS 37

TABLE-US-00006 TABLE1f LightChainCDR3 Sequence SEQIDNO GTWDASLSGYV 38 GSWDYSLSGYV 39 ATWDYSLSGYV 40 GAWDDSLSGYV 41 GAWDDSLSGYV 41 GTWDYSLSGYV 42

[0577] In some embodiments of the present invention, the heavy chain and light chain variable region sequences of the antibody or antigen-binding fragment comprising the above light chain and heavy chain CDR sequences are disclosed in Table 2a and Table 2b below, respectively.

TABLE-US-00007 TABLE2a HeavyChainVariableRegion(VH)Sequence SEQIDNO EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVS 43 WISPDSGSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARP TGRFDYWSQGTLVTVSS EVQLLESGGGLVQPGSSLRLSCAASGFTFSDYYMSWVRQAPSKGLEWVS 44 SISPDGSNTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKN LRAFDYWGQGTLVTVSS EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVS 45 WISPGGGSKYTADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR VNGRFDYWGQGTLVTVSS EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYDMSWVRQAPGKGLEWVS 46 AIYHSGSSKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR GGNGAWDTGFDYWGQGTLVTVSS EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVS 47 GISHGSGNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK RLSLRRRPSYYSDNAMDVWGQGTLVTVSS EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVS 48 SISHNSGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKFI SARKSLGRSYSNGMDVWGQGTLVTVSS EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYDMSWVRQAPGKGLEWVS 49 VISPDGGSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARD VVECNMNPCSYDNAMDVWGQGTLVTVSS EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYDMSWVRQAPGKGLEWVS 50 SISPSSGSSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKA PGWCQAPSCYYDNAMDVWGQGTLVTVSS EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYYMSWVRQAPSGKGLEWVS 98 SISPDASNTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKN LRAFDYWGQGTLVTVSS EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYDMSWVRQAPGKGLEWVS 99 AIYHSGSSKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR GGNAAWDTGFDYWGQGTLVTVSS

TABLE-US-00008 TABLE2b LightChainVariableRegion(VL)Sequence SEQIDNO QSVLTQPPSASSTPGQRVTISCSGSSSNIGNNNVNWYQQLPSTAPKILIYY 51 DNKRPSSVPDRESGSKSGTSASLAISGLRSEDEADYYCGTWDASLSGYVF GGGTKLTVLG QSVLTQPPPASGTPGQRVTISCSGSSSNIGSNTVYWYQQLPGTAPKLLIYA 52 NSQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGSWDYSLSGYVF GGGTKLTVLG QSVLTQPPSASGTPGQRVTISCSSSSSNIGNNNVSWYQQLPGTAPKLLIYA 53 DSHRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCATWDYSLSGYVF GGGTKLTVLG QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNDVSWYQQLPGTAPKLLIYY 54 DNNRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGAWDDSLSGYVF GGGTKLTVLG QSVLTQPPSASGTPGQRVTISCTGSSSNIGNNAVNWYQQLPGTAPKLLIYY 55 DSNRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGAWDDSLSGYVF GGGTKLTVLG QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNDVTWYQQLPGTAPKLLIYA 56 DSKRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGTWDYSLSGYVF GGGTKLTVLG QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNYVSWYQQLPGTAPKLLIYD 57 DSHRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGAWDDSLSGYVF GGGTKLTVLG QSVLTQPPSASGTPGQRVTISCSGSSSNIGNNDVSWYQQLPGTAPKLLIYD 58 DSQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGAWDDSLSGYVF GGGTKLTVLG

[0578] In some embodiments, the CDRs of the respective light chain variable regions and the CDRs of the respective heavy chain variable regions disclosed in Table 1a through Table if above may be combined freely.

[0579] In some embodiments, the heavy chain and light chain variable regions disclosed in Table 2a and Table 2b may be combined freely for preparation of various forms of antibody, and for example, a single antibody such as ScFV or a domain antibody or full-length antibody may be formed.

[0580] Each of the heavy chain and light chain variable regions disclosed in the present invention may bind to various target heavy chain and light chain constant regions to form heavy chains and light chains, respectively, of an intact antibody. Further, the respective heavy chain and light chain sequences bonded to constant regions may further be combined to form an intact antibody structure.

[0581] Any variable region of a heavy chain or light chain of the antibody according to the present invention may be linked to at least part of a constant region. The constant region may be selected according to whether antibody-dependent cell-mediated cytotoxicity, antibody-dependent cell phagocytosis and/or complement-dependent cytotoxicity, etc. is required.

[0582] Whichever is appropriate of the above constant regions may be used depending on the objective, for example human or mouse-derived constant region. In some embodiments, a human heavy chain constant region IgG1 is used, represented by SEQ ID No. 91. In some embodiments, a human lambda region represented by SEQ ID No. 93 is used as a light chain constant region.

[0583] Any variable region disclosed in the present invention may bind to a constant region to form heavy chain and light chain sequences. In some embodiments, a heavy chain variable region disclosed in the present invention may be linked to a human IgG1 constant region, represented by SEQ ID NO. 59 to 66, 100 and 101. In some embodiments, the light chain variable region disclosed in the present invention may be linked to a human lambda constant region, and these are represented respectively by SEQ ID No. 67 through 74. The light chain and heavy chain according to the present invention may be combined in a variety of combinations to form intact antibodies comprising two light chains and two heavy chains.

[0584] However, these constant region sequences which may be combined with variable regions disclosed in the present invention are intended to be exemplary, and those skilled in the art shall be able to know that other variable regions, including IgG1 heavy chain constant regions, IgG3 or IgG4 heavy chain constant regions, any kappa or lambda light chain constant region, or other variable regions modified to give target characteristics such as stability, expression, manufacturability or otherwise may be used.

[0585] The present invention also includes one or more nucleic acid sequences having substantial sequence identity to one or more nucleic acid sequences disclosed in the present invention. Substantial identity means that the antibody or antigen-binding fragment encoded by the nucleic acid maintains the effect disclosed In the present disclosure, even with sequence variation. In some embodiments, the sequence has about 90%, 95%, or 99% identity to the heavy chain variable regions disclosed in Table 2a. In some embodiments, the sequence has about 90%, 95%, or 99% identity to the light chain variable regions disclosed in Table 2b. For example, in the case of variant showing 90%, 95%, or 99% identity to the antibody or antigen-binding fragment disclosed In the present disclosure, the variation occurs at the framework of the variable region, rather than at the CDRs.

[0586] In some embodiments, the nucleic acid coding the antibody disclosed in the present invention or a fragment thereof is a nucleic acid which codes the CDRs disclosed In the present disclosure, a variable region including the CDRs, and a whole length antibody including the variable region and a constant region. Upon determining the amino acid sequence, the nucleic acid sequence may be readily determined using known reverse transcription programs and with consideration for codon usage, etc. An example of a nucleic acid sequence for a heavy chain constant region coding human IgG1 may be represented by SEQ ID No. 92. An example of a nucleic acid sequence for a light chain constant region coding human lambda may be represented by SEQ ID No. 94 or 95. Examples of nucleic acid sequence for a whole-length heavy chain including the above constant region nucleic acid may be represented by SEQ ID NO. 75 through 82, 102 and 103 (heavy chain including human IgG1 constant region), and examples of nucleic acid sequence for a whole-length light chain may be SEQ ID No. 83 through 90 (light chain including human lambda constant region).

[0587] Further, nucleic acid sequences coding the CDR sequences of Table 1a through Table 1f, and the variable regions of Table 2a and Table 2b, are included. These nucleic acids are included in the nucleic acid sequences coding the whole-length antibody disclosed in the above, and are not indicated separately. Those skilled in the art will be able to, based on the protein sequences of the CDRs and variable regions disclosed In the present disclosure, readily identify from among SEQ ID No. 75 through 90 the nucleic acid sequences which code the same.

[0588] The present invention further includes at least one nucleic acid sequence which has substantial sequence identity with at least one nucleic acid disclosed in the present invention. Substantial identity means that the antibody or antigen-binding fragment encoded by the nucleic acid maintains the effect disclosed In the present disclosure, even in cases where nucleic acid variation causes conservative substitution or amino acid variation in which the variation of nucleic acid is not accompanied by amino acid substitution.

Specificity and Affinity of Antibody to Antigen

[0589] The antibody or antigen-binding fragment according to the present invention has specificity in particular to the ECD of ROR1 antigen, and affinity appropriate for use as an antibody therapeutic or diagnostic agent. In one embodiment, according to Table 6, the affinity to an aggregate is KD<1.010.sup.9 M; and in another embodiment, KD1.010.sup.10 M. The antibody or antigen-binding fragment according to the present invention having such affinity has the advantage of being administrable in loser doses compared to antibodies having lower affinity, for example 10.sup.8 M or 10.sup.9 M. Whereas antibodies are not limited to those described in the foregoing, [those described] have a large clinical advantage as sufficient efficacy can be achieved through more convenient methods of administration, such as subcutaneous injection.

Variable Region of Antibody

[0590] The present invention includes the variable regions of the heavy chains and light chains disclosed in Table 2a and Table 2b above. Further, the present invention includes an antibody including an immunological functional fragment, a derivative, a mutant protein and a variant of the light chain and heavy chain variable regions (and corresponding nucleic acid sequence). An antibody wherein the variable regions of heavy chains and light chains according to the present invention are combined in various ways may be expressed as VHx/VLy, where x is the heavy chain variable region SEQ ID NO., and y corresponds to the light chain. In one example, the variable region may include the following combinations: VH43/VL51, VH43/VL52, VH43/VL53, VH43/VL54, VH43/VL55, VH43/VL56, VH43/VL57, VH43/VL58, VH44/VL51, VH44/VL52, VH44/VL53, VH44/VL54, VH44/VL55, VH44/VL56, VH44/VL57, VH44/VL58, VH45/VL51, VH45/VL52, VH45/VL53, VH45/VL54, VH45/VL55, VH45/VL56, VH45/VL57, VH45/VL58, VH46/VL51, VH46/VL52, VH46/VL53, VH46/VL54, VH46/VL55, VH46/VL56, VH46/VL57, VH46/VL58, VH47/VL51, VH47/VL52, VH47/VL53, VH47/VL54, VH47/VL55, VH47/VL56, VH47/VL57, VH47/VL58, VH48/VL51, VH48/VL52, VH48/VL53, VH48/VL54, VH48/VL55, VH48/VL56, VH48/VL57, VH48/VL58, VH49/VL51, VH49/VL52, VH49/VL53, VH49/VL54, VH49/VL55, VH49/VL56, VH49/VL57, VH49/VL58, VH50/VL51, VH50/VL52, VH50/VL53, VH50/VL54, VH50/VL55, VH50/VL56, VH50/VL57, VH50/VL58, VH98/VL51, VH98/VL52, VH98/VL53, VH98/VL54, VH98/VL55, VH98/VL56, VH98/VL57, VH98/VL58, VH99/VL51, VH99/VL52, VH99/VL53, VH99/VL54, VH99/VL55, VH99/VL56, VH99/VL57, or VH99/VL58.

Various Other Forms of Antibody

[0591] The antibody disclosed in the present invention is also a variant of the antibody disclosed in the present invention. For example, a part of an antigen comprises conservative amino acid substitution in one or more of the residues of the heavy chains, light chains, variable regions or CDR sequences disclosed in the above. A conservative amino acid substitution refers to a substitution which does not substantially affect the activity of a polypeptide or its antigenicity. In some embodiments, a conservative amino acid substitution refers to a substitution with another residue falling in the same category in the following amino acid categorization. Naturally occurring amino acids can be categorized as follows, based on common properties of side chain properties: 1) hydrophobic: norleucine, Met, Ala, Val, Leu, Ile; 2) neutral, hydrophilic: Cys, Ser, Thr, Asn, Gln; 3) acidic: Asp, Glu; 4) basic: His, Lys, Arg; 5) residue affecting a chain direction: Gly, Pro; and 6) aromatic: Trp, Tyr, Phe. The conservative amino acid substitution may also comprise a non-naturally-occurring amino acid residue such as a peptide mimetic, and this residue is typically introduced by chemical synthesis, not a cell.

[0592] Non-limiting examples of conservative amino acid substitution are shown in, and are not limited to, Table 3.

TABLE-US-00009 TABLE 3 Conservative amino acid substitution original residue Exemplary subsititution Ala Ser Arg Lys Asn Gln, His Asp Glu Cys Ser Gln Asn Glu Asp Gly Pro His Asn, Gln Ile Leu, Val Leu Ile, Val Lys Arg, Gln, Glu Met Leu, Ile Phe Met, Leu, Tyr Ser Thr Thr Ser Trp Tyr Tyr Trp, Phe Val Ile, Leu

[0593] Non-conservative substitution includes substitution with a residue which belongs to other categories in the above categorization. Such substitution may be adopted into a region of an antibody which is homologous to a human antibody, or a non-homologous region of the same.

Preparation of Antibody

[0594] In the present disclosure, non-human antibody may be derived from, for example, any antibody-producing animal, for example, mouse, rat, rat, rabbit, goat, donkey or non-human primates (for example monkeys such as the cynomolgus monkey or rhesus macaque) or apes (for example, chimpanzees). Non-human antibody can be produced by immunizing animals using methods known to the art. The antibody may be polyclonal or monoclonal, or may be synthesized within a cell host through expression of recombinant DNA. Fully human antibody may be produced by administering antigen to a transformed animal including a human immunoglobulin gene locus, or by treating a phage display library expressing a human antibody repertory with antigen, then selecting the target antibody.

[0595] A monoclonal antibody (mAb) may be produced using conventional monoclonal antibody methods, for example the standard somatic hybridization method in literature (See: Kohler and Milstein, 1975, Nature 256:495).

[0596] The single chain antibody disclosed in the present invention may be produced using an amino acid bridge (short peptide linker) to link heavy chain and light chain variable domain (Fv region) fragments. The single-chain antibody disclosed in the present invention includes scFv including combinations of heavy chain and light chain variable region domains listed in Table 1a through Table 1f, or the CDRs disclosed in Table 1a through Table 1f, but is not limited thereto.

[0597] Also, the antibody disclosed in the present invention may be modified to a different subtype antibody through subtype switching. Accordingly, an IgG antibody may, for example, be derived from an IgM antibody, and the reverse is also possible.

[0598] Accordingly, included among the antibodies disclosed in the present invention are, for example, the variable domain combination antibody according to the present invention, switched to the target isotype (for example, IgA, IgG1, IgG2, IgG3, IgG4, IgE and IgD).

Method for Expressing Antibody

[0599] The present invention further relates to an expression systems and constructs in the form of plasmids, expression vectors, and transcription or expression cassettes including at least one polynucleotide described in the above; a host cell comprising such expression systems or constructs; and a method for producing antibody using the expression systems or host cells.

[0600] The antibody disclosed in the present invention may be expressed in a hybridoma cell line or a cell line other than a hybridoma. Expression constructs coding the antibody may be used to transform mammalian, insect or microbial host cells. Constructs such as plasmids may be prepared, as described in the foregoing, any of various known methods for introducing polynucleotide into a host cell. The specific method may vary according to the type of host cell. Methods for introducing a heterogeneous polynucleotide into a mammalian cell are widely known to the art, and include, and are not limited to, for example, dextran-mediated transfer, calcium phosphate precipitation, polybrene-mediated transfer, protoplast fusion, electrophoresis, capsulation of transferred polynucleotide using liposome, mixing of nucleic acid and positively charged lipid, and direct microinjection of DNA into the nucleus.

Use of Human ROR1 Antibody for Therapeutic and Treatment Purposes

[0601] In cancers, ROR1 is associated with unfavorable prognosis of cancer patients, and is reported to also affect metastasis. ROR1 is overexpressed not only in hematologic malignancy such as B-cell leukemia, lymphoma, acute myeloid leukemia (AML), Burkitt lymphoma, chronic lymphocytic leukemia (CLL), mantle cell lymphoma (MCL), acute lymphoblastic leukemia (ALL), Diffuse large B-cell lymphoma (DLBCL), follicular lymphoma (FL) and marginal zone lymphoma (MZL), etc. but also solid cancer including breast cancer, renal cancer, ovarian cancer, gastric cancer, liver cancer, lung cancer, colorectal cancer, pancreatic cancer, skin cancer, bladder cancer, testicular cancer, uterine cancer, prostate cancer, non-small cell lung cancer (NSCLC), neuroblastoma, brain cancer, colon cancer, squamous cell carcinoma, melanoma, myeloma, cervical cancer, thyroid cancer, head and neck cancer and adrenal cancer, etc. For anti-cancer antibody therapy, for example, ROR1 antibody may, as described In the present disclosure, be used in the form of the antibody alone or in a form bonded to various cytotoxic agents to remove cancer cells which overexpress ROR1. Accordingly, antibody binding to ROR1 may be used alone or as bonded to anti-cancer chemotherapeutic agents, cytotoxic agents or radioactive materials, or may be embodied as a cytotherapeutic agent such as CAR-T cells for example, to target an anti-cancer target, and thereby used as a targeted therapeutic agent which guides a therapeutic agent derived from the antibody disclosed in the present invention to a cell expressing ROR1.

Method of Treatment: Pharmaceutical Formulation and Administration Pathway

[0602] A treatment method using an antibody, an antibody drug conjugate, or a pharmaceutically acceptable salt or solvate thereof is also provided. In certain embodiments, the antibody, antibody drug conjugate, or a pharmaceutically acceptable salt or solvate thereof is provided to a patient. The antibody, antibody drug conjugate, or a pharmaceutically acceptable salt or solvate thereof binds to human ROR1 expressed on the surface of cancer cells, thereby suppressing metastasis of cancer cells. In some embodiments, the antibody in a form bonded to a cytotoxic agent binds to human ROR1 expressed on the surface of cancer cells, specifically delivering the cytotoxic agent to cancer cells to induce cell death of the cancer cells. In some embodiments, the antibody in a form of an antibody specific to the same or a different target binds to human ROR1 expressed on the surface of cancer cells, thereby increasing the specificity of a multi-specific antibody to cancer cells or inducing the connection of cancer cells to other types of cell such as immune cells, and inducing death of cancer cells. In certain embodiments, the antibody is expressed on the surface of cytotherapeutic agents such as CAR-T cells, binding to human ROR1 and thereby specifically delivering the cytotherapeutic agent to the cancer cells to induce their death.

[0603] A pharmaceutical composition comprising a therapeutically effective dose of the antibody drug conjugate and a pharmaceutically acceptable diluent, carrier, solubilizer, emulsifier, preservative and/or supplement is also provided. In addition, for example, a method for treating a cancer patient by administering such a pharmaceutical composition is included. The term patient includes a human patient.

[0604] The pharmaceutical composition may comprise pharmaceutically acceptable carriers. Here, carriers refer to excipients, diluents or adjuvants. The carrier may be selected from a group comprised of lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, acacia rubber, alginate, gelatin, calcium phosphate, calcium silicate, cellulose, methyl cellulose, microcrystalline cellulose, polyvinyl pyrrolidone, water, saline, PBS and other buffer solutions, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate and mineral oil. The composition may include fillers, anticoagulants, lubricants, wetting agents, flavoring agents, emulsifiers, preservatives, or combinations thereof.

[0605] The pharmaceutical composition may be formulated as any dosage form according to known methods. The composition may be formulated into formulations for oral administration (for example, powders, tablets, capsules, syrups, pills or granules) or non-oral administration (for example, injections). Further, the composition may be prepared as a systemic or local formulation.

[0606] The pharmaceutical composition may comprise the antibody conjugate, an antigen-binding fragment thereof, anti-cancer agents, or combinations of these in effective amounts. The term effective amount refers to an amount sufficient to exhibit preventive or therapeutic effects when administered to an individual requiring prevention or treatment. The effective amount may be appropriately selected by a PHOSITA depending on the cell or individual, and may be determined based on elements including severity of illness, patient age, body weight, health, gender, sensitivity to drugs, duration of administration, administration pathway, excretion ratio, duration of therapy, and drugs mixed with the composition or used concomitantly therewith, and other elements well known to the field of medicine. The effective amount may be approximately 0.1 g to approximately 2 g per [unit missing] of the pharmaceutical composition.

[0607] The administration dose of the pharmaceutical composition may be, for example, 10 g /kg to approximately 30 mg/kg for an adult, selectively 0.1 mg/kg to approximately 30 mg/kg, or alternatively 0.3 mg/kg to approximately 20 mg/kg. The administration may be performed once a day, multiple times a day, or once per week to four weeks, or one two twelve times per year.

[0608] In the following, preferred embodiments are presented to aid understanding of the present invention. However, the following embodiments are provided to facilitate understanding of the present invention, and the present invention is not limited to these embodiments.

Embodiment 1: Preparation of ROR1 Antibody

Embodiment 1-1: Antigen

[0609] As the antigen, an ROR1 ECD-Fc type protein wherein Fc is connected to the C-terminal of the extracellular domain (ECD) of human ROR1 was used.

[0610] Specifically, to prepare the antigen, a residue including the extracellular domain of ROR1 and corresponding to amino acid 1 through amino acid 406 of the ROR1 amino acid sequence represented by NCBI reference number NP_0050032 was used. As for the gene coding the extracellular domain of the ROR1, cDNA from Origene was purchased and used (Origene, RC214967). In addition, to purify the ROR1 extracellular domain thereafter, a gene coding human IgG1-derived Fc protein was synthesized and linked to the 3 terminal of the gene coding the ROR1 extracellular domain (hereinafter referred to as ROR1-Fc). By introducing the gene into a pcDNA3.1 vector, a vector which codes ROR1-Fc nucleic acid in a mammalian cell line was obtained.

[0611] The expression vector was transiently transfected into HEK 293E cells to express ROR1-Fc by culturing in DMEM-/F12 medium at 8% CO2 and 37 C., and collecting the medium every 72 hours. Protein A affinity chromatography was used to purify the Fc-ROR1 ECD protein.

Embodiment 1-2: Selection of Antibody Through Phage Library Screening

Preparation of Library Phage

[0612] Escherichia coli 210 10 with a human-derived single-chain variable fragment (scFv) library (Yang et. Al., 2009 Mol. Cells 27: 225) gene with binding potential to various antigens was cultured for 2 to 3 hours at 37 C. (0D600=0.50.7) in medium containing 2X YT (Amresco, J902-500G), carbenicillin (Duchefa, C.sub.01090025) 100 g/mcustom-character and 2% glucose (sigma, G.sub.7021), then infected with helper phage and cultured for 16 hours at 30 C. in a 2X YT medium [2X YT, carbenicillin, 70 g/mcustom-character kanamycin (Duchefa, K0126), 1 mM IPGTG (Duchefa, I1401)] to induce phage packaging. Thereafter, the cultured cells were centrifuged (6000 rpm, 15 minutes, 4 C.), and then 4% PEG8000 (sigma, P2139) and 3% NaCl (Samchun, S2097) was added to the supernatant and dissolved thoroughly and reacted for 1 hour in ice. After centrifuging once again (8000 rpm, 20 minutes, 4 C.), PBS (Phosphate buffered saline, Gibco 10010-023) was added to the pellet to create a suspension, which was again centrifuged (12000 rpm, 10 minutes, 4 C.). The supernatant containing library phage was placed in a new tube, and kept at 4 C. until use.

Panning Through Phage Display

[0613] To screen antibodies binding to human ROR1 protein, the ROR1-Fc protein prepared in Embodiment 1-1 was used to carry out panning a total of three times as explained in the following.

[0614] Specifically, in an immunotube (maxisorp 444202), ROR1-Fc at a concentration of 10 g/mcustom-character and a negative control-Fc (BCMA-Fc) were added to PBS. Protein was allowed to be adsorbed on the surface of the immunotube over night at 4 C., after which a 3% BSA (bovine serum albumin) solution was added to the immunotube to protect surfaces on which the ROR1-Fc had not been adsorbed. The immunotube was emptied, and 10.sup.12 CFU antibody phage library dispersed in 3% BSA solution was placed in the immunotube where the control Fc protein is adsorbed, then allowed to react for 1 hour at room temperature (negative selection). Thereafter, the phages which did not bind to the negative control Fc were recovered and bonded to the immunotube to which ROR1-Fc had been adsorbed. The non-specifically bound phages were removed by washing 5 to 30 times using PBS-T solution (Phosphate buffered saline-0.05% Tween 20), then the remaining antigen-specific phage antibodies were recovered using 100 mM triethylamine solution. The recovered phages were neutralized with 1M Tris buffer (pH 7.4). ER2537 E. Coli was infected for 1 hour at 37 C., and the infected E. Coli was plated on 2X YT agar medium and cultured overnight at 37 C. The next day, the cultured E. Coli was suspended in 4 mcustom-character of 2X YT carbenicillin culture, and 15% glycerol was added. Some was stored at 80 C., and the rest was used to prepare phages for the next experiment. This process was repeated a total of three times to amplify and concentrate the ROR1 antigen-specific phage pool.

Monoclonal Phage Antibody Screening (Single Clone Screening)

[0615] The following experiment was performed to select a monoclonal antibody that specifically binds to ROR1 from the phage pool obtained through panning.

[0616] To isolate the monoclones from the concentrated pool, the phage pool was plated in LB-tetracycline/carbenicillin agar medium and cultured to obtain a single colony. Monoclones were then inoculated into 96 deep well plates containing 400 custom-character of 2 YT-tetracycline/carbenicillin medium per well and grown overnight, then 10 custom-character of the culture was added to a new 96 deep well plate containing 390 custom-character of 2 YT-tetracycline/carbenicillin and incubated at 37 C. for 4 hours. 1 mM IPTG was added to the culture solution and incubated overnight at 30 C. The culture solution cultured overnight was centrifuged to obtain the supernatant.

[0617] Thereafter, the ELISA method was used as follows to select clones expressing monoclonal soluble scFv binding to ROR1-Fc antigen (Steinberger Rader and Barbas III 2000 Phage display vectors In: Phage Display Laboratory Manual 1 sted Cold Spring Harbor Laboratory Press NY USA pp119-1112). Specifically, 100 ng per well of recombinant human ROR1-Fc prepared in Embodiment 1-1 or FBMA-Fc was placed in a 96-well microtiter plate (Nunc-Immuno Plate, NUNC, USA), which was coated overnight at 4 C. BCMA-Fc is the protein used as a negative control, a recombinant protein where the extracellular domain of human BCMA protein is linked to human Fc. 200 L each of 3% BSA was placed in each well, and blocked for 2 hours at 37 C.

[0618] The monoclonal phage supernatant was prepared by mixing 1:1 with 3% BSA, and 100 L each of this mixture was loaded into the wells and reacted for 2 hours at 37 C. After washing times with 300 L PBST, anti-HA HRP binding antibody was added, reacted for 1 hour at 37 C., then washed 5 times with PBST. 100 L TMB (Tetramethylbenzidine, Sigma, T0440) was added for color development, and then 50 L 1N H2SO4 was added to stop the reaction. Absorbance was measured at 450 nm and 650 nm, and clones where the absorbance at 450 nm and 650 nm was 10 or higher when coated with 1 g/mL ROR1 were screened (FIG. 1)

[0619] Next, flow cytometry was used to screen clones binding to cell lines expressing ROR1. Specifically, 100 custom-character of the monoclonal scFv supernatant was reacted with a cell line (JeKo-1) overexpressing ROR1, then washed two times with PBS. After reacting with anti-HA-FITC antibody (Sigma, H7411) at 4 C. for 30 minutes, and washing twice with PBS then suspending in 200 custom-character PBS, a FACSCalibur flow cytometer (BD Bioscience) was used to screen clones binding to the JeKo-1 cell line (FIG. 2)

[0620] This this process, 10 antibody clones (AB4, A2F2, A2F3, BA6, CC9, C2E3, DG6, D2B12, A2F2 M1 and BA6 M1) binding to recombinant human ROR1 protein and cell lines expressing ROR1 were screened. The amino acid sequence and CDR sequence of the heavy chain variable region and light chain variable region of each of these antibodies are as shown in the following tables.

TABLE-US-00010 TABLE4a CDRSequenceofHeavyChainVariable(VH) CDR1 CDR2 CDR3 VH SEQ SEQ SEQ SEQ ID ID ID ID Clone Sequence NO Sequence NO Sequence NO NO AB4 SYDMS 1 WISPDSGSIYYADS 6 PTGRFDY 14 43 VKG A2F2 DYYMS 2 SISPDGSNTYYADS 7 NLRAFDY 15 44 VKG A2F3 SYDMS 1 WISPGGGSKYYAD 8 VNGRFDY 16 45 SVKG BA6 NYDMS 3 AIYHSGSSKYYAD 9 GGNGAWDTGFDY 17 46 SVKG CC9 SYDMS 1 GISHGSGNKYYAD 10 RLSLRRRPSYYSD 18 47 SVKG NAMDV C2E3 NYAMS 4 SISHNSGSTYYADS 11 FISARKSLGRSYSN 19 48 VKG GMDV DG6 DYDMS 5 VISPDGGSIYYADS 12 DVVECNMNPCSY 20 49 VKG DNAMDV D2B12 NYDMS 3 SISPSSGSSIYYADS 13 APGWCQAPSCYY 21 50 VKG DNAMDV A2F2 DYYMS 2 SISPDASNTYYADS 96 NLRAFDY 15 98 M1 VKG BA6 NYDMS 3 AIYHSGSSKYYAD 9 GGNAAWDTGFDY 97 99 M1 SVKG

TABLE-US-00011 TABLE4b CDRSequenceofLightChainVariable(VL) CDR1 CDR2 CDR3 VL SEQ SEQ SEQ SEQ ID ID ID ID Clone Sequence NO Sequence NO Sequence NO NO AB4 SGSSSNIGNNNVN 22 YDNKRPS 30 GTWDASLSGYV 38 51 A2F2 SGSSSNIGSNTVY 23 ANSQRPS 31 GSWDYSLSGYV 39 52 A2F3 SGSSSNIGNNNVS 24 ADSHRPS 32 ATWDYSLSGYV 40 53 BA6 SGSSSNIGSNDVS 25 YDNNRPS 33 GAWDDSLSGYV 41 54 CC9 TGSSSNIGNNAVN 26 YDSNRPS 34 GAWDDSLSGYV 41 55 C2E3 TGSSSNIGSNDVT 27 ADSKRPS 35 GTWDYSLSGYV 42 56 DG6 SGSSSNICSNYVS 28 DDSHRPS 36 GAWDDSLSGYV 41 57 D2B12 SGSSSNIGNNDVS 29 DDSQRPS 37 GAWDDSLSGYV 41 58 A2F2M1 SGSSSNIGSNTVY 23 ANSQRPS 31 GSWDYSLSGYV 39 52 BA6M1 SGSSSNIGSNDVS 25 YDNNRPS 33 GSWDYSLSGYV 41 54

[0621] The nucleic acid sequence encoding the variable region and CDR sequences is included as part of the nucleic acid sequence encoding the following full length heavy chains and light chains, in the order of AB4, A2F2, A2F3, BA6, CC9, C2E3, DG6, D2B12, A2F2 M1 and BA6 M1: SEQ ID NO. 75 (Heavy chain) and 83 (light chain); SEQ ID NOs. 76 (heavy chain) and 84 (light chain); SEQ ID NOs. 77 (heavy chain) and 85 (light chain); SEQ ID NOs. 78 (heavy chain) and 86 (light chain); SEQ ID NOs. 79 (heavy chain) and 87 (light chain); SEQ ID NOs. 80 (heavy chain) and 88 (light chain); SEQ ID NOs. 81 (heavy chain) and 89 (light chain); SEQ ID NOs. 82 (heavy chain) and 90 (light chain); SEQ ID NOs: 102 (heavy chain) and 84 (light chain); SEQ ID NO: 103 (heavy chain) and 86 (light chain). The nucleic acid sequence encoding the constant region in the nucleic acid sequence is SEQ ID NO. 92 (heavy chain), and SEQ ID NO. 94 (light chain) or 95 (light chain).

Embodiment 2: Conversion of Anti-ROR1 scFV into Full IgG Form, and Production of the Same

Embodiment 2-1: Cloning of Anti-ROR1 scFV into Full IgG Form

[0622] To convert the sequences of each of the ROR1-specific monoclonal phage antibodies obtained in Embodiment 1 to full IgG form, nucleic acids encoding the heavy chain and light chain variable regions of the respective clones obtained in Embodiment 1 were synthesized (Genotech, South Korea). After synthesizing genes encoding the heavy chain and light chain constant regions (SEQ ID No. 91 and 93, respectively) of the human IgG1 subtypes, the genes were connected with nucleic acid encoding the respective heavy chain and light chain variable regions. The nucleic acids encoding the light chains and heavy chains of the respective antibodies were respectively cloned into pcDNA3.1-based expression vectors, obtaining vectors encoding antibody nucleic acids in CHOS mammalian cell lines.

[0623] As for the reference group, a chimera antibody where human IgG1 is bonded to the variable region of the conventional anti-ROR1 antibody 2A2 (U.S. Pat. No. 9,316,646) was used.

[0624] The antibodies according to the present invention in IgG form are disclosed with the following heavy and light chain full-length sequences, in the order of AB4, A2F2, A2F3, BA6, CC9, C2E3, DG6, D2B12 A2F2 M1 and BA6 M1: SEQ ID NOs. 59 (heavy chain) and 67 (light chain); SEQ ID NOs. 60 (heavy chain) and 68 (light chain); SEQ ID NOs. 61 (heavy chain) and 69 (light chain); SEQ ID NOs. 62 (heavy chain) and 70 (light chain); SEQ ID NOs. 63 (heavy chain) and 71 (light chain); SEQ ID NOs. 64 (heavy chain) and 72 (light chain); SEQ ID NOs. 65 (heavy chain) and 73 (light chain); SEQ ID NOs. 66 (heavy chain) and 74 (light chain) SEQ ID NOs: 100 (heavy chain) and 68 (light chain); SEQ ID NOs: 101 (heavy chain) and 70 (light chain).

Embodiment 2-2: Expression of Anti-ROR1 IgG Antibodies

[0625] CHOS cells were adjusted to a concentration of 1.5106 cells/ml in CD-CHO (Gibco, 10743) medium, then cultured for 1 day at 37 C. and 8% CO.sub.2. On the day of DNA transfection, the cells, which had grown to 2.5 to 3106 cells/ml, were prepared to a concentration of 2.1106 cells/ml using a CD-CHO medium containing 1% DMSO and then cultured for 3 hours at 37 C. and 8% CO.sub.2. After centrifuging for 15 minutes at 3000 rpm, the supernatant was removed, and re-suspended in RPMI 1640 medium containing 25% FBS. Thereafter, vectors expressing the heavy chain and light chain of Embodiment 2-1 were diluted in Opti-MEM medium at a rate of 1 g per ml medium, and PEI (Polysciences, 23966, stock concentration: 1 mg/ml) was diluted at a rate of 8 g per ml culture medium.

[0626] The vector and PEI mixture was fixed at room temperature for 10 minutes, then placed in a flask containing cells prepared as described above. After culturing for 4 hours at 5% CO2, 37 C. and 100 rpm, CD-CHO of the same volume as the culture was added, followed by culturing for 4 days at 8% CO2, 37 C. and 110 rpm.

Embodiment 2-3: Isolation and Purification of Anti-ROR1 IgG Antibodies

[0627] Equilibrium buffer solution (50 mM Tris-HCl, pH7.5, 100 mM NaCl) was brought to equilibrium by passing through a Mab selectsure (GE healthcare, 5 mL), the culture solution of Embodiment 3-2 was passed through a column (Mab selectsure (GE healthcare, 5 mL) so that the expressed antibody would bind to the column. Thereafter, after eluting with 50 mM Na-citrate (pH 3.4) and 100 mM NaCl solution, 1M Tris-HCl (pH 9.0) was used to neutralize and achieve a final pH of 7.2. The buffer solution was exchanged with PBS (phosphate buffered saline, pH 7.4).

Embodiment 3: Analysis of Binding Specificity of Anti-ROR1 IgG Antibody to ROR1

Embodiment 3-1: Analysis of Binding Capacity (ELISA) of Anti-ROR1 IgG Antibody to ROR1 Antigen (Extracellular Domain)

[0628] The specific binding capacities of the IgG antibodies of the respective clones prepared and screened in Embodiment 2 to antigen were analyzed as follows.

[0629] Anti-ROR1 antibodyantigen binding affinity was assessed using an ELISA-based solution binding assay. Specifically, a 96-well microtiter plate (Nunc-Immuno Plates), NUNC) was coated for 16 hours at 4 C. with the ROR1 protein described below at a concentration of 1 g/mcustom-character in PBS solution, and non-specific binding sites were blocked for 2 hours with 3% BSA (bovine serum albumin). Here, the ROR1 protein used was, in the case of human ROR1, the ROR1-Fc or recombinant human ROR1-His (Sino Biological, 13968-H08H) of Embodiment 1. The ROR1-His used in ELISA, as stated in the above sentence, was a protein from the Sino Biological company (13968-H08H), and the ROR1-His of Embodiment 1 or recombinant mouse ROR1 protein was used (Acrobiosystems, RO1-M5221-100 g)

[0630] Subsequently, the anti-ROR1 antibodies prepared in Embodiment 3 were added at the concentrations stated in FIG. 2 to a 96-well microtiter plate, and binding capacity was analyzed using ELISA as follows. Specifically, after incubating for 2 hours, the plate was washed 5 times with PBS containing 0.05% Tween 20, then HRP-conjugated Fab multiclonal antibody reagent (Perce, 31414) was diluted to 1:10,000 and placed in the washed microtiter plate. After reacting for 1 hour at 37 C., the ROR1 antibodies bonded to the plate were detected. After the reaction, color development was performed using TMB (Tetramethylbenzidine, Sigma, T0440). The enzymatic reaction was stopped using 0.5 mol/L sulfuric acid, and absorbance at 450 nm and 650 nm was measured (450 nm-650 nm) using a micro plate reader (Molecular Device)

[0631] The results are shown in FIG. 3a, FIG. 3b and FIG. 4, and it was confirmed that the anti-ROR1 antibody of the present invention binds to human ROR1 and mouse ROR1 in a concentration-dependent manner. Further when comparing the cross-reactivity to mouse ROR1 protein, the ROR1 antibody according to the present invention was found to have superior binding capacity compared to the 2A2 antibody used as a reference group.

Embodiment 3-2: Measuring the Specific Binding Capacity of Anti-ROR1 IgG Antibody to Cell Surface-Expressed ROR1 Antigen (FACS)

[0632] It is critical for an antibody to a certain antigen to be used in vivo as a therapeutic antibody, for example, that it binds to antigens expressed at the cell surface. Some antigens will bind to purified antigen, but will not bind to cell surface-expressed antigen. In such cases, even in the antibody is administered in vivo, it cannot bind to antigen, meaning that the antibody is unable to bind to cells expressing the antigen and that a therapeutic antibody, etc. is unable to exhibit in vivo activity.

[0633] Accordingly, FACS analysis was carried out to confirm that the anti-ROR1 antibody of the present invention binds to cell surface-expressed ROR1.

[0634] For this experiment, using cell lines (FIG. 5 and FIG. 7, respectively) transiently (CHO-human ROR1, CHO-human ROR2, CHO-mouse ROR1) or stably (MC38-human ROR1) transfected with ROR1 gene to achieve artificial over-expression of ROR1 protein, an ROR1-expressing cell line (JeKo-1, Mino) (FIG. 6), a non ROR1-expressing cell line (MCF7) (FIG. 6) and a FACSCalibur (BD Biosciences) device was used to measure the degree to which anti-ROR1 antibody and ROR1 were bound, as follows. MCF7 is a negative control which does not express ROR1, and CHO-human ROR2 is a negative control expressing human ROR2. JeKo-1, Mino, CHO-human ROR1, CHO-mouse ROR1 and MC38-human ROR1 are all cell lines which express human ROR1 or mouse ROR1.

[0635] Specifically, after dissociating each cell line and washing in PBS, the number of cells was counted and adjusted to 210 5 cells/200 custom-character PBS. Then the respective ROR1 monoclonal antibodies prepared in Embodiment 3 were diluted 5 times from 10 g/mL or 10 g/mL, then reacted for 1 hour at 4 C. After the reaction, the cells were washed in PBS, then FITC-marked constant region (Fc) specific antibody (Goat anti-human IgG FITC conjugate, Fc specific, Sigma, F9512, concentration 20 mg/ml) was suspended in 2 custom-character/110.sup.5 cells/200 custom-character PBS and reacted for 1 hour at 4 C. As for identification of the degree of expression of the transiently over-expressed human ROR1, human ROR2 and mouse ROR1, a commercially available FACS analysis antibody (anti-ROR1: R&D Systems, FAB 2000G, anti-ROR2: R&D, FAB20641P) was used. After reacting the cells were washed in PBS and analyzed using a FACSCalibur device. The negative control (2nd Ab) was only treated with FITC-marked constant region (Fc) specific antibody. The shifted readings for the respective experimental groups treated with ROR1 monoclonal antibody were compared against the shifted reading for the control group (MFI Ratio: MFI of anti-ROR1/MFI of 2nd Ab).

[0636] The results are represented in FIG. 5, FIG. 6 and FIG. 7. In the results, it was found that the anti-ROR1 antibody of the present invention binds specifically and in a concentration-dependent manner to human ROR1 (FIG. 6) which is originally expressed in cells, and the extracellular domain of human ROR1 (FIG. 5 and FIG. 7) artificially over-expressed in cells.

[0637] Further, it was confirmed that it does not bind to the family protein human ROR2, and that it has inter-species cross-reactivity with to mouse ROR1 (FIG. 5). When comparing cross-reactivity to cell surface-expressed mouse ROR1, it was confirmed that the ROR1 antibody of the present invention has a superior degree of binding than the 2A2 antibody used as a reference group (FIG. 5).

Embodiment 3-3: Measuring the Binding Ability of Anti-ROR1 IgG Antibody to Cell Surface-Expressed ROR1 Antigen in Various Cancers (FACS)

[0638] Subsequently, FACS analysis was performed to verify that the anti-ROR1 antibody of the present invention binds to cell surface-expressed ROR1 in various types of cancer cell lines. ROR1 is expressed in a variety of cancer cells, including not only blood cancers such as B-cell leukemia, lymphoma, acute myeloid leukemia (AML), Burkitt lymphoma, mantle cell lymphoma (MCL), acute lymphoblastic leukemia (ALL), chronic lymphocytic leukemia (CLL), Diffuse large B-cell lymphoma (DLBCL), follicular lymphoma (FL) and marginal zone lymphoma (MZL), etc. but also solid cancers including breast cancer, renal cancer, ovarian cancer, gastric cancer, liver cancer, lung cancer, colorectal cancer, pancreatic cancer, skin cancer, bladder cancer, testicular cancer, uterine cancer, prostate cancer, non-small cell lung cancer (NSCLC), neuroblastoma, brain cancer, colon cancer, squamous cell carcinoma, melanoma, myeloma, cervical cancer, thyroid cancer, head and neck cancer and adrenal cancer, etc.

[0639] For this experiment, the following various cancer cell lines were used: AGS (ATCC CRL-1739, human gastric adenocarcinoma), NCI-N.sub.87 (ATCC CRL-5822, human gastric carcinoma), MKN-28 (KCLB 80102, human gastric adenocarcinoma), SNU-1750 (KCLB 01750, human gastric adenocarcinoma), SNU-16 (ATCC CRL5974, human gastric carcinoma), HCC1187 (ATCC CRL-2322, human breast cancer TNM stage IIA grade 3), MDA-MB-231 ATCC HTB-26, human breast cancer), MDA-MB-468 (ATCC HTB-132, human breast cancer), HCC70 (ATCC CRL2315, human breast cancer TNM stage IIIA, grade 3), HCC1143 (ATCC CRL-2321, TNM stage IIA, grade3, primary ductal carcinoma), BT20 (ATCC HTB-19 human breast cancer), HCC1806 (ATCC CRL-2335, human breast cancer TNM stage IIB grade 2), HCC1937 (ATCC CRL2336, TNM stage IIB, grade3, primary ductal carcinoma), BT474 (ATCC HTB-20, ductal carcinoma), MCF7 (ATCC HTB-22, breast cancer metastatic site), H460 (ATCC HTB-177, large cell lung cancer), A549 (ATCC CCL-185, lung carcinoma), NCI-H1975 (ATCC CRL-5908, non-small cell lung cancer), H1437 (ATCC CRLS872, stage1, adenocarcinomanonsmallcelllungcancer), Calu-6 (ATCC HTB-56, anaplastic lung carcinoma), HCT116 (ATCC CCL-247, colorectal carcinoma), DLD-1 (ATCC CCL-221, Dukes' type C, colorectal adenocarcinoma), HT29 (ATCC HTB-38, colorectal adenocarcinoma), 697 (DSMZACC.sub.42, acute myeloblastic leukemia), Kasumi-2 (ATCC CRL-2724, acute myeloblastic leukemia), Mino (ATCC CRL3000, Mantle Cell Lymphoma), JeKo-1 (ATCC CRL3006, Mantle Cell Lymphoma), Jurkat (ATCC TIB-152, acute Tcell leukemia). FACS analysis (FACSCalibur, BD Biosciences) was used to analyze the binding of the anti-ROR1 antibody of the present invention to ROR1 in the above cell lines.

[0640] Specifically, the respective cell lines were dissociated and washed in PBS, then the numbers of cells were counted and adjusted to 210.sup.5 cells/200 custom-character PBS. Then, they were treated with 10 g/mL of the antibody of clone name C2E3 of the ROR1 monoclonal antibodies prepared in Embodiment 3, and reacted for 1 hour at 4 C. After the reaction, the cells were washed in PBS, then FITC-marked constant region (Fc) specific antibody (Goat anti-human IgG FITC conjugate, Fc specific, Sigma, F9512, concentration 20 mg/ml) was suspended in 2 custom-character10.sup.5 cells/200 custom-character PBS and reacted for 1 hour at 4 C. After reacting, the cells were washed with PBS and analyzed with the FACSCalibur equipment. The negative control was only treated with FITC-marked constant region (Fc) specific antibody. To compare the degree of ROR1 expression among the respective cancer cell lines, the quotient of dividing the shifted readings for the experimental group treated with the ROR1 monoclonal antibody (C2E3) of the present invention by the shifted readings for the control group (MFI Ratio: MFI of anti-ROR1/MFI or 2nd Ab) is indicated.

[0641] The results are shown in FIG. 8. The anti-ROR1 antibody of the present invention was confirmed to bind to ROR1 expressed in various cancer cell lines derived from gastric cancer, breast cancer, lung cancer, colon cancer, acute lymphocytic leukemia (ALL), and mantle cell lymphoma (MCL).

Embodiment 4: Measuring the Affinity of Anti-ROR1 IgG Antibody to ROR1

[0642] A 96-well black microplate (greiner bio one) was mounted on a biosensor tray case, and 200 custom-character 10 KB or DW was added to each of 8 wells. Then Anti Penta His biosensors or 8 AR2G biosensors (ForteBio, USA) were inserted to hydrate for 10 minutes. 600 custom-character of the assay samples were diluted 2-fold or 3-fold to the appropriate assay concentrations, using 1 KB or KB to 30 to 0.021 nM. To immobilize the antigen, recombinant human ROR1-His (Sino Biological, 13968-H08H) was diluted to 1 g/ML with 10 KB or Sodium Acetate pH5 buffer. Immobilization was fixed at a threshold of 0.3 nm in the loading step. The association assay was carried out for 3 to 10 minutes, and the dissociation assay was carried out for 20 minutes. According to the Octet program template, the buffer was placed in a new 96-well black microplate according to order. As Baseline1, 200 custom-character 10 KB or DW was placed. Then 200 custom-character each of 1 custom-character/mL of the antigen to be loaded, the ROR1-HIS protein, was added. As Baseline2, 200 custom-character 10 KB or 1 KB was placed. Then to each well 30 to 0.021 nM of the diluted antibody and 200 custom-character each of 10 KB buffer or 1 KB corresponding to a reference blank was added. The temperature of the test plate was fixed at 30 C. After all of the samples were introduced, the equipment was started, and after the assay was completed, results were uploaded to the Octet Analysis 90 software, with KD values analyzed through 1:1 fitting. The results are shown in Table 6 below. By obtaining KD values through the Octet assay method, it was confirmed that the anti-ROR1 antibody had strong binding potential to ROR1 antigen.

TABLE-US-00012 TABLE 6 Measuring affinity of antiROR1 IgG antibody to ROR1 NO Clone KD (M) kon(1/Msec) koff(1/sec) Chi R{circumflex over ()}2 1 AB4 6.39E11 1.81E+06 1.16E04 0.016 0.996 2 A2F2 7.73E11 1.53E+06 1.19E04 0.106 0.997 3 A2F3 2.40E11 1.38E+06 3.31E05 0.131 0.992 4 BA6 9.37E11 2.47E+06 2.31E04 0.138 0.993 5 C2E3 4.24E11 5.46E+06 2.31E03 0.176 0.966 6 CC9 7.54E10 7.31E+05 5.51E04 0.200 0.992 7 DG6 1.52E10 2.23E+06 3.38E04 0.506 0.964 8 D2B12 8.03E10 4.50E+05 3.61E04 0.341 0.952

Embodiment 5: Analyzing the Cancer Growth Suppression Efficacy of Anti-ROR1 IgG Antibody in Mouse Tumor Xenograft Model

[0643] Human cancer xenograft mice were prepared by transplanting 110.sup.7 cells/head of the ROR1-expressing human mantle cell lymphoma cell line JeKo-1 to severe combined immunodeficiency mice (SCID). After xenograft, when tumor size reached 170 mm.sup.3 on average (Day 1), the mice were divided into groups, and 5 types of anti-ROR-1 antibody were peritoneally injected into the mice using a 1 mL syringe twice a week at 10 mg/kg for a total of 5 administrations (Days 1, 4, 7, 10 and 14). The negative control group was peritoneally administered 10 mg/kg each of human IgG1 (InVivoPlus human IgG1 isotype control, BioXCell, BP0297) having a structure similar to that of ROR-1 antibody twice a week for a total of 5 administrations. The size of the tumors grafted to the mice and the weight of the mice were measured immediately before initial administration (Day 1), immediately before administration on each administration date thereafter, and at two days after final administration (Day 16).

[0644] The results are presented in FIG. 9a and FIG. 9b. The anti-ROR-1 antibodies according to the present invention suppressed growth of cancer, and the % tumor growth inhibition (% TGI) of the [antibody according to] the present invention compared to the human IgG1 antibody (HuIgG1) negative control was of Day 16 when the experiment ended was C2E3 360%, A2F2 289%, AB4 361%, BA6 317%, and CC9 294%. The anti-ROR1 antibodies according to the present invention were found to have a statistically significant difference compared to the HuIgG-administered group (one-way ANOVA, P value <0.05) (FIG. 9a) Results of body weight measurement (FIG. 9b) did not reveal a significant difference between the administration groups. As stated in Embodiments 3-1 and 3-2, the anti-ROR1 antibodies of the present invention have cross-reactivity to mouse ROR1 antigen. Accordingly, the anti-ROR1 antibodies of the present invention administered can bind to human ROR1 expressed by the xenografted human mantle cell lymphoma cell line JeKo-1, as well as to the mouse ROR1 expressed by the mouse itself. Measuring body weight indicated similar increasing trends in body weight between the negative control group (HuIgG1) and the anti-ROR1 antibodies of the present invention, and this can be said to indicate that administration of the anti-ROR1 antibodies of the present invention does not induce toxicity. These results indicate that the antibodies according to the present invention may be useful as cancer therapeutic agents.

[0645] In the mouse tumor xenograft model, all 5 ROR1 antibodies of the present invention were found to suppress growth of cancer. Of these, some antibodies (C2E3 and AB4), as shown in Embodiment 6 and FIG. 10 below, were found to be able to induce auto-active cell death of ROR1-overexpressing cancer cell lines when multimerized by anti-human Fc antibody. However, various cancer inhibition mechanisms are possible, such as inducing auto-active cell death, inhibiting division and growth of cancer cells, suppressing tumor angiogenesis, and activation of immune cells. As such, the results of FIG. 10 below indicate that each of the anti-ROR1 antibodies according to the present invention are able to suppress cancer growth in vivo through different action mechanisms.

Embodiment 6: Analysis of Anti-ROR1 IgG Antibodies' Ability to Induce Auto-Active Cell Death

[0646] To analyze the possible mechanisms of the antibodies according to the present invention exhibiting tumor suppression capacity as shown in Embodiment 5, their ability to induce cell death was analyzed.

[0647] To this end, the ROR1 over-expressing cell line JeKo-1 was centrifuged to remove the serum-containing medium. After washing once with PBS, 510{circumflex over ()}6 cells were seeded in each well of a 6-well plate using serum-free RPMI1640 medium. 100 g/mL of the anti-ROR1 antibody according to the present invention and 300 g/ml of anti-human Fc antibody (Thermo Fisher, 31125) were placed at a 1:1 ratio in an equivalent tube, an reacted for 10 minutes at room temperature so that the anti-ROR1 antibody was cross-linked by the anti-human Fc antibody. 150 custom-character each of the mixtures was placed in the wells containing 15 ml medium so that the final amount of antibody treated was 10 custom-character/mL for ROR1 antibody, and 30 custom-character/mL for anti-human Fc antibody, then reacted by culturing for 24 hours at 5% CO.sub.2 and 37 C.

[0648] Next, to confirm whether or not whether or not the ROR1 antibody alone and the cross-linked anti-ROR1 antibody had the capacity to induce auto-active cell death, the cells of each well were collected and washed once with PBS. Thereafter, each group was reacted with the auto-active cell death marker Annexin V and the cell death marker PI, and the degree to which the groups were dyed was observed through FACS analysis.

[0649] The results are shown in FIG. 10. In the results of the experiment, no auto-active cell death was observed for the group treated with anti-ROR1 antibody alone, but in the case of some anti-ROR1 antibody clones (C2E3 and AB4) cross-linked by anti-human Fc, the degree of dyeing by Annexin V and PI was increased over the control group. In particular, in terms of dyeing by the auto-active cell death marker Annexin V, there was a 23% increase for the C2E3 clone and a 10% increase for the AB4 clone over the control. To see if such capacity to induce auto-active cell death is a reaction specific to ROR1, the same method was carried out on the ROR1 non-expressing cell line U266 using the C2E3 clone to examine the degree of dyeing by Annexin V and PI. It was confirmed that the ROR1 non-expressing cell line U266 was not able to induce auto-active cell death, proving that the capacity of the one cross-linked anti-ROR1 antibody to induce auto-active cell death was an ROR1-specific reaction. Antibodies are able to form multimers in vivo by binding with Fc gamma receptors through their Fc regions, and therefore the formation of anti-ROR1 antibody multimer using anti-human Fc antibody can be said to represent conditions similar to in vivo phenomena. The above analysis results relate to a single mechanism, signifying that the anti-ROR1 antibody according to the present invention may induce auto-active cell death in ROR1 over-expressing cancer cell lines.

[0650] It should be noted that induction of auto-active cell death of cancer cell lines through multimerization of ROR1 antibody is not a phenomenon observed in all types of ROR.sup.1 antibody. For example, in the case of the BA6 clone among the ROR1 antibodies of the present invention and the 2A2 antibody used as a reference group, these did not induce auto-active cell death of ROR1 over-expressing cancer cell lines even when multimerized by anti-human Fc antibody. This signifies that the ROR1 antibodies according to the present invention have cancer cell suppression capacity through different action mechanisms. This difference may be due to differences in epitopes to which the respective ROR1 antibodies bind, but this theory is not the sole explanation thereof.

Embodiment 7: Preparation of Compounds 1, 2, 3 and 4

[0651] ##STR00054##

[0652] Compounds 1, 2 3 and 4 above were prepared using the method stated in Patent WO 2017-089895.

[0653] In Compounds 1, 2, 3 and 4 above, the structures of MMAE or MMAF are as follow:

##STR00055##

Embodiment 8: Preparation of Compounds 5, 6 and 7

[0654] ##STR00056## ##STR00057##

[0655] Compounds 5, 6 and 7 above were prepared using the method stated in Korean Patent Application No. 10-2018-0036895.

Embodiment 9: Preparation of ADC

[0656] ADC was prepared through the following two steps, and the LCB14-0511 and LCB14-0606 used commonly were prepared using the method stated in Korean Laid-open Patent No.

[0657] The structural formulae of LCB14-0511 and LCB14-0606 are as follow:

##STR00058##

Step 1: Preparation of Prenylated Antibody

[0658] A prenylation reaction mixture of an ROR1 monoclonal antibody (C2E3) of the present invention was prepared and reacted for 16 hours at 30 C. The reaction mixture was comprised of 24 M antibody, 200 nM FTase (Calbiochem #344145) and buffer solution (50 mM Tris-HCl (pH 7.4), 5 mM MgCl2, 10 M ZnCl2, 0.144 mM DTT) containing 0.144 mM LCB14-0511 or LCB14-0606. After the reaction was completed, the prenylated antibody was desalted using a G25 Sepharose column (AKTA purifier, GE healthcare) equilibrated with PBS buffer solution.

[0659] As the reference group antibody, a chimera antibody (2A2) where human IgG1 is bonded to the variable region of an existing anti-ROR1 antibody 2A2 (U.S. Pat. No. 9,316,646) was used.

Step 2: Method of Drug-Conjugation

[0660] <Conjugation by Oxime Bond Formation>

[0661] The mixture for oxime bond-forming reaction between prenylated antibody and linker-drug was prepared by mixing 100 mM Na-acetate buffer solution pH 5.2, 10% DMSO, 20 M antibody and 200 M linker-drug (in, house, compounds 1, 2, 3, 4, 5 and 7 from Embodiments 7 and 8), and stirred lightly at 30 C. After reacting for 6 or 24 hours, an FPLC (AKTA purifier, GE healthcare) process was carried out to remove the surplus small compounds used. The protein fraction was collected and concentrated.

[0662] <Conjugation by Click Reaction>

[0663] The mixture for oxime bond-forming reaction between prenylated antibody and linker-drug was prepared by mixing 10% DMSO, 20 M antibody and 200 M linker-drug (in, house, compound 6 from Embodiment 8), 1 mM copper (II) sulfate pentahydrate, 2 mM (BimC4A).sub.3 (Sigma-Aldrich 696854), 10 mM sodium ascorbate and 10 mM aminoguanidine hydrochloride, reacted for 3 hours at 25 C., then treated with 20 mM EDTA and reacted for 30 minutes. After reacting, an FPLC (AKTA purifier, GE healthcare) process was carried out to remove the surplus small compounds used. The protein fraction was collected and concentrated.

TABLE-US-00013 TABLE 7 List of ADCs prepared ADCs Antibody Prenylation group Toxin ADC1 C2E3 LCB14-0000 Compound 1 ADC2 Compound 2 ADC3 Compound 3 ADC4 Compound 4 ADC5 Compound 5 ADC6 Compound 6 ADC7 LCB14-0511 Compound 7 ADC8 2A2 LCB14-0606 Compound 1 ADC9 Compound 2 ADC10 Compound 3

Embodiment 10: Assessing ADC Properties

[0664] Using the ADCs prepared in Embodiment 9, the properties of the ADCs according to the present invention were analyzed.

[0665] For this purpose, hydrophobic interaction chromatography-high-performance liquid chromatography (HIC-HPLC) analysis was carried out. The ADCs were subjected to hydrophobic interaction chromatography-high-performance liquid chromatography using a phenyl-5PW column (7.575 mm, 10 m, Tosoh Bioscience, USA). 50 mM potassium phosphate buffer solution (pH 7.0) containing 1.5M ammonium sulfate was used as buffer solution A, and 50 mM potassium phosphate buffer solution (pH 7.0) containing 30% acetonitrile was used as buffer solution B, and 70% A and 30% B were stabilized as an initial condition. Using a 70% A/30% B v. 10% A/90% B linear gradient, elution was performed for the next 25 minutes, with 5 minutes additional elution at 10% A/90% B. Flow rate and temperature were set to 1.0 mcustom-character/min and 25 C., respectively. This was followed by detection at both 254 and 280 mm. ROR1 antibody was used, and prenylated ROR1 antibody was used as a reference group.

[0666] In addition, size exclusion chromatography-high-performance liquid chromatography (SEC-HPLC) analysis was carried out. Size exclusion chromatography-high-performance liquid chromatography was carried out on the ADCs using an SWXL guard column (6.040 mm, Tosoh Bioscience, USA) and a G.sub.3000SWx1 column (7.8300 mm, 5 m, Tosoh Bioscience, USA). Using 200 mM potassium phosphate buffer solution (pH 7.0) containing 250 mM phosphate chloride and 15% isopropyl alcohol as the mobile phase, analysis was carried out for 30 minutes under conditions of 0.5 mcustom-character/min flow rate and 25 C. This was followed by detection at both 254 and 280 mm. ROR1 antibody was used, and prenylated ROR1 antibody was used as a reference group.

[0667] The results of analyzing properties of ADC2 and ADC5 among the ADCs prepared in Embodiment 9 are represented in FIG. 11a and FIG. 11b.

Embodiment 11: In Vitro Cytotoxicity Assessment

[0668] The cancer cell line cell proliferation inhibition activity of the ADCs prepared in Embodiment 9 was measured.

[0669] For this purpose, commercially available cancer cell lines were used (Mino, Jeko-1, REC-1, H2228, NCIN87, HCC1806, MDA-MB-231, MCF-7 and Daudi cell lines). In a 96-well plate, each well was seeded with 4,000 to 5,000 of the respective cancer cell lines. After culturing for 24 hours, they were treated with the ADCs in Table 8 at a concentration of 0.0015 to 10.0 nM (serially diluted threefold). 72 hours later, the number of live cells was measured using WST-8 (Dojindo Molecular Technology Inc.) dye.

[0670] The results are stated in Table 8 below. In cancer cell lines over-expressing ROR1, the anti-ROR1 monoclonal antibodies of the present invention were confirmed to have far superior cytotoxicity than the ADCs (ADC 8, 9 and 10) conjugated with conventional anti-ROR1 antibody. Further, it was confirmed that pyrrolobenzodiazepine based ADCs exhibited strong cytotoxicity compared to auristatin-based ADCs.

TABLE-US-00014 TABLE 8 Cytoxicity comparison of ADC specimens Jeko-1 MDA-MB-231 H2228 HCC1806 MCF-7 Ag level 13 11.2 9.4 2.7 1 (MIF fold) Test sample IC.sub.50 [pM] ADC1 2,067 n.d. n.d. n.d. ADC8 n.d. n.d n.d. ADC2 2,909 10,276 11,587 15,526 12,567 ADC9 7,259 17,806 19,500 23,583 32,049 ADC5 247 243 n.d. 5,092 ADC10 481 ~1,000 n.d. 23,430 *n.d: Cytotoxicity observed as concentration increases, but cells did not completely die at maximum concentration, and IC50 value could not be found. *: Exhibited weak or no cytotoxicity at maximum concentration. *N/A: no data

Embodiment 12: Analysis of In Vivo Cancer Growth Suppression Efficacy

Embodiment 12-1: Analysis of Cancer Growth Suppression Efficacy by ADC in Mouse Model Grafted with ROR1-Expressing Breast Cancer Cell Line

[0671] 110.sup.7 cells/head of human ROR-1 expressing breast cancer cell line MDA-MB-468 were grafted to female Balb/C nude mice to prepare human cancer grafted mice. After grafting, the mice were grouped when tumor size reached 166 mm.sup.3 on average (Day 1), and 1 mg/kg of ADC5 prepared in Embodiment 9 was intravenously injected into the mice. In the control group, 10 ml/kg PBS was intravenously injected into the mice.

[0672] The size of the tumors grafted into the mice and the body weight of the mice were measured immediately before first administration (Day 1), and at regular intervals for 56 days thereafter.

[0673] Also, 110.sup.7 cells/head of human ROR-1 expressing breast cancer cell line MDA-MB-231 were grafted to severe combined immunodeficient (SCID) mice to prepare human cancer grafted mice. After grafting, the mice were grouped when tumor size reached 110 mm.sup.3 on average (Day 1), and 0.5, 1.0 or 2.0 mg/kg of ADC5 prepared in Embodiment 9 was intravenously injected into the mice once, or 0.33 mg/kg ADC5 was intravenously injected twice weekly a total of three times (Days 1, 7 and 14). In the control group, 10 ml/kg PBS was intravenously injected into the mice. The size of the tumors grafted into the mice and the body weight of the mice were measured immediately before first administration (Day 1), and at regular intervals for 22 days thereafter.

[0674] Also, 110.sup.7 cells/head of human ROR-1 expressing breast cancer cell line HCC1187 were grafted to severe combined immunodeficient (SCID) mice to prepare human cancer grafted mice. After grafting, the mice were grouped when tumor size reached 110 mm.sup.3 on average (Day 1), and 1.25 or 0.31 mg/kg of ADC5 prepared in Embodiment 9 was intravenously injected into the mice once, or 3.75 mg/kg ADC2 was intravenously injected once. In the control group, 10 ml/kg PBS was intravenously injected into the mice. The size of the tumors grafted into the mice and the body weight of the mice were measured immediately before first administration (Day 1), and at regular intervals for 41 days thereafter.

[0675] The results are stated in FIG. 12, FIG. 13 and FIG. 14. It was confirmed that the ADCs of the present invention suppress growth of cancer in ROR1-expressing breast cancer cell line-grafted mouse models.

Embodiment 12-2: Analysis of Cancer Growth Suppression Efficacy by ADC in Mouse Model Grafted with ROR1-Expressing Breast Cancer Cell Line

[0676] 110.sup.7 cells/head of human ROR-1 expressing lung cancer cell line Calu-3 were grafted to female Balb/C nude mice to prepare human cancer grafted mice. After grafting, the mice were grouped when tumor size reached 184 mm.sup.3 on average (Day 1), and 3 mg/kg of ADC2 prepared in Embodiment 9 was intravenously injected into the mice once, or 0.25 or 1.0 mg/kg ADC5 prepared in Embodiment 9 was intravenously injected once. In the control group, 10 ml/kg PBS was intravenously injected into the mice. The size of the tumors grafted into the mice and the body weight of the mice were measured immediately before first administration (Day 1), and at regular intervals for 35 days thereafter.

[0677] The results are stated in FIG. 15. It was confirmed that the ADCs of the present invention suppress growth of cancer in ROR1-expressing lung cancer cell line-grafted mouse models.

Embodiment 12-3: Analysis of Cancer Growth Suppression Efficacy by ADC in Mouse Model Grafted with ROR1-Expressing Mantle Cell Lymphoma Cell Line

[0678] 110.sup.7 cells/head of human ROR-1 expressing human mantle cell lymphoma cell line Jeko-1 were grafted to severe combined immunodeficient (SCID) mice to prepare human cancer grafted mice. After grafting, the mice were grouped when tumor size reached 110 mm.sup.3 on average (Day 1), and 3 mg/kg of ADC2 prepared in Embodiment 9 was intravenously injected into the mice once, or 0.25 or 1.0 mg/kg ADC5 prepared in Embodiment 9 was intravenously injected once. In the control group, 10 ml/kg PBS was intravenously injected into the mice. The size of the tumors grafted into the mice and the body weight of the mice were measured immediately before first administration (Day 1), and at regular intervals for 33 days thereafter.

[0679] The results are stated in FIG. 16. It was confirmed that the ADCs of the present invention suppress growth of cancer in ROR1-expressing mantle cell lymphoma cell line-grafted mouse models.

Embodiment 12-4: Comparison of Cancer Growth Suppression Efficacy Among ADCs in Mouse Model Grafted with ROR1-Expressing Mantle Cell Lymphoma Cell Line

[0680] Cancer growth suppression efficacy depending on the antibodies and drugs comprising the ADCs was compared.

[0681] For this purpose, 110 7 cells/head of human ROR-1 expressing human mantle cell lymphoma cell line Calu-3 were grafted to severe combined immunodeficient (SCID) mice to prepare human cancer grafted mice. After grafting, the mice were grouped when tumor size reached 110 mm.sup.3 on average (Day 1), and 1 mg/kg or 4 mg/kg of ADC2 (C2 MMAE)) or ADC9 (2A2 MMAE) prepared in Embodiment 9 was intravenously injected into the mice once, or or 1.0 mg/kg of ADC5 (dPBD-ADC) or ADC10 (2A2 dPBD) prepared in Embodiment 9 was intravenously injected once. In the control group, 10 ml/kg PBS was intravenously injected into the mice. The size of the tumors grafted into the mice and the body weight of the mice were measured immediately before first administration (Day 1), and at regular intervals for 37 days thereafter.

[0682] The results are stated in FIG. 17. The ADCs conjugated with the anti-ROR1 monoclonal antibodies of the present invention were confirmed to have superior cancer growth suppression efficacy than the ADCs (ADC9 and 10) conjugated with conventional anti-ROR1 antibody. Further, it was confirmed that pyrrolobenzodiazepine based ADCs exhibited stronger cancer growth suppression than auristatin-based ADCs.