ANTI-SEVERE ACUTE RESPIRATORY SYNDROME CORONAVIRUS ANTIBODIES
20230408517 · 2023-12-21
Inventors
- Christine Andrea Goetz (Blaine, MN, US)
- Jody Bonnevier (Chanhassen, MN, US)
- Christopher David Hammerbeck (Shoreview, MN, US)
- Ernesto Rubin Resnik (Minneapolis, MN, US)
- Cyrus B. Munshi (Blaine, MN, US)
- Enqing Tan (Lexington, MA, US)
Cpc classification
C07K2317/76
CHEMISTRY; METALLURGY
G01N2469/10
PHYSICS
C07K16/1003
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
C07K2317/33
CHEMISTRY; METALLURGY
International classification
G01N33/543
PHYSICS
Abstract
Anti-SARS-CoV-specific monoclonal antibodies, methods of making and characterizing those antibodies, and methods of using those antibodies are described herein. In some embodiments, the antibodies may bind to both SARS-CoV-1 and SARS-CoV-2. In some embodiments, the antibodies bind to S.sub.1 of the spike protein of SARS-CoV-2 including, for example, to the receptor binding domain (RBD) of S.sub.1. In some embodiments, the antibodies may block the binding of SARS-CoV-1 and/or SARS-CoV-2 to ACE-2. Such antibodies are useful as diagnostic and therapeutic agents.
Claims
1. An anti-SARS-CoV antibody, wherein the anti-SARS-CoV antibody comprises an antibody or antigen binding fragment thereof that binds to the same epitope as an antibody produced a clone selected from 1035211.11, 1035224.11, 1035240.11, 1035414.11, 1035419.11, 1035423.11, 1035433.11, 1035709.11, 1035716.11, 1035740.11, 1035744.11, 1035752.11, 1035753.11, 1035755.11, and 1035762.11.
2. An anti-SARS-CoV antibody of claim 1, wherein the anti-SARS-CoV antibody comprises: a heavy chain variable region (V.sub.H) of an antibody selected from 1035211, 1035224, 1035240, 1035414, 1035419, 1035423, 1035433, 1035709, 1035716, 1035740, 1035744, 1035752, 1035753, 1035755, and 1035762; or a light chain variable region (V.sub.L) of an antibody selected from 1035211, 1035224, 1035240, 1035414, 1035419, 1035423, 1035433, 1035709, 1035716, 1035740, 1035744, 1035752, 1035753, 1035755, and 1035762; or both.
3. (canceled)
4. An anti-SARS-CoV antibody of claim 1, wherein the anti-SARS-CoV antibody comprises: each of the complementary determining regions (CDRs) of a heavy chain variable region of a monoclonal antibody produced by one of the clones of Table 1; or each of the CDRs of a light chain variable region of a monoclonal antibody produced by one of the clones of Table 1; each of the CDRs of a heavy chain variable region of a monoclonal antibody produced by one of the clones of Table 1 and each of the CDRs of a light chain variable region of a monoclonal antibody produced by one of the clones of Table 1; or each of the CDRs of a heavy chain variable region of a monoclonal antibody produced by one of the clones of Table 1, and each of the CDRs of a light chain variable region of a monoclonal antibody produced by the same clone.
5. The anti-SARS-CoV antibody of claim 4, wherein the CDRs of the heavy chain variable region have an amino acid sequence set forth in Table 9; or wherein the CDRs of the light chain variable region have an amino acid sequence set forth in Table 8; or both.
6. An anti-SARS-CoV antibody of claim 1, wherein the anti-SARS-CoV antibody comprises an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the heavy chain variable region of a monoclonal antibody produced by a clone of Table 1; or at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the light chain variable region of a monoclonal antibody produced by a clone of Table 1; or at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the heavy chain variable region of a monoclonal antibody produced by a clone of Table 1, and at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the light chain variable region of a monoclonal antibody produced by a clone of Table 1.
7. The anti-SARS-CoV antibody of claim 1, wherein the anti-SARS-CoV antibody comprises an antibody produced by a clone selected from 1035211.11, 1035224.11, 1035240.11, 1035414.11, 1035419.11, 1035423.11, 1035433.11, 1035709.11, 1035716.11, 1035740.11, 1035744.11, 1035752.11, 1035753.11, 1035755.11, and 1035762.11.
8. The anti-SARS-CoV antibody of claim 1, wherein the anti-SARS-CoV antibody specifically binds to the receptor binding domain (RBD) of the SARS-CoV spike (S) protein.
9. The anti-SARS-CoV antibody of claim 1, wherein the anti-SARS-CoV antibody decreases binding of SARS-CoV-1 or SARS-CoV-2 or both SARS-CoV-1 and SARS-CoV-2 to ACE-2 by at least 10 percent (%), at least 15%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98%.
10. The anti-SARS-CoV antibody of claim 1, wherein the anti-SARS-CoV antibody comprises an anti-SARS-CoV-2 antibody.
11. The anti-SARS-CoV antibody of claim 1, wherein the anti-SARS-CoV antibody comprises an anti-SARS-CoV-1 antibody.
12. The anti-SARS-CoV antibody of claim 1, wherein the anti-SARS-CoV antibody specifically binds to a SARS-CoV-2 variant selected from: the alpha variant (the United Kingdom variant (UK), B.1.1.7 lineage, RBD with N501Y); the beta variant (South African variant (SA), B.1.3512 lineage, RBD with K417N, E484K, and N501Y); the gamma variant (Brazilian variant P.1 (BR P.1), B.1.1.28.1 lineage, RBD with K417T, E484K, and N501Y); the delta variant (Indian variant 2 (IN v2), B.1.617.2 lineage, RBD with L452R and T478K); the epsilon variant (California variant (CA), B.1.427/9 lineage, RBD with L452R); the kappa variant (Indian variant 1 (IN v1), B.1.617.1 lineage, RBD with L452R and E484Q); the zeta variant (Brazilian variant P.2 (BR P.2), B.1.1.28.2 lineage, RBD with E484K); the K417E RBD (R319-F541 with K417E); the T478K RBD (R319-F541 with T478K); the iota variant (New York variant (NY), B.1.526 lineage, RBD with a single mutation E484K); the eta variant (Nigeria variant, B.1.525 lineage); the lambda variant (Peru variant, C.37 lineage, RBD with L452Q and F490S); the theta variant (Philippine variant, P.3 lineage, RBD with E484K and N501Y); and/or the Denmark mink variant (B.1.1.298 lineage, DM, RBD with Y453).
13. (canceled)
14. The anti-SARS-CoV antibody of claim 1, wherein the anti-SARS-CoV antibody has an NC.sub.50 of about 0.3 g/L to about 1.5 g/l.
15. The anti-SARS-CoV antibody of claim 1, wherein the anti-SARS-CoV antibody binds to a bin A RBD epitope, a bin B RBD epitope, or a bin C RBD epitope.
16. The anti-SARS-CoV antibody of claim 1, wherein the anti-SARS-CoV antibody comprises a humanized antibody.
17. The anti-SARS-CoV antibody of claim 1, wherein the anti-SARS-CoV antibody is labeled with one or more detectable markers.
18. A composition comprising the anti-SARS-CoV antibody of claim 1.
19. The composition of claim 18 further comprising one or more additional anti-SARS-CoV antibodies.
20. A composition comprising two or more anti-SARS-CoV antibodies of claim 1.
21. The composition of claim 19, wherein one anti-SARS-CoV antibody binds to a bin A epitope of RBD and one anti-SARS-CoV antibody binds to a bin B epitope of RBD.
22. The composition of claim 21, wherein the anti-SARS-CoV antibody that binds to a bin A epitope of RBD is selected from: an antibody that binds to the same epitope as an antibody produced by clone 1035709.11; an antibody produced by clone 1035709.11; an antibody comprising a heavy chain variable region (V.sub.H) of the antibody 1035709; an antibody comprising a light chain variable region (V.sub.L) of the antibody 1035709; an antibody comprising a heavy chain V.sub.H and a light chain V.sub.L of the antibody 1035709; an antibody comprising a heavy chain V.sub.H comprising one or more of the heavy chain complementary determining regions (CDRs) of antibody 1035709; an antibody comprising a light chain V.sub.L comprising one or more of the light chain CDRs of the antibody 1035709; an antibody comprising a heavy chain V.sub.H comprising one or more of the heavy chain CDRs and a light chain V.sub.L comprising one or more of the light chain CDRs of the antibody 1035709; an antibody comprising the three heavy chain CDRs of the antibody 1035709; an antibody comprising the three light chain CDRs the antibody 1035709; an antibody comprising the three heavy chain CDRs and the three light chain CDRs of the antibody 1035709; an antibody comprising a heavy chain V.sub.H with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to a heavy chain V.sub.H of the antibody 1035709; an antibody comprising a light chain V.sub.L with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the light chain variable region of the antibody 1035709; and an antibody comprising a heavy chain V.sub.H with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to a heavy chain V.sub.H of the antibody 1035709 and a light chain V.sub.L with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the light chain variable region of the antibody 1035709; and wherein the anti-SARS-CoV antibody binds to the bin B epitope of RBD is selected from an antibody that binds to the same epitope as an antibody produced by clone 1035740.11; an antibody produced by clone 135740.11; an antibody comprising a heavy chain variable region (V.sub.H) of the antibody 135740; an antibody comprising a light chain variable region (V.sub.L) of the antibody 135740; an antibody comprising a heavy chain V.sub.H and a light chain V.sub.L of the antibody 135740; an antibody comprising a heavy chain V.sub.H comprising one or more of the heavy chain complementary determining regions (CDRs) of antibody 135740; an antibody comprising a light chain V.sub.L comprising one or more of the light chain CDRs of the antibody 135740; an antibody comprising a heavy chain V.sub.H comprising one or more of the heavy chain CDRs and a light chain V.sub.L comprising one or more of the light chain CDRs of the antibody 135740; an antibody comprising the three heavy chain CDRs of the antibody 135740; an antibody comprising the three light chain CDRs the antibody 135740; an antibody comprising the three heavy chain CDRs and the three light chain CDRs of the antibody 135740; an antibody comprising a heavy chain V.sub.H with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to a heavy chain V.sub.H of the antibody 135740; an antibody comprising a light chain V.sub.L with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the light chain variable region of the antibody 135740; an antibody comprising a heavy chain V.sub.H with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to a heavy chain V.sub.H of the antibody 1035709 and a light chain V.sub.L with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the light chain variable region of the antibody 135740.
23-24. (canceled)
25. A method comprising administering the anti-SARS-CoV antibody of claim 1 to a subject.
26-27. (canceled)
28. The method of claim 25, wherein the subject is suspected of having, has been diagnosed with, or has been exposed to a SARS-CoV-2 variant selected from: the alpha variant (the United Kingdom variant (UK), B.1.1.7 lineage, RBD with N501Y); the beta variant (South African variant (SA), B.1.3512 lineage, RBD with K417N, E484K, and N501Y); the gamma variant (Brazilian variant P.1 (BR P.1), B.1.1.28.1 lineage, RBD with K417T, E484K, and N501Y); the delta variant (Indian variant 2 (IN v2), B.1.617.2 lineage, RBD with L452R and T478K); the epsilon variant (California variant (CA), B.1.427/9 lineage, RBD with L452R); the kappa variant (Indian variant 1 (IN v1), B.1.617.1 lineage, RBD with L452R and E484Q); the zeta variant (Brazilian variant P.2 (BR P.2), B.1.1.28.2 lineage, RBD with E484K); the K417E RBD (R319-F541 with K417E); the T478K RBD (R319-F541 with T478K); the iota variant (New York variant (NY), B.1.526 lineage, RBD with a single mutation E484K); the eta variant (Nigeria variant, B.1.525 lineage); the lambda variant (Peru variant, C.37 lineage, RBD with L452Q and F490S); the theta variant (Philippine variant, P.3 lineage, RBD with E484K and N501Y); and/or the Denmark mink variant (B.1.1.298 lineage, DM, RBD with Y453).
29-33. (canceled)
34. An immunoassay device comprising one or more of the anti-SARS-CoV antibodies of claim 1.
35. A lateral flow immunoassay device comprising one or more of the anti-SARS-CoV antibodies of claim 1.
36-38. (canceled)
39. A method of identifying a SARS-CoV-2 receptor binding domain (RBD) variant in a sample, the method comprising contacting the biosample with an antibody of claim 1.
40-41. (canceled)
Description
BRIEF DESCRIPTION OF THE FIGURES
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072] In
[0073] In
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
[0081]
[0082]
[0083]
[0084]
[0085]
[0086]
[0087]
[0088]
[0089]
[0090]
[0091]
[0092]
[0093]
[0094]
DETAILED DESCRIPTION OF ILLUSTRATIVE EMBODIMENTS
[0095] This disclosure describes anti-SARS-CoV-specific monoclonal antibodies, methods of making and characterizing those antibodies, and methods of using those antibodies in both diagnostic and therapeutic applications. In some embodiments, the antibodies may bind to both SARS-CoV-1 and SARS-CoV-2. In some embodiments, the antibodies bind to S.sub.1 of the spike protein of SARS-CoV-2 including, for example, to the receptor binding domain (RBD) of S.sub.1. In some embodiments, the antibodies may block the binding of SARS-CoV-1 and/or SARS-CoV-2 to ACE-2.
SARS-CoV-1 and SARS-CoV-2
[0096] Severe acute respiratory syndrome-coronavirus 2 (SARS-CoV-2) virus is a positive stranded RNA virus that is a member of the coronaviridae family, and is the causative agent of the COVID-19 pandemic (Lu et al. Lancet 395, 565-574 (2020); Wu et al. Nature 579, 265-269 (2020); Zhou et al. Nature 579, 270-273 (2020); Zhu et al. N Engl J Med 382, 727-733 (2020)). Coronaviruses include four structural proteins: a spike protein (S), a membrane protein (M), an envelope protein (E), and a nucleocapsid protein (N). The spike protein is composed of two subunits: S.sub.1 which is responsible for binding to the host cell receptor via a highly conserved receptor binding domain (RBD) (Lan et al. Nature 581, 215-220 (2020)), and S.sub.2 which facilitates fusion of the virus to a target cell membrane.
[0097] Like the related severe acute respiratory syndrome (SARS) virus, SARS-CoV-1, the causative agent of the 2002 SARS pandemic, SARS-CoV-2 primarily infects cells of a host's respiratory system by binding to the angiotensin converting enzyme 2 (ACE-2) (Chen et al. Biochem Biophys Res Commun, (2020); Letko et al. Nat Microbiol 5, 562-569 (2020); Li et al. Nature 426, 450-454 (2003); Walls et al. Cell 181, 281-292 e286 (2020)) which is highly expressed in lung epithelial cell vascular endothelia. Other organ systems are also involved, however, due to the high level expression of ACE-2 on cells in cardiovascular tissue, kidney, and bladder tissue, and on the epithelia of the small intestine and testes (Zou et al. Front Med 14, 185-192 (2020)). The resulting inflammation and tissue damage caused either by direct viral infection by lung epithelial cells, or indirectly by host immune responses to infection and subsequent cytokine storm, can, in cases of severe, result in severe respiratory failure with multiple organ failure and death (Yuki et al. Clin Immunol 215, 108427 (2020)).
[0098] Phylogenetically, SARS-CoV-2 and SARS-CoV-1 belong to the Betacoronavirus genus which can be found in human and many animal species (Lu et al. Lancet 395, 565-574 (2020); Wu et al. Nature 579, 265-269 (2020); Zhou et al. Nature 579, 270-273 (2020); Zhu et al. N Engl J Med 382, 727-733 (2020)). Although both viruses have been responsible for independent severe acute respiratory syndromes in humans, SARS-CoV-2 is more closely related to bat coronavirus RaTG13, sharing more than 93% homology in the spike gene, than SARS-CoV-1 (Zhou et al. Nature 579, 270-273 (2020)). Sequence analysis of the S gene of SARS-CoV-2 and SARS-CoV-1 reveals that spike proteins of the two viruses are highly divergent, sharing about 76% homology while the receptor binding protein shares less than 75% homology (Zhou et al. Nature 579, 270-273 (2020); Ou et al. Nat Commun 11, 1620 (2020)); still, the portion of the receptor binding domains for both viruses that is critical for binding to ACE-2 is nearly identical (Lan et al. Nature 581, 215-220 (2020)) suggesting that antibodies that block the correct portion of the receptor binding domain of SARS-CoV-2 may also block the receptor binding domain of SARS-CoV-1.
[0099] A third member of the Betacoronavirus genus, Middle East respiratory syndrome coronavirus (MERS-CoV), was identified as the causative agent of a human severe respiratory syndrome in 2012 in Saudi Arabia (Zaki et al. N Engl J Med 367, 1814-1820 (2012)), known as Middle East respiratory syndrome (HERS). Whereas SARS-CoV-1 and SARS-CoV-2 use human ACE-2 as their main receptor, MERS-CoV uses transmembrane dipeptidylpeptidase 4 (DPP4), also known as CD26, as its primary receptor. The homology between the receptor binding domains (RBDs) of SARS-CoV-2 spike protein and MERS-CoV spike protein is low, only 19.1%; however, both SARS-CoV-2 and MERS-CoV can bind DPP4 by virtue of identical amino acids at their respective DPP4 binding residues (Li et al. iScience 23, 101160 (2020)).
[0100] The SARS-CoV-2 virus infects mammalian cells by attaching transmembrane spike proteins (S protein) to angiotensin-converting enzyme 2 receptors (ACE-2) found on the surface of human target cells (Ou et al. Nature Communications 11, 1620 (2020); Shang et al. Proceedings of the National Academy of Sciences 117, 11727-11734 (2020)). Hence, inhibiting the binding of SARS-CoV-2 spike protein to ACE-2 has been the primary strategy behind most SARS-CoV-2 vaccines (Jackson et al. N Engl J Med 383, 1920-1931 (2020); Mulligan et al. Nature 590, E26-E26 (2021)), therapeutic antibodies (Food and Drug Administration. Letter to Regeneron Pharmaceuticals, Inc. (21 Nov. 2020)) (Food and Drug Administration. Letter to Eli Lilly and Company. (10 Nov. 2020)), and therapeutic soluble ACE-2 molecules (Zoufaly et al. Lancet Respir Med 8, 1154-1158 (2020)).
[0101] The receptor binding domain (RBD) of the viral spike protein plays a critical role in the binding of SARS-CoV-2 to ACE-2. The SARS-CoV-2 RBD is a 220-amino acid fragment (Arg319-Phe541) in the 51 subunit of SARS-CoV-2 spike protein. The spike protein has two conformational statesthe pre-fusion state (closed conformation) and the post-fusion state (open conformation) (Cai et al. Science 369, 1586-1592 (2020)), and the RBD portion fluctuates between the up and down conformations (Khare et al. Front Artif Intell 4, 630955 (2021)). The RBD consists of a twisted five-stranded antiparallel sheet core with disulfide bonds and short connecting helices and loops outside as well as a looped-out extension from the 4 and 7 strands of the core (Lan et al. Nature 581, 215-220 (2020)). The looped-out extension, e.g., the receptor binding motif (RBM), forms the boat-shaped bowl structure that interacts with and holds the contacting arm of ACE2. Seventeen amino acid resides of the RBD contact their partners in ACE2. These contacting resides of the RBD include one residue from the non-RBM portion (K417) and 16 residues from the RBM portion (i.e., G446, Y449, Y453, L455, F456, A475, F486, N487, Y489, Q493, G496, Q498, T500, N501, G502, and Y505) (Lan et al. Nature 581, 215-220 (2020)). Five amino acid residues of the RBD are often mutated in currently dominant variants, including two ACE2 contacting residues (K417 and N501) and three residues near the ACE2 contacting residues (L452, T478, E484). These mutations have been shown to increase ACE2-RBD affinity, induce escape from monoclonal antibody or convalescent sera, and cause severe disease (Tao et al. Nat Rev Genet, 22, 757-773 (2021); Xie et al. Nat Med 27, 620-621 (2021)).
[0102] The spike protein is highly antigenic glycosylated protein (Henderson et al. bioRxiv, (2020)). Numerous anti-spike antibodies, isolated from the sera post-infection patients, are able to neutralize the SARS-CoV-2 adhesion and reduces viral infection, alleviating the disease status (Huang et al. Antib Ther 3, 285-299 (2020); Zost et al. Nature 584, 443-449 (2020)). Most of these neutralizing antibodies belong to anti-RBD antibodies. Therefore, the identification of potent neutralizing antibodies has significant implication for the development of therapeutic antibodies and better understanding the humoral immune response to SARS-CoV-2 variants. In fact, all three FDA approved anti-SARS-CoV-2 monoclonal antibody products with Emergency Use Authorizations (EUAs) designation are anti-RBD antibodies. For example, the bamlanivimab (LY-CoV555) plus etesevimab (LY-CoV016) cocktail targets two partially non-overlapping epitopes on the RBD and the casirivimab (REGN10933) plus imdevimab (REGN10987) cocktail targets two nonoverlapping epitopes on the RBD. The third antibody product, sotrovimab, targets an epitope on the RBD that is conserved between SARS-CoV and SARS-CoV-2 (NIH websiteAnti-SARS-CoV-2 Monoclonal Antibodies).
Anti-SARS-CoV Antibodies
[0103] In one aspect, this disclosure describes an antibody that binds to SARS-CoV (that is, an anti-SARS CoV antibody). An antibody that binds to SARS-CoV includes an antibody that binds to SARS-CoV-1 and/or SARS-CoV-2. In some embodiments, an antibody that binds to SARS-CoV may bind to both SARS-CoV-1 and SARS-CoV-2. In some embodiments, an antibody that binds to SARS-CoV may bind to SARS-CoV-1 but not SARS-CoV-2 or to SARS-CoV-2 but not SARS-CoV-1. In some embodiments an anti-SARS-CoV antibody preferably binds to SARS-CoV-2 and may optionally bind to SARS-CoV-1.
[0104] In some embodiments, an antibody that binds to SARS-CoV preferably binds to SARS-CoV-2 S.sub.1 or SARS-CoV-2 S.sub.1. For example, as described in Example 1 and shown in
[0105] In some embodiments, an antibody that binds to SARS-CoV may inhibit the binding of SARS-CoV-2 S.sub.1 to ACE-2 and/or may inhibit the binding of SARS-CoV-2 S.sub.1 RBD to ACE-2. For example, as described in Example 1 and shown in Table 2, antibodies 1035211, 1035224, 1035240, 1035414, 1035419, 1035423, 1035433, 1035709, 1035716, 1035740, 1035744, 1035752, 1035753, 1035755, and 1035762 reduced the binding of SARS-CoV-2 S.sub.1 RBD to ACE-2 expressing cells (by at least 50%), and monoclonal antibodies 1035211, 1035224, 1035240, 1035419, 1035709, 1035716, 1035740, 1035744, 1035752, 1035753, 1035755, and 1035762 reduced of the binding of SARS-CoV-2 S.sub.1 to ACE-2 expressing cells (by at least 85%).
[0106] In some embodiments, an antibody binds to the receptor binding domain (RBD) of the viral spike (S) protein.
[0107] In some embodiments, an antibody that binds to SARS-CoV-2 may also inhibit the binding of SARS-CoV-1 S.sub.1 to ACE-2 or may inhibit the binding of SARS-CoV-1 S.sub.1 RBD to ACE-2. For example, as described in Example 1 and shown in Table 4, antibodies 1035419, 1035716, and 1035740 inhibited SARS-CoV-1 S.sub.1 and SARS-CoV-1 S.sub.1 RBD binding to ACE-2 as well as SARS-CoV-2 S.sub.1 and SARS-CoV-2 S.sub.1 RBD binding to ACE-2.
[0108] In some embodiments, the antibody may decrease the binding of SARS-CoV (including SARS-CoV-1, SARS-CoV-2, SARS-CoV-1 spike protein, SARS-CoV-1 S.sub.1, SARS-CoV-1 S.sub.1 RBD, SARS-CoV-2 spike protein, SARS-CoV-2 S.sub.1, and/or SARS-CoV-2 S.sub.1 RBD) to a SARS-CoV ligand (including, for example, ACE-2) by at least 10 percent (%), at least 15%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98%. In some embodiments, the antibody may decrease the binding of SARS-CoV to a SARS-CoV ligand (including, for example, ACE-2) by up to 99% or up to 99.5%. For example, the antibody may decrease the binding of SARS-CoV to a SARS-CoV ligand by 50% to 99.5% or by 80% to 99.5%. In some embodiments, the binding of SARS-CoV to a SARS-CoV ligand may be measured using an antibody-blocking assay as described in the Examples.
[0109] In some embodiments, the antibody may bind to one or more variants of the RBD of SARS-CoV-2 S.sub.1. In some embodiments, an antibody that binds to one or more variants of the RBD may also inhibit and/or neutralize the binding of SARS-CoV-2 S.sub.1 to ACE-2. The continued emergence of SARS-CoV-2 variants has raised concerns and challenges for the control, prevention, and management of the coronavirus disease (COVID-19) (Abdool Karim et al. N Engl J Med 384, 1866-1868 (2021)). After over 18 months since the World Health Organization (WHO) declared COVID-19 a pandemic on Mar. 11, 2020 (Cucinotta et al. Acta Biomed 91, 157-160 (2020)), the spread of constantly emerging SARS-CoV-2 variants remains a global threat to the worldwide health and economy. As of Oct. 1, 2021, the WHO classifies four variants (alpha, beta, gamma, and delta) as VOC (variants of concern), two variants (lambda and mu) as VOI (variants of interest), and eleven variants as VUM (variants under monitoring) (WHO websiteTracking SARS-CoV-2 variants). Each variant carries a specific set of mutations in their respective viral genome, particularly in the spike protein that is key to the virus adhesion to target cells. Since the RBD plays a central role in the binding of the spike protein and the viral particle to the ACE2 receptor, mutations in the RBD that result in changes of the epitope structure or conformations on the RBD, at the location where the neutralizing antibodies bind, will cause subsequent evasion of post-infection and/or post vaccination induced immune protection (Tao et al. Nat Rev Genet, 22, 757-773 (2021); Xie et al. Nat Med 27, 620-621 (2021)).
[0110] In some embodiments, the antibody may bind to one or more the RBD variants as described in more detail in Examples 3 and 4, including one or more of those shown in
[0111] In some embodiments, an antibody that binds to one or more of these variants of these RBDs may also inhibit and/or neutralize the binding of SARS-CoV-2 S1 to ACE-2.
[0112] In some embodiments, an antibody may bind to the delta variant of the RBD. In some embodiments, an antibody that binds to the delta variant of the RBD may inhibit and/or neutralize the binding of a delta variant of SARS-CoV-2 to ACE-2 and/or may inhibit the binding of the delta variant SARS-CoV-2 S.sub.1 RBD to ACE-2. The delta variant (B.1.617.2) includes mutations in the gene encoding the SARS-CoV-2 spike protein causing the substitutions T478K, P681R and L452R (Starr et al., Cell Reports Medicine. 2 (4): 100255.doi:10.1016/j.xcrm.2021.100255. PMC 8020059. PMID 33842902), which are known to affect transmissibility of the virus as well as whether it can be neutralized by antibodies for previously circulating variants of the COVID-19 virus (SARS-CoV-2 variants of concern as of 24 May 2021, European Centre for Disease Prevention and Control. Retrieved 6 Aug. 2021).
[0113] In some embodiments, an antibody may block, inhibit, and/or neutralize the binding of a SARS-CoV-2 RBD polypeptide to ACE-2. Neutralization activity of an antibody may be strong, moderate, or weak. In some embodiments, strong neutralization activity is a NC.sub.50 value of less than about 1.5 g/l, moderate neutralization activity is a NC.sub.50 value between greater than or equal to about 1.5 g/l and less than or equal to about 15 g/l, and weak neutralization activity is a NC.sub.50 value of greater than about 15 g/l, all as measured by the lateral flow immunoassay described in more detail in Examples 3 and 4. In some embodiments, an antibody as described may have a NC.sub.50 of about 0.3 g/l to about 1.5 g/l, as measured by the lateral flow immunoassay described in more detail in Examples 3 and 4.
[0114] In some embodiments, an antibody may bind to a RBD bin A epitope, a RBD bin B epitope, or RBD bin C epitope, as described in more detail in Examples 3 and 4. As shown in Table 11, RBD epitope bin A includes the epitope of the RBD polypeptide recognized by the 1035709 and 1035762 antibodies, RBD epitope bin B includes the epitope of the RBD polypeptide recognized by the 1035740 and 1035419 antibodies, and RBD epitope bin C includes the epitope of the RBD polypeptide recognized by the 1035753, 1035224, and 1035240 antibodies. RBD epitope bin C epitope may be further classified bin Ca (1035753 and 1035224) and bin Cb (1035240).
[0115] In some embodiments, the antibody may be an isolated antibody. In some embodiments, the antibodies may be isolated or purified by conventional immunoglobulin purification procedures, such as protein A- or G-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.
[0116] In some embodiments, an antibody that binds to SARS-CoV may include a derivative of an antibody that is modified or conjugated by the covalent attachment of any type of molecule to the antibody. Such antibody derivatives include, for example, antibodies that have been modified by glycosylation, acetylation, pegylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, toxins, or linkage to a cellular ligand or other protein. Any of numerous chemical modifications may be carried out by known techniques, including, but not limited to, specific chemical cleavage, acetylation, formylation, and metabolic synthesis of tunicamycin. Additionally, the derivatives may contain one or more non-classical amino acids.
[0117] An antibody that binds to SARS-CoV may be coupled directly or indirectly to a detectable marker by techniques well known in the art. A detectable marker is an agent detectable, for example, by spectroscopic, photochemical, biochemical, immunochemical, or chemical means. Useful detectable markers include, but are not limited to, fluorescent dyes, chemiluminescent compounds, radioisotopes, electron-dense reagents, enzymes, coenzymes, colored particles, biotin, or digoxigenin. A detectable marker often generates a measurable signal, such as radioactivity, fluorescent light, color, or enzyme activity. Antibodies conjugated to detectable agents may be used for diagnostic or therapeutic purposes. Examples of detectable agents include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, radioactive materials, positron emitting metals using various positron emission tomographies, and nonradioactive paramagnetic metal ions. The detectable substance may be coupled or conjugated either directly to the antibody or indirectly, through an intermediate such as, for example, a linker known in the art, using techniques known in the art. See, for example, U.S. Pat. No. 4,741,900, describing the conjugation of metal ions to antibodies for diagnostic use. Examples of suitable enzymes include horseradish peroxidase, alkaline phosphatase, beta-galactosidase, and acetylcholinesterase; examples of suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin; examples of suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride and phycoerythrin; an example of a luminescent material includes luminol; examples of bioluminescent materials include luciferin, and aequorin; and examples of suitable radioactive material include iodine (.sup.121I, .sup.123I, .sup.125I, .sup.131I) carbon (.sup.14C), sulfur (.sup.35S), tritium (.sup.3H), indium (.sup.111In, .sup.112In, .sup.113mIn, .sup.115mIn), technetium (.sup.99Tc, .sup.99mTc), thallium (.sup.201Ti), gallium (.sup.68Ga, .sup.67Ga), palladium (.sup.103Pd), molybdenum (.sup.99Mo), xenon (.sup.133Xe), fluorine (.sup.18F), .sup.153Sm, .sup.177Lu, .sup.159Gd, .sup.149Pm, .sup.140La, .sup.175Yb, .sup.166Ho, .sup.90Y, .sup.47Sc, .sup.186Re, .sup.188Re, .sup.142Pr, .sup.105Rh, and .sup.97Ru. Techniques for conjugating such therapeutic moieties to antibodies are well-known.
[0118] The antibody may be an antibody from any suitable species. For example, the antibody may be a human antibody, a mouse antibody, a rat antibody, a rabbit antibody, a goat antibody, a shark antibody, or a camelid antibody, such as a llama antibody, etc.
[0119] The antibody may be of any type, any class, or any subclass. When the antibody is a human or mouse antibody, for example, the type may include, for example, IgG, IgE, IgM, IgD, IgA and IgY; and/or the class may include, for example, IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2.
[0120] In some embodiments, the antibody is an IgG antibody. In some embodiments, the IgG antibody may be a human antibody of any one of the IgG subclasses including, for example, IgG1, IgG2, IgG3 or IgG4. In some embodiments, the antibody may be a mouse IgG of one of the following sub-classes: IgG1, IgG2A, IgG2B, IgG2C and IgG3. In some embodiments, the antibody may be a rat IgG of one of the following sub-classes: IgG1, IgG2A, IgG2B, or IgG2C.
[0121] In some embodiments, the antibody may include a kappa light chain. In some embodiments, the antibody may include a lambda light chain.
[0122] In some embodiments, the antibody includes an antibody fragment capable of binding to a biological molecule (such as an antigen or receptor) or portions thereof, including but not limited to Fab, Fab and F(ab).sub.2, pFc, Fd, a single domain antibody (sdAb), a variable fragment (Fv), a single-chain variable fragment (scFv) or a disulfide-linked Fv (sdFv); a diabody or a bivalent diabody; a linear antibody; a single-chain antibody molecule; and a multispecific antibody formed from antibody fragments.
[0123] In some embodiments, the antibody may be a humanized antibody. An antibody that binds to SARS-CoV may be humanized by any suitable method. Techniques for producing humanized monoclonal antibodies may be found, for example, in Jones et al. (Jones et al. Nature 321, 522-525 (1986)) and Singer et al. (Singer et al. J Immunol 150, 2844-2857 (1993)). For example, humanization of the antibody may include changes to the antibody to reduce the immunogenicity of the antibody when used in humans. In some embodiments, a humanized antibody that binds to SARS-CoV may include at least a portion of an immunoglobulin constant region (Fc) of a human immunoglobulin. A humanized antibody that binds to SARS-CoV-2 may include, in some embodiments, a human immunoglobulin (recipient antibody) in which residues from one or more complementary determining regions (CDRs) of the recipient antibody are replaced by residues from one or more CDRs of a non-human species antibody (donor antibody), such as mouse, rat, or rabbit antibody, that binds to SARS-CoV. In some embodiments, Fv framework residues (FR) of a human immunoglobulin may be replaced by corresponding non-human residues from an antibody that binds to SARS-CoV.
[0124] In some embodiments, one or more of the variable regions of Table 6 or Table 7 and/or CDR regions of Table 8 or Table 9 may be included in an antibody sequence (e.g., a constant region) of any suitable species (e.g., rat, rabbit, goat, shark, or a camelid species, such as, for example, a llama, etc.).
[0125] In some embodiments, a monoclonal antibody includes a chimeric antibody, that is, an antibody in which different portions are derived from different animal species. A chimeric antibody may be obtained by, for example, splicing the genes from a mouse antibody molecule with appropriate antigen specificity together with genes from a human antibody molecule of appropriate biological specificity. See, for example, Takeda et al. (Takeda et al. Nature 314, 452-454 (1985)). Additional chimeric antibodies including genes from different species may be envisioned.
[0126] In some embodiments, an antibody includes a bispecific or a bifunctional antibody. A bispecific or bifunctional antibody is an artificial hybrid antibody having two different heavy/light chain pairs and two different binding sites. A bispecific antibody may be produced by a variety of methods including fusion of hybridomas or linking of F(ab) fragments. See, for example, Songsivilai et al. and Kostelny et al. (Kostelny et al. J Immunol 148, 1547-1553 (1992); Songsivilai et al. Clin Exp Immunol 79, 315-321 (1990)). In addition, bispecific antibodies may be formed as diabodies (Holliger et al. Proc Natl Acad Sci USA 90, 6444-6448 (1993)) or Janusins (Traunecker et al. EMBO J 10, 3655-3659 (1991); Traunecker et al Int J Cancer Suppl 7, 51-52 (1992)).
[0127] In some embodiments, an antibody includes a multispecific antibody that includes more than one variable region, wherein each variable region binds to a different site of a single target molecule or more than one target molecule.
[0128] In some embodiments, the antibody may be produced by an animal (including, but not limited to, human, mouse, rat, rabbit, hamster, goat, horse, chicken, turkey, or camelid species, such as, for example, a llama), produced by a cell from an animal, chemically synthesized, or recombinantly expressed. The antibody may be purified by any method known in the art for purification of an immunoglobulin molecule, for example, by chromatography (for example, ion exchange, affinity, and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for the purification of proteins. In addition, an antibody may be fused to a heterologous polypeptide sequence, as described herein or otherwise known in the art, including, for example, to facilitate purification.
[0129] In some embodiments, an antibody that binds to SARS-CoV may be made by immunizing an animal with a SARS-CoV protein or fragment thereof (including, for example, SARS-CoV-1 spike protein, SARS-CoV-1 S.sub.1, SARS-CoV-1 S.sub.1 RBD, SARS-CoV-2 spike protein, SARS-CoV-2 S.sub.1, and/or SARS-CoV-2 S.sub.1 RBD). In some embodiments, an antibody that binds to SARS-CoV may be made by immunizing an animal with at least a portion of SARS-CoV-2 S.sub.1 (UniProt PODTC2). In some embodiments, the animal may be a mammal. For example, the animal may be a rabbit, a mouse, a goat, a sheet, a rat, or a camelid species, including, for example, a llama. In some embodiments, the animal may be a chicken.
[0130] For example, as described in Example 1, mice were immunized with amino acids 1-666 of SARS-CoV-2 S.sub.1, amino acids 319-541 of SARS-CoV-2 S.sub.1, or amino acids 1-681 of SARS-CoV-2 S.sub.1.
[0131] A monoclonal antibody may be assayed for immunospecific binding by the methods described herein and by any suitable method known in the art. The immunoassay that may be used includes but is not limited to a competitive and/or a non-competitive assay system using a technique such as BIACORE analysis, fluorescence activated cell sorter (FACS) analysis, immunofluorescence, immunocytochemistry, Western blot, radio-immunoassay, enzyme linked immunosorbent assay (ELISA), sandwich immunoassay, immunoprecipitation assay, precipitin reaction, gel diffusion precipitin reaction, immunodiffusion assay, agglutination assay, complement-fixation assay, immunoradiometric assay, fluorescent immunoassay, and protein A immunoassay. Such assays are routine and well known in the art (see for example, Ausubel et al., eds, Current Protocols in Molecular Biology, Vol. 1, John Wiley & Sons, Inc., N.Y. (1994)).
[0132] In some embodiments, the anti-SARS CoV antibody is preferably a monoclonal antibody.
[0133] The anti-SARS CoV monoclonal antibody may be produced by progeny or derivatives of a hybridoma cell line described herein, a monoclonal antibody produced by equivalent or similar hybridoma cell line, and/or a recombinant derivative made therefrom. In some embodiments, an antibody that binds to SARS-CoV includes a recombinantly derived monoclonal antibody including, for example, a rabbit B cell derived monoclonal antibody or a mouse B-cell derived monoclonal antibody.
[0134] An intact antibody molecule has two heavy (H) chain variable regions (abbreviated herein as V.sub.H) and two light (L) chain variable regions (abbreviated herein as V.sub.L). The V.sub.H and V.sub.L regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FRs). The extent of the FRs and CDRs has been precisely defined (see, Kabat et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242, and (Chothia et al. J Mol Biol 196, 901-917 (1987))). Each V.sub.H and V.sub.L is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
[0135] A monoclonal antibody may be obtained by any suitable technique. In some embodiments, an antibody that binds to SARS-CoV may be made by recombinant DNA methods, produced by phage display, and/or produced by combinatorial methods. DNA encoding an antibody that binds to SARS-CoV may be readily isolated and sequenced using conventional procedures. In some embodiments, a hybridoma cell described herein may serve as a source of such DNA. Once isolated, the DNA may be transfected into a host cell (including, for example, simian COS cells, Chinese hamster ovary (CHO) cells, human embryonic kidney cells (HEK), or myeloma cells that do not otherwise produce immunoglobulin protein) or introduced into a host cell by genome editing (for example, using a CRISPR-Cas system) to obtain the synthesis of monoclonal antibodies in recombinant host cells. The DNA encoding an antibody that binds to SARS-CoV may be modified to, for example, humanize the antibody.
[0136] In some embodiments, an antibody includes the same light chain sequence as a monoclonal antibody produced by at least one of the clones of Table 1: 1035211.11, 1035224.11, 1035240.11, 1035414.11, 1035419.11, 1035423.11, 1035433.11, 1035709.11, 1035716.11, 1035740.11, 1035744.11, 1035752.11, 1035753.11, 1035755.11, and 1035762.11 (which produce monoclonal antibodies 1035211, 1035224, 1035240, 1035414, 1035419, 1035423, 1035433, 1035709, 1035716, 1035740, 1035744, 1035752, 1035753, 1035755, and 1035762, respectively). In some embodiments, an antibody includes the same heavy chain sequence as a monoclonal antibody produced by at least one of the clones of Table 1. In some embodiments, an antibody includes the same heavy chain sequence and the same light chain sequence as a monoclonal antibody produced by at least one of the clones of Table 1. In some embodiments, a monoclonal antibody can contain one, two, three, four, five, six, or more amino acid substitutions in the heavy and/or the light chain sequences identified above wherein the amino acid substitutions do not substantially affect binding of the antibody to SARS-CoV, and, in some embodiments, preferably do not substantially affect binding of the antibody to SARS-CoV-2.
[0137] In some embodiments, an antibody includes a light chain variable region (V.sub.L) sequence of Table 6 (that is, one of SEQ ID NO:1 to SEQ ID NO:16). In some embodiments, an antibody includes a heavy chain variable region (V.sub.H) sequence of Table 7 (that is, one of SEQ ID NO:17 to SEQ ID NO:31). In some embodiments, an antibody includes a V.sub.L sequence of Table 6 and a V.sub.H sequence of Table 7. In some embodiments, an antibody includes a V.sub.L sequence of Table 6 and a corresponding V.sub.H sequence of Table 7. For example, if the antibody includes the V.sub.L of antibody 1035419 in Table 6 (e.g., SEQ ID NO:5), the antibody includes a corresponding V.sub.H sequence if the antibody also includes the V.sub.H sequence of antibody 1035419 in Table 7 (SEQ ID NO:21). In some embodiments, an antibody can contain one, two, three, four, five, six, or more amino acid substitutions in the heavy and/or the light chain variable regions identified above wherein the amino acid substitutions do not substantially affect binding of the antibody to SARS-CoV, and, in some embodiments, preferably do not substantially affect binding of the antibody to SARS-CoV-2.
[0138] In some embodiments, an antibody includes at least one CDR of the V.sub.L domain of an antibody produced by at least one of the clones of Table 1; those CDR sequences are provided in Table 8. In some embodiments, an antibody includes at least two CDRs of the V.sub.L domain of an antibody produced by at least one of the clones of Table 1. In some embodiments, an antibody includes all three CDRs of the V.sub.L domain of an antibody produced by at least one of the clones of Table 1.
[0139] In some embodiments, an antibody includes at least one CDR of the V.sub.H domain of an antibody produced by at least one of the clones of Table 1; those CDR sequences are provided in Table 9. In some embodiments, an antibody includes at least two CDRs of the V.sub.H domain of an antibody produced by at least one of the clones of Table 1. In some embodiments, an antibody includes all three CDRs of the V.sub.H domain of an antibody produced by at least one of the clones of Table 1.
[0140] In some embodiments, an antibody may preferably include all three CDRs of the V.sub.L domain of an antibody produced by one of clones of Table 1 and all three CDRs of the V.sub.H domain of an antibody produced by a different clone of Table 1.
[0141] In some embodiments, an antibody may preferably include all three CDRs of the V.sub.L domain of an antibody produced by one of clones of Table 1 and all three CDRs of the V.sub.H domain of an antibody produced by the same clone of Table 1. For example, in an exemplary embodiment, an antibody may include all three CDRs of the V.sub.L domain of antibody 1035419: RASESVDSYGASFMH (SEQ ID NO: 38), LASNLES (SEQ ID NO: 39), and QQNYEDPWT (SEQ ID NO: 40); and all three CDRs of the V.sub.H domain of antibody 1035419: SYWIH (SEQ ID NO:76), RIYPGTGSTYNNEKFKG (SEQ ID NO:77), and GEDNLYFYAMDY (SEQ ID NO:78).
[0142] In some embodiments, an antibody can contain one, two, three, four, five, six, or more amino acid substitutions in one or more CDRs identified above which do not substantially affect binding of the antibody to SARS-CoV, and, in some embodiments, preferably do not substantially affect binding of the antibody to SARS-CoV-2. In some embodiments, the substitutions in one or more CDRs may be substitutions with conserved amino acids.
[0143] In some embodiments, an antibody can contain one, two, three, four, five, six, or more amino acid substitutions in one or more framework regions (FRs). In some embodiments, the substitutions, or substitutions in the framework regions (FRs) do not substantially affect binding of the antibody to SARS-CoV, and, in some embodiments, preferably do not substantially affect binding of the antibody to SARS-CoV-2. In some embodiments, the substitutions in one or more FRs may be substitutions with conserved amino acids.
[0144] In some embodiments, an antibody can contain one, two, three, four, five, six, or more amino acid substitutions relative to an antibody produced by one of the clones of Table 1, wherein the substitutions do not substantially affect binding of the antibody to SARS-CoV, and, in some embodiments, preferably do not substantially affect binding of the antibody to SARS-CoV-2. In some embodiments, the substitutions may be substitutions with conserved amino acids.
[0145] In some embodiments, the antibody includes an amino acid sequence that is at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to an amino acid sequence of at least one V.sub.L domain of an antibody produced by one of the clones of Table 1 (see Table 6).
[0146] In some embodiments, the antibody includes an amino acid sequence that is at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to an amino acid sequence of at least one V.sub.H domain of an antibody produced by one of the clones of Table 1 (see Table 7).
[0147] In some embodiments, an anti-SARS-CoV antibody includes an antibody that binds to the same SARS-CoV epitope as an antibody produced by one of the clones of Table 1.
[0148] In another aspect, this disclosure describes an isolated polynucleotide molecule. In some embodiments, the isolated polynucleotide molecule includes a nucleotide sequence encoding an antibody. In some embodiments, the isolated polynucleotide molecule includes a nucleotide sequence that has at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to nucleotide sequence encoding an antibody described herein. In some embodiments, the isolated polynucleotide molecule includes polynucleotides that hybridize under high stringency to a nucleotide sequence encoding an antibody or a complement thereof. As used herein stringent conditions refer to the ability of a first polynucleotide molecule to hybridize, and remain bound to, a second, filter-bound polynucleotide molecule in 0.5 M NaHPO.sub.4, 7% sodium dodecyl sulfate (SDS), and 1 mM EDTA at 65 C., followed by washing in 0.2SSC/0.1% SDS at 42 C. (see Ausubel et al. (eds.), Current Protocols in Molecular Biology, Vol. 1, Green Publishing Associates, Inc., and John Wiley & Sons, Inc., N.Y. (1989), at p. 2.10.3). In some embodiments, the isolated polynucleotide molecule includes polynucleotides that encode one or more of the CDRs or the heavy and/or light chains of a monoclonal antibody of the present disclosure. General techniques for cloning and sequencing immunoglobulin variable domains and constant regions are well known. See, for example, Orlandi et al. (Orlandi et al. Proc Natl Acad Sci USA 86, 3833-3837 (1989)).
[0149] In another aspect, this disclosure describes recombinant vectors including an isolated polynucleotide of the present disclosure. The vector may be, for example, in the form of a plasmid, a viral particle, or a phage. The appropriate DNA sequence may be inserted into a vector by a variety of procedures. In general, the DNA sequence is inserted into an appropriate restriction endonuclease site(s) in a vector by procedures known in the art. Such procedures are deemed to be within the scope of those skilled in the art. Large numbers of suitable vectors and promoters are known to those of skill in the art and are commercially available. The following vectors are provided by way of example. Bacterial vectors include, for example, pQE70, pQE60, pQE-9, pBS, pD10, phagescript, psiX174, pbluescript SK, pbsks, pNH8A, pNH16a, pNH18A, pNH46A, ptrc99a, pKK223-3, pKK233-3, pDR540, and pRIT5. Eukaryotic vectors include, for example, pWLNEO, pSV2CAT, pOG44, pXT1, pSG, pSVK3, pBPV, pMSG, and pSVL. However, any other plasmid or vector may be used.
[0150] In a further aspect, this disclosure also includes a host cell containing at least one of the above-described vectors. The host cell may be a higher eukaryotic cell, such as a mammalian or insect cell, or a lower eukaryotic cell, such as a yeast cell. Or, the host cell may be a prokaryotic cell, such as a bacterial cell, or a plant cell. Introduction of a vector construct into the host cell may be affected by any suitable techniques, such as, for example, calcium phosphate transfection, DEAE-Dextran mediated transfection, electroporation, or nucleofection.
[0151] Antibodies of the present disclosure may be expressed in mammalian cells, yeast, bacteria, or other cells under the control of appropriate promoters. Cell-free translation systems may also be employed to produce such proteins using RNAs derived from the DNA constructs of the present disclosure. Appropriate cloning and expression vectors for use with prokaryotic and eukaryotic hosts are described by, for example, Sambrook et al., Molecular Cloning: A Laboratory Manual, Second Edition, Cold Spring Harbor, N.Y. (1989).
[0152] Also included in the present disclosure are phage display libraries expressing one or more hypervariable regions from an antibody of the present disclosure, and clones obtained from such a phage display library. A phage display library is used to produce antibody derived molecules. Gene segments encoding the antigen-binding variable domains of antibodies are fused to genes encoding the coat protein of a bacteriophage. Bacteriophage containing such gene fusions are used to infect bacteria, and the resulting phage particles have coats that express the antibody-fusion protein, with the antigen-binding domain displayed on the outside of the bacteriophage. Phage display libraries may be prepared, for example, using the P
Hybridoma Cell Lines
[0153] This disclosure further describes hybridoma cell lines (also referred to herein as clones or antibody clones) expressing monoclonal antibodies including, for example, the hybridoma cell lines of Table 1. In some embodiments, a monoclonal antibody produced by a hybridoma cell line binds to SARS-CoV. In some embodiments, a monoclonal antibody produced by a hybridoma cell line abrogates binding of SARS-CoV to ACE-2.
[0154] Hybridoma cell lines may be obtained by various techniques familiar to those skilled in the art. For example, cells from an animal immunized with a desired antigen are immortalized, commonly by fusion with a myeloma cell (see, for example, Kohler and Milstein (Kohler et al. Eur J Immunol 6, 511-519 (1976)); J. Goding in Monoclonal Antibodies: Principles and Practice, Academic Press, pp 59-103 (1986); and Harlow et al., Antibodies: A Laboratory Manual, page 726 (Cold Spring Harbor Pub. 1988). In some embodiments, the immunized animal is preferably a mammal. In some embodiments, the immunized animal is a rat including, for example, a Wistar rat, or a mouse including, for example, a BALB/C mouse. In some embodiments, the cells from the animal are spleen cells. In some embodiments, the cells from the animal are preferably lymphocytes. In some embodiments, the myeloma cell includes a P3X63Ag8.653 cell.
[0155] Other known methods of producing transformed B cell lines that produce monoclonal antibodies may also be used.
[0156] Exemplary hybridoma cell lines include 1035211.11, 1035224.11, 1035240.11, 1035414.11, 1035419.11, 1035423.11, 1035433.11, 1035709.11, 1035716.11, 1035740.11, 1035744.11, 1035752.11, 1035753.11, 1035755.11, and 1035762.11 which produce antibodies 1035211, 1035224, 1035240, 1035414, 1035419, 1035423, 1035433, 1035709, 1035716, 1035740, 1035744, 1035752, 1035753, 1035755, and 1035762, respectively.
Recombinant Antibodies
[0157] This disclosure further describes recombinantly derived monoclonal antibodies. Recombinantly derived monoclonal antibodies may include, for example, rabbit B cell derived monoclonal antibodies or mouse B cell derived antibodies. Monoclonal antibodies of the present disclosure may be produced by any suitable recombinant technique including, for example, by phage display or by combinatorial methods. See, for example, U.S. Pat. No. 5,223,409; WO 92/18619; WO 91/17271; WO 92/20791; WO 92/15679; WO 93/01288; WO 92/01047; WO 92/09690; or WO 90/02809. Such methods may be used to generate human monoclonal antibodies.
Uses for the Anti-SARS-CoV Antibodies
[0158] An antibody that binds to SARS-CoV, as described herein, may be used for any suitable application. For example, a monoclonal antibody may be used in both in vitro and in vivo diagnostic and therapeutic methods.
[0159] In some embodiments, an antibody may be used to determine a level of expression of SARS-CoV protein in vitro or in vivo. In some embodiments, an antibody may be used to label a cell in vivo or in vitro. In some embodiments, an antibody may be used to determine a level of expression of SARS-CoV protein in a patient sample.
[0160] In some embodiments, an antibody may be used to identify the presence or absence of SARS-CoV protein in a sample from a subject. In some embodiments, identifying the presence of SARS-CoV may include identifying an amount of SARS-CoV in a sample from a subject.
[0161] In some embodiments, an antibody may be used to identify a SARS-CoV-2 receptor binding domain (RBD) variant in a sample from a subject.
[0162] The sample from the subject may include any suitable or useful samples. Exemplary samples include saliva, sputum, blood, urine, feces, nasal swabs, and bronchial brush or bronchoalveolar lavage (BAL) fluid.
[0163] In some embodiments, the antibody may be labeled. The antibodies may be labeled with one or more detectable markers, as described herein. For example, a labeled antibody may be used to label a cell, and the labeled cell may be directly or indirectly imaged via secondary methods. In some embodiments, the cell may be a mammalian cell.
[0164] In some embodiments, the antibody may be used to modulate the interaction of SARS-CoV and a ligand of SARS-CoV including, for example, ACE-2. In some embodiments, modulation of the interaction of SARS-CoV and ACE-2 can include inhibiting the interaction of SARS-CoV and ACE-2. Such inhibition may produce immunotherapeutic effects including, for example, the prevention of infection of a cell expressing ACE-2 by SARS-CoV, delaying the onset of SARS or COVID-19, and/or delaying the progression of SARS or COVID-19.
[0165] In some embodiments, an antibody as described herein may be administered as a therapeutic agent to prevent the binding of SARS-CoV-2 to the host ACE-2 enzyme.
[0166] This disclosure further describes a kit including an antibody. For example, a kit may include a composition that includes an anti-SARS-CoV monoclonal antibody. The antibodies in the kit may be labeled with one or more detectable markers, as described herein. A kit may include one or more containers filled with one or more of the monoclonal antibodies of the disclosure. Additionally, the kit may include other reagents such as buffers and solutions needed to practice the disclosure are also included. Optionally associated with such container(s) may be a notice or printed instructions. As used herein, the phrase packaging material refers to one or more physical structures used to house the contents of the kit. The packaging material is constructed by well-known methods, preferably to provide a sterile, contaminant-free environment. As used herein, the term package refers to a solid matrix or material such as glass, plastic, paper, foil, and the like, capable of holding within fixed limits a polypeptide.
[0167] This disclosure further describes a lateral flow immunoassay device including one or more of the antibodies described herein. The antibodies may be labeled with one or more detectable markers, as described herein. In some embodiments, the lateral flow immunoassay may also include an antibody with a specificity other than a SARS-CoV, such as, for example, an anti-nucleocapsid protein (NP) antibody. Such a lateral flow immunoassay device may be provided in a package that may include other reagents such as buffers and solutions needed to practice the disclosure are also included. Optionally the package may also include a notice or printed instructions. As used herein, the phrase packaging material refers to one or more physical structures used to house the contents of the immunoassay device. The packaging material is constructed by well-known methods, preferably to provide a sterile, contaminant-free environment. As used herein, the term package refers to a solid matrix or material such as glass, plastic, paper, foil, and the like, capable of holding within fixed limits a polypeptide.
Compositions Including Antibodies
[0168] In some embodiments, this disclosure describes a composition including at least one of the antibodies described herein.
[0169] In some embodiments, the composition may also include, for example, buffering agents to help to maintain the pH in an acceptable range or preservatives to retard microbial growth. A composition may also include, for example, carriers, excipients, stabilizers, chelators, salts, or antimicrobial agents. Acceptable carriers, excipients, stabilizers, chelators, salts, preservatives, buffering agents, or antimicrobial agents, include, but are not limited to, buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives, such as sodium azide, octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol; polypeptides; proteins, such as serum albumin, gelatin, or non-specific immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (for example, Zinc (Zn)-protein complexes); and/or non-ionic surfactants such as TWEEN, PLURONICS, or polyethylene glycol (PEG).
[0170] In some embodiments, the composition is a pharmaceutical composition and includes the monoclonal antibody and a pharmaceutically acceptable carrier, diluent, or excipient. In the preparation of the pharmaceutical compositions comprising the antibodies described in the teachings herein, a variety of vehicles and excipients may be used, as will be apparent to the skilled artisan.
[0171] The pharmaceutical compositions will generally comprise a pharmaceutically acceptable carrier and a pharmacologically effective amount of an antibody, or mixture of antibodies.
[0172] The pharmaceutical composition may be formulated as a powder, a granule, a solution, a suspension, an aerosol, a solid, a pill, a tablet, a capsule, a gel, a topical cream, a suppository, a transdermal patch, and/or another formulation known in the art.
[0173] For the purposes described herein, pharmaceutically acceptable salts of an antibody are intended to include any art-recognized pharmaceutically acceptable salts including organic and inorganic acids and/or bases. Examples of salts include but are not limited to sodium, potassium, lithium, ammonium, calcium, as well as primary, secondary, and tertiary amines, esters of lower hydrocarbons, such as methyl, ethyl, and propyl. Other salts include but are not limited to organic acids, such as acetic acid, propionic acid, pyruvic acid, maleic acid, succinic acid, tartaric acid, citric acid, benzoic acid, cinnamic acid, salicylic acid, etc.
[0174] As used herein, pharmaceutically acceptable carrier comprises any standard pharmaceutically accepted carriers known to those of ordinary skill in the art in formulating pharmaceutical compositions. For example, the antibody may be prepared as a formulation in a pharmaceutically acceptable diluent, including for example, saline, phosphate buffer saline (PBS), aqueous ethanol, or solutions of glucose, mannitol, dextran, propylene glycol, oils (for example, vegetable oils, animal oils, synthetic oils, etc.), microcrystalline cellulose, carboxymethyl cellulose, hydroxylpropyl methyl cellulose, magnesium stearate, calcium phosphate, gelatin, polysorbate 80 or as a solid formulation in an appropriate excipient.
[0175] A pharmaceutical composition will often further comprise one or more buffers (for example, neutral buffered saline or phosphate buffered saline), carbohydrates (for example, glucose, sucrose or dextrans), mannitol, proteins, polypeptides or amino acids such as glycine, antioxidants (for example, ascorbic acid, sodium metabisulfite, butylated hydroxytoluene, butylated hydroxyanisole, etc.), bacteriostats, chelating agents such as EDTA or glutathione, adjuvants (for example, aluminium hydroxide), solutes that render the formulation isotonic, hypotonic or weakly hypertonic with the blood of a recipient, suspending agents, thickening agents and/or preservatives. Alternatively, compositions of the present disclosure may be formulated as a lyophilizate.
[0176] Any suitable carrier known to those of ordinary skill in the art may be employed in a composition including at least one of the antibodies describes herein. Antibody compositions may be formulated for any appropriate manner of administration, including for example, oral, nasal, mucosal, intravenous, intraperitoneal, intradermal, subcutaneous, and intramuscular administration.
[0177] In some embodiments a composition may include at least one of the anti-SARS-CoV antibodies described herein and one or more additional anti-SARS-CoV antibodies. Such an additional therapeutic agent may be an anti-SARS-CoV antibody, including a polyclonal antibody, such as convalescent serum, or one or more monoclonal antibodies that bind to the SARS-CoV-1 or the SARS-CoV-2 virus. Such a monoclonal antibody may bind to one of the structural proteins of the SARS-CoV virus, such as the spike protein (S), membrane protein (M), envelope protein (E), or nucleocapsid protein (N). Such a monoclonal antibody may bind to the RBD of the S protein. Such a monoclonal antibody may bind to the RBD of the S protein of the SARS-CoV-1 or the SARS-CoV-2 virus. Such a monoclonal antibody may include one of the FDA approved anti-SARS-CoV-2 monoclonal antibody products with Emergency Use Authorizations (EUAs) designation, including the anti-RBD antibodies bamlanivimab (LY-CoV555), etesevimab (LY-CoV016), casirivimab (REGN10933), imdevimab (REGN10987), and sotrovimab.
[0178] The neutralization activity of the cocktail may be additive or more than additive compared to the neutralization of the antibodies individually. In some embodiments, neutralization activity may be determined by the lateral flow immunoassay described in more detail in Examples 3 and 4.
[0179] In some embodiments a composition may include a cocktail of two or more anti-RBD antibodies, each anti-RBD antibody binding to a different epitope of RBD.
[0180] For example, a cocktail of antibodies binding to RBD epitope bin A, RBD epitope bin B, and/or RBD epitope bin C, as described in more detail in Examples 3 and 4.
[0181] In some embodiments, includes the cocktail includes an antibody binding to RBD epitope bin A and an antibody binding to RBD epitope bin B, an antibody binding to RBD epitope bin A and an antibody binding to RBD epitope bin C, or an antibody binding to RBD epitope bin B and an antibody binding to RBD epitope bin C.
[0182] One embodiment includes a cocktail of at least two antibodies, wherein one antibody is an anti-SARS-CoV antibody that binds to a bin A epitope of RBD is selected from: [0183] an antibody that binds to the same epitope as an antibody produced by clone 1035709.11; [0184] an antibody produced by clone 1035709.11; [0185] an antibody comprising a heavy chain variable region (V.sub.H) of the antibody 1035709 (SEQ ID NO: 24); [0186] an antibody comprising a light chain variable region (V.sub.L) of the antibody 1035709 (SEQ ID NO:8); [0187] an antibody comprising a heavy chain V.sub.H and a light chain V.sub.L of the antibody 1035709; [0188] an antibody comprising a heavy chain V.sub.H comprising one or more of the heavy chain complementary determining regions (CDRs) of antibody 1035709; [0189] an antibody comprising a light chain V.sub.L comprising one or more of the light chain CDRs of the antibody 1035709; [0190] an antibody comprising a heavy chain V.sub.H comprising one or more of the heavy chain CDRs and a light chain V.sub.L comprising one or more of the light chain CDRs of the antibody 1035709; [0191] an antibody comprising the three heavy chain CDRs of the antibody 1035709 (SEQ ID NO: 87, SEQ ID NO: 88, and SEQ ID NO: 89); [0192] an antibody comprising the three light chain CDRs the antibody 1035709 (SEQ ID NO: 49, SEQ ID NO:50, and SEQ ID NO: 51); [0193] an antibody comprising the three heavy chain CDRs and the three light chain CDRs of the antibody 1035709; [0194] an antibody comprising a heavy chain V.sub.H with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to a heavy chain V.sub.H of the antibody 1035709 (SEQ ID NO: 24); [0195] an antibody comprising a light chain V.sub.L with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the light chain variable region of the antibody 1035709 (SEQ ID NO: 8); or [0196] an antibody comprising a heavy chain V.sub.H with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to a heavy chain V.sub.H of the antibody 1035709 and a light chain V.sub.L with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the light chain variable region of the antibody 1035709;
and wherein a second antibody is an anti-SARS-CoV antibody that binds to a bin B epitope of RBD selected from: [0197] an antibody that binds to the same epitope as an antibody produced by clone 1035740.11; [0198] an antibody produced by clone 135740.11; [0199] an antibody comprising a heavy chain variable region (V.sub.H) of the antibody 135740 (SEQ ID NO: 26); [0200] an antibody comprising a light chain variable region (V.sub.L) of the antibody 135740 (SEQ ID NO: 10); [0201] an antibody comprising a heavy chain V.sub.H and a light chain V.sub.L of the antibody 135740; [0202] an antibody comprising a heavy chain V.sub.H comprising one or more of the heavy chain complementary determining regions (CDRs) of antibody 135740; [0203] an antibody comprising a light chain V.sub.L comprising one or more of the light chain CDRs of the antibody 135740; [0204] an antibody comprising a heavy chain V.sub.H comprising one or more of the heavy chain CDRs and a light chain V.sub.L comprising one or more of the light chain CDRs of the antibody 135740; [0205] an antibody comprising the three heavy chain CDRs of the antibody 135740 (SEQ ID NO: 90, SEQ ID NO: 93, and SEQ ID NO: 92); [0206] an antibody comprising the three light chain CDRs the antibody 135740 (SEQ ID NO: 55, SEQ ID NO: 56, and SEQ ID NO: 57); [0207] an antibody comprising the three heavy chain CDRs and the three light chain CDRs of the antibody 135740; [0208] an antibody comprising a heavy chain V.sub.H with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to a heavy chain V.sub.H of the antibody 135740 (SEQ ID NO: 26); [0209] an antibody comprising a light chain V.sub.L with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the light chain variable region of the antibody 135740 (SEQ ID NO: 10); or [0210] an antibody comprising a heavy chain V.sub.H with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to a heavy chain V.sub.H of the antibody 1035709 and a light chain V.sub.L with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the light chain variable region of the antibody 135740.
[0211] A composition including an anti-SARS-CoV antibody may be formulated in pharmaceutical preparations in a variety of forms adapted to the chosen route of administration. One of skill will understand that the composition will vary depending on mode of administration and dosage unit. For example, for parenteral administration, isotonic saline may be used. For topical administration a cream, including a carrier such as dimethylsulfoxide (DMSO), or other agents typically found in topical creams that do not block or inhibit activity of the peptide, may be used. Other suitable carriers include, but are not limited to alcohol, phosphate buffered saline, and other balanced salt solutions. The compounds of this disclosure may be administered in a variety of ways, including, but not limited to, intravenous, topical, oral, subcutaneous, intraperitoneal, and intramuscular delivery. In some embodiments, the compounds of the present disclosure may be formulated for controlled or sustained release. In some embodiments, a formulation for controlled or sustained release is suitable for subcutaneous implantation. In some embodiments, a formulation for controlled or sustained release includes a patch.
[0212] Administration may be as a single dose or in multiple doses. In some embodiments, the dose is an effective amount as determined by the standard methods, including, but not limited to, those described herein. Those skilled in the art of clinical trials will be able to optimize dosages of particular compounds through standard studies. Additionally, proper dosages of the compositions may be determined without undue experimentation using standard dose-response protocols. Administration includes, but is not limited to, any of the dosages and dosing schedules, dosing intervals, and/or dosing patterns described in the examples included herewith.
[0213] The composition including an antibody according to the present disclosure may be administered by any suitable means including, but not limited to, for example, oral, rectal, nasal, topical (including transdermal, aerosol, buccal and/or sublingual), vaginal, parenteral (including subcutaneous, intramuscular, and/or intravenous), intradermal, intravesical, intra joint, intra-arteriole, intraventricular, intracranial, intraperitoneal, intranasal, by inhalation, or intralesional (for example, by injection into or around a tumor).
[0214] For parenteral administration in an aqueous solution, for example, the solution should be suitably buffered if necessary and the liquid diluent first rendered isotonic with sufficient saline or glucose. These particular aqueous solutions are especially suitable for intravenous, intramuscular, subcutaneous, and intraperitoneal administration. In this connection, sterile aqueous media that may be employed will be known to those of skill in the art. Some variation in dosage will necessarily occur depending on the condition of the subject being treated. The person responsible for administration will, in any event, determine the appropriate dose for the individual subject. Moreover, for human administration, preparations should meet sterility, pyrogenicity, and general safety and purity standards as required by the FDA. Such preparations may be pyrogen-free.
[0215] Many suitable formulations are known, including polymeric or protein microparticles encapsulating drug to be released, ointments, gels, or solutions which may be used topically or locally to administer drug, and even patches, which provide controlled release over a prolonged period of time. These may also take the form of implants. Such an implant may be implanted within the tumor.
[0216] The compounds of the present disclosure may also be provided in a lyophilized form. Such compositions may include a buffer, for example, bicarbonate, for reconstitution prior to administration, or the buffer may be included in the lyophilized composition for reconstitution with, for example, water. The lyophilized composition may further comprise a suitable vasoconstrictor, for example, epinephrine. The lyophilized composition may be provided in a syringe, optionally packaged in combination with the buffer for reconstitution, such that the reconstituted composition may be immediately administered to a patient.
[0217] As used herein treating or treatment may include therapeutic and/or prophylactic treatments. Treating a disorder, as used herein, is not intended to be an absolute term. Treatment may lead to an improved prognosis or a reduction in the frequency or severity of symptoms. A therapeutically effective concentration or amount as used herein is an amount that provides some improvement or benefit to the subject. Desirable effects of treatment include preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis. Likewise, the term preventing, as used herein, is not intended as an absolute term. Instead, prevention refers to delay of onset, reduced frequency of symptoms, or reduced severity of symptoms associated with a disorder. Prevention therefore refers to a broad range of prophylactic measures that will be understood by those in the art. In some circumstances, the frequency and severity of symptoms is reduced to non-pathological levels. In some circumstances, the symptoms of an individual receiving the compositions of the disclosure are only 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, 10%, 5%, or 1% as frequent or severe as symptoms experienced by an untreated individual with the disorder.
[0218] In some embodiments, the compounds of the present disclosure may be used for the presymptomatic treatment of individuals, with the administration of an anti-SARS-CoV antibody as described herein beginning after the determination or diagnosis of SARS or COVID-19, prior to the onset of symptoms. The diagnosis of SARS or COVID-19 may be made by any suitable method including, for example, antibody testing, PCR testing, etc.
[0219] Therapeutically effective concentrations and amounts may be determined for each application herein empirically by testing the compounds in known in vitro and in vivo systems, such as those described herein, dosages for humans or other animals may then be extrapolated therefrom.
[0220] It is understood that the precise dosage and duration of treatment is a function of the disease being treated and may be determined empirically using known testing protocols or by extrapolation from in vivo or in vitro test data. It is to be noted that concentrations and dosage values may also vary with the severity of the condition to be alleviated. It is to be further understood that for any particular subject, specific dosage regimens should be adjusted over time according to the individual need and the professional judgment of the person administering or supervising the administration of the compositions, and that the concentration ranges set forth herein are exemplary only and are not intended to limit the scope or practice of the claimed compositions and methods.
[0221] Toxicity and therapeutic efficacy of the compositions may be determined by standard pharmaceutical procedures in cell cultures or experimental animals, for example, for determining the LD.sub.50 (the dose lethal to 50% of the population) and the ED.sub.50 (the dose therapeutically effective in 50% of the population). The dose ratio between toxic and therapeutic effects is the therapeutic index and it may be expressed as the ratio between LD.sub.50 and ED.sub.50. Compositions that exhibit high therapeutic indices may be preferred. The data obtained from cell culture assays and animal studies may be used in formulating a range of dosage for use in humans. The dosage of such compositions may preferably lie within a range of circulating concentrations that include the ED.sub.50 with little or no toxicity. The dosage may vary within this range depending upon the dosage form employed and the route of administration utilized. The exact formulation, route of administration and dosage may be chosen by the individual physician in view of the patient's condition.
[0222] The dosage of such compositions may include similar doses as other antibody cocktails. Exemplary doses of antibody cocktails include, for example, antibody in a range of 25 mg/kg to 200 mg/kg including for example, 50 mg/kg of antibody or 150 mg/kg of antibody. If multiple antibodies are administered together, the dose may include 25 mg/kg to 75 mg/kg of each antibody, or, for example, 50 mg/kg of each antibody or 150 mg/kg of antibody. Exemplary doses for a human (having an average weight of 62 kg) may include a dose in a range of 1 g to 12 g of antibody, in a range of 1 g to 6 g of antibody, or in a range of 6 g to 12 g of antibody.
[0223] A composition as described herein may be administered at once or may be divided into a number of smaller doses to be administered at intervals of time. For example, compositions may be administered repeatedly, for example, at least 2, 3, 4, 5, 6, 7, 8, or more times, or may be administered by continuous infusion. It is understood that the precise dosage and duration of treatment is a function of the disease being treated and may be determined empirically using known testing protocols or by extrapolation from in vivo or in vitro test data. It is to be noted that concentrations and dosage values may also vary with the severity of the condition to be alleviated. It is to be further understood that for any particular subject, specific dosage regimens should be adjusted over time according to the individual need and the professional judgment of the person administering or supervising the administration of the compositions, and that the concentration ranges set forth herein are exemplary only and are not intended to limit the scope or practice of the claimed compositions and methods.
[0224] In some therapeutic embodiments, an effective amount of an agent is an amount that results in a reduction of at least one pathological parameter. Thus, for example, in some aspects of the present disclosure, an effective amount is an amount that is effective to achieve a reduction of at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% compared to the expected reduction in the parameter in an individual not treated with the agent.
[0225] In some aspects of the methods of the present disclosure, a method further includes the administration of one or more additional therapeutic agents. One or more additional therapeutic agents may be administered before, after, and/or coincident to the administration of a monoclonal antibody as described herein. An additional therapeutic agent may include, for example, chemotherapy, radiation therapy, etc. Additional therapeutic agents may be administered separately or as part of a mixture or cocktail. In some aspects of the present disclosure, the administration of an antibody may allow for the effectiveness of a lower dosage of other therapeutic modalities when compared to the administration of the other therapeutic modalities alone, providing relief from the toxicity observed with the administration of higher doses of the other modalities.
[0226] An additional therapeutic agent may be an anti-SARS-CoV antibody, including a polyclonal antibody, such as convalescent serum, and one or more known monoclonal antibodies that bind to the SARS-CoV-1 or SARS-CoV-2 virus. Such a monoclonal antibody may bind to one of the structural proteins of the SARS-CoV virus, such as the spike protein (S), membrane protein (M), envelope protein (E), or nucleocapsid protein (N). Such a monoclonal antibody may bind to the RBD of the S protein. Such a monoclonal antibody may include one of the FDA approved anti-SARS-CoV-2 monoclonal antibody products with Emergency Use Authorizations (EUAs) designation, including the anti-RBD antibodies bamlanivimab (LY-CoV555), etesevimab (LY-CoV016), casirivimab (REGN10933), imdevimab (REGN10987), and sotrovimab.
[0227] An additional therapeutic agent include small molecule antiviral agents, including, but not limited to a small molecule anti-COVID-19 agent. COVID-19 antiviral small molecules may be classified based on their mechanism of action and/or target. Example classes of COVID-19 small molecule inhibitors include, but are not limited to, TMPRRS2 inhibitors, androgen antagonists, endosomal entry inhibitors, protease inhibitors, inhibitors of viral RNA and/or viral RNA synthesis, inhibitors of host proteins that support viral RNA or viral protein synthesis (imek-Yavuz et al. Turk J Med Sci, (2021)), Many small molecule based COVID-19 treatments have entered clinical trials including AT-527, a viral RNA synthesis inhibitor, and plitidepsin, an inhibitor of proteins supporting viral protein synthesis. Additionally, remdesivir (VEKLURY, N4-hydroxycytidine), an inhibitor of viral RNA synthesis, has received FDA emergency use authorization (U.S. Food & Drug Administration. FDA's approval of Veklury (remdesivir) for the treatment of COVID-19the science of safety and effectiveness. 2020 Oct. 22). The FDA is also considering emergency use authorization of MOLNUPIRAVIR (N4-hydroxycytidine), an inhibitor of viral RNA synthesis (U.S. Food & Drug Administration. FDA to Hold Advisory Committee Meeting to Discuss Merck and Ridgeback's EUA Application for COVID-19 Oral Treatment, 2021 Oct. 14.). Furthermore, Pfizer has recently disclosed promising data regarding PAXLOVID (PF-07321332, ritonavir combination), a small molecule protease inhibitor (Pfizer, Pfizer's Novel COVID-19 Oral Antiviral Treatment Candidate Reduced Risk of Hospitalization or Death by 89% in Interim Analysis of Phase 2/3 Epic-HR Study, 2021 Nov. 5).
[0228] In some embodiments, the composition including at least one antibody as described herein, also includes an FDA approved, or an FDA issued notice of emergency use authorization, COVID-19 antiviral small molecule. In some embodiments, the COVID-19 antiviral small molecule is a protease inhibitor. In some embodiments the protease inhibitor is PAXLOVID (PF-07321332, ritonavir combination). In some embodiments, the COVID-19 antiviral small molecule is an inhibitor of viral RNA synthesis. In some embodiments, the inhibitor of viral RNA synthesis is MOLNUPIRAVIR and/or remdesivir.
[0229] In some aspects of the methods of the present disclosure, the administration of a composition as described herein and the at least one additional therapeutic agent demonstrate therapeutic synergy. In some aspects of the methods of the present disclosure, a measurement of response to treatment observed after administering both an antibody as described herein and the additional therapeutic agent is improved over the same measurement of response to treatment observed after administering either the antibody or the additional therapeutic agent alone. In some aspects of the methods of the present disclosure, a measurement of response to treatment observed after administering both an antibody as described herein and the additional therapeutic agent is improved over the combined measurements of the response to treatment observed after administering either the antibody or the additional therapeutic agent alone.
[0230] The invention is defined in the claims. However, below there is provided a non-exhaustive listing of non-limiting exemplary aspects. Any one or more of the features of these aspects may be combined with any one or more features of another example, embodiment, or aspect described herein.
Exemplary Antibody Aspects
[0231] A1. An anti-SARS-CoV antibody, wherein the anti-SARS-CoV antibody comprises an antibody or antigen binding fragment thereof that binds to the same epitope as an antibody produced a clone selected from 1035211.11, 1035224.11, 1035240.11, 1035414.11, 1035419.11, 1035423.11, 1035433.11, 1035709.11, 1035716.11, 1035740.11, 1035744.11, 1035752.11, 1035753.11, 1035755.11, and 1035762.11. [0232] A2. An anti-SARS-CoV antibody, wherein the anti-SARS-CoV antibody comprises: [0233] a heavy chain variable region (V.sub.H) of an antibody selected from 1035211, 1035224, 1035240, 1035414, 1035419, 1035423, 1035433, 1035709, 1035716, 1035740, 1035744, 1035752, 1035753, 1035755, and 1035762; or [0234] a light chain variable region (V.sub.L) of an antibody selected from 1035211, 1035224, 1035240, 1035414, 1035419, 1035423, 1035433, 1035709, 1035716, 1035740, 1035744, 1035752, 1035753, 1035755, and 1035762; or [0235] both. [0236] A3. An anti-SARS-CoV antibody, wherein the anti-SARS-CoV antibody comprises: [0237] a heavy chain variable region (V.sub.H) comprising one or more complementary determining regions (CDRs) of Table 9; or [0238] a light chain variable region (V.sub.L) comprising one or more CDRs of Table 8; or [0239] both. [0240] A4. An anti-SARS-CoV antibody, wherein the anti-SARS-CoV antibody comprises: [0241] each of the complementary determining regions (CDRs) of a heavy chain variable region of a monoclonal antibody produced by one of the clones of Table 1; or [0242] each of the CDRs of a light chain variable region of a monoclonal antibody produced by one of the clones of Table 1; [0243] each of the CDRs of a heavy chain variable region of a monoclonal antibody produced by one of the clones of Table 1 and each of the CDRs of a light chain variable region of a monoclonal antibody produced by one of the clones of Table 1; or [0244] each of the CDRs of a heavy chain variable region of a monoclonal antibody produced by one of the clones of Table 1, and each of the CDRs of a light chain variable region of a monoclonal antibody produced by the same clone. [0245] A5. The anti-SARS-CoV antibody of Aspect A4, [0246] wherein the CDRs of the heavy chain variable region have an amino acid sequence set forth in Table 9; or [0247] wherein the CDRs of the light chain variable region have an amino acid sequence set forth in Table 8; or [0248] both. [0249] A6. An anti-SARS-CoV antibody, wherein the anti-SARS-CoV antibody comprises an amino acid sequence having [0250] at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the heavy chain variable region of a monoclonal antibody produced by a clone of Table 1; or [0251] at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the light chain variable region of a monoclonal antibody produced by a clone of Table 1; or [0252] at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the heavy chain variable region of a monoclonal antibody produced by a clone of Table 1, and at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the light chain variable region of a monoclonal antibody produced by a clone of Table 1. [0253] A7. The anti-SARS-CoV antibody of any one of Aspects A1 to A6, wherein the anti-SARS-CoV antibody comprises an antibody produced by a clone selected from 1035211.11, 1035224.11, 1035240.11, 1035414.11, 1035419.11, 1035423.11, 1035433.11, 1035709.11, 1035716.11, 1035740.11, 1035744.11, 1035752.11, 1035753.11, 1035755.11, and 1035762.11. [0254] A8. The anti-SARS-CoV antibody of any one of Aspects A1 to A7, wherein the anti-SARS-CoV antibody specifically binds to the receptor binding domain (RBD) of the SARS-CoV spike (S) protein. [0255] A8. The anti-SARS-CoV antibody of any one of Aspects A1 to A7, wherein the anti-SARS-CoV antibody decreases binding of SARS-CoV-1 or SARS-CoV-2 or both SARS-CoV-1 and SARS-CoV-2 to ACE-2 by at least 10 percent (%), at least 15%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98%. [0256] A9. The anti-SARS-CoV antibody of any one of Aspects A1 to A8, wherein the anti-SARS-CoV antibody comprises an anti-SARS-CoV-2 antibody. [0257] A10. The anti-SARS-CoV antibody of any one of Aspects A1 to A9, wherein the anti-SARS-CoV antibody comprises an anti-SARS-CoV-1 antibody. [0258] A11. The anti-SARS-CoV antibody of any one of Aspects A1 to A10, wherein the anti-SARS-CoV antibody specifically binds to a SARS-CoV-2 variant selected from: [0259] the alpha variant (the United Kingdom variant (UK), B.1.1.7 lineage, RBD with N501Y); [0260] the beta variant (South African variant (SA), B.1.3512 lineage, RBD with K417N, E484K, and N501Y); [0261] the gamma variant (Brazilian variant P.1 (BR P.1), B.1.1.28.1 lineage, RBD with K417T, E484K, and N501Y); [0262] the delta variant (Indian variant 2 (IN v2), B.1.617.2 lineage, RBD with L452R and T478K); [0263] the epsilon variant (California variant (CA), B.1.427/9 lineage, RBD with L452R); [0264] the kappa variant (Indian variant 1 (IN v1), B.1.617.1 lineage, RBD with L452R and E484Q); [0265] the zeta variant (Brazilian variant P.2 (BR P.2), B.1.1.28.2 lineage, RBD with E484K); [0266] the K417E RBD (R319-F541 with K417E); [0267] the T478K RBD (R319-F541 with T478K); [0268] the iota variant (New York variant (NY), B.1.526 lineage, RBD with a single mutation E484K); [0269] the eta variant (Nigeria variant, B.1.525 lineage); [0270] the lambda variant (Peru variant, C.37 lineage, RBD with L452Q and F490S); [0271] the theta variant (Philippine variant, P.3 lineage, RBD with E484K and N501Y), and/or [0272] the Denmark mink variant (B.1.1.298 lineage, DM, RBD with Y453). [0273] A12. The anti-SARS-CoV antibody of any one Aspects A1 to A11, wherein binding specificity is characterized by a lateral flow immunoassay. [0274] A13. The anti-SARS-CoV antibody of any one of Aspects A1 to A12, wherein the anti-SARS-CoV antibody has an NC.sub.50 of about 0.3 g/l to about 1.5 g/l. [0275] A14. The anti-SARS-CoV antibody of any one of Aspects A1 to A13, wherein the anti-SARS-CoV antibody binds to a bin A RBD epitope, a bin B RBD epitope, or a bin C RBD epitope. [0276] A15. The anti-SARS-CoV antibody of any one Aspects A1 to A14, wherein the anti-SARS-CoV antibody comprises a humanized antibody. [0277] A16. The anti-SARS-CoV antibody of any one of Aspects A1 to A15, wherein the anti-SARS-CoV antibody is labeled with one or more detectable markers. [0278] A17. The anti-SARS-CoV antibody of any one of Aspects A1 to A16 for use as a reference control solution.
Exemplary Composition Aspects
[0279] B1. A composition comprising the anti-SARS-CoV antibody of any one of Aspects A1 to A17. [0280] B2. The composition of Aspect B1 further comprising one or more additional anti-SARS-CoV antibodies. [0281] B3. A composition comprising two or more anti-SARS-CoV antibodies of any one of Aspects A1 to A17. [0282] B4 The composition of Aspect B2 or B3, wherein one anti-SARS-CoV antibody binds to a bin A epitope of RBD and one anti-SARS-CoV antibody binds to a bin B epitope of RBD. [0283] B5. The composition of Aspect B4, wherein the anti-SARS-CoV antibody that binds to a bin A epitope of RBD is selected from: [0284] an antibody that binds to the same epitope as an antibody produced by clone 1035709.11; [0285] an antibody produced by clone 1035709.11; [0286] an antibody comprising a heavy chain variable region (V.sub.H) of the antibody 1035709; [0287] an antibody comprising a light chain variable region (V.sub.L) of the antibody 1035709; [0288] an antibody comprising a heavy chain V.sub.H and a light chain V.sub.L of the antibody 1035709; [0289] an antibody comprising a heavy chain V.sub.H comprising one or more of the heavy chain complementary determining regions (CDRs) of antibody 1035709; [0290] an antibody comprising a light chain V.sub.L comprising one or more of the light chain CDRs of the antibody 1035709; [0291] an antibody comprising a heavy chain V.sub.H comprising one or more of the heavy chain CDRs and a light chain V.sub.L comprising one or more of the light chain CDRs of the antibody 1035709; [0292] an antibody comprising the three heavy chain CDRs of the antibody 1035709; [0293] an antibody comprising the three light chain CDRs the antibody 1035709; [0294] an antibody comprising the three heavy chain CDRs and the three light chain CDRs of the antibody 1035709; [0295] an antibody comprising a heavy chain V.sub.H with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to a heavy chain V.sub.H of the antibody 1035709; [0296] an antibody comprising a light chain V.sub.L with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the light chain variable region of the antibody 1035709; and an antibody comprising a heavy chain V.sub.H with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to a heavy chain V.sub.H of the antibody 1035709 and a light chain V.sub.L with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the light chain variable region of the antibody 1035709; and [0297] wherein the anti-SARS-CoV antibody binds to the bin B epitope of RBD is selected from [0298] an antibody that binds to the same epitope as an antibody produced by clone 1035740.11; [0299] an antibody produced by clone 135740.11; [0300] an antibody comprising a heavy chain variable region (V.sub.H) of the antibody 135740; [0301] an antibody comprising a light chain variable region (V.sub.L) of the antibody 135740; [0302] an antibody comprising a heavy chain V.sub.H and a light chain V.sub.L of the antibody 135740; [0303] an antibody comprising a heavy chain V.sub.H comprising one or more of the heavy chain complementary determining regions (CDRs) of antibody 135740; [0304] an antibody comprising a light chain V.sub.L comprising one or more of the light chain CDRs of the antibody 135740; [0305] an antibody comprising a heavy chain V.sub.H comprising one or more of the heavy chain CDRs and a light chain V.sub.L comprising one or more of the light chain CDRs of the antibody 135740; [0306] an antibody comprising the three heavy chain CDRs of the antibody 135740; [0307] an antibody comprising the three light chain CDRs the antibody 135740; [0308] an antibody comprising the three heavy chain CDRs and the three light chain CDRs of the antibody 135740; [0309] an antibody comprising a heavy chain V.sub.H with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to a heavy chain V.sub.H of the antibody 135740; [0310] an antibody comprising a light chain V.sub.L with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the light chain variable region of the antibody 135740; [0311] an antibody comprising a heavy chain V.sub.H with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to a heavy chain V.sub.H of the antibody 1035709 and a light chain V.sub.L with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the light chain variable region of the antibody 135740. [0312] B6 The composition of any one of Aspects B1 to B5, wherein the composition further comprises a pharmaceutically acceptable carrier. [0313] B7. The composition of any one of Aspects B1 to B6 for use as a reference control solution.
Exemplary Administration Method Aspects
[0314] C1. A method comprising administering the anti-SARS-CoV antibody of any one Aspects A1 to A17 or the composition of any one of Aspects B1 to B7 to a subject. [0315] C2. The method of Aspect C1, wherein the subject is suspected of having SARS-CoV-1 or SARS-CoV-2 or has been diagnosed with SARS-CoV-1 or SARS-CoV-2. [0316] C3. The method of Aspect C1, wherein the subject has been exposed to SARS-CoV-1 or SARS-CoV-2. [0317] C4. The method of any one of Aspects C1 to C3, wherein the subject is suspected of having, has been diagnosed with, or has been exposed to a SARS-CoV-2 variant selected from: [0318] the alpha variant (the United Kingdom variant (UK), B.1.1.7 lineage, RBD with N501Y); [0319] the beta variant (South African variant (SA), B.1.3512 lineage, RBD with K417N, E484K, and N501Y); [0320] the gamma variant (Brazilian variant P.1 (BR P.1), B.1.1.28.1 lineage, RBD with K417T, E484K, and N501Y); [0321] the delta variant (Indian variant 2 (IN v2), B.1.617.2 lineage, RBD with L452R and T478K); [0322] the epsilon variant (California variant (CA), B.1.427/9 lineage, RBD with L452R); [0323] the kappa variant (Indian variant 1 (IN v1), B.1.617.1 lineage, RBD with L452R and E484Q); [0324] the zeta variant (Brazilian variant P.2 (BR P.2), B.1.1.28.2 lineage, RBD with E484K); [0325] the K417E RBD (R319-F541 with K417E); [0326] the T478K RBD (R319-F541 with T478K); [0327] the iota variant (New York variant (NY), B.1.526 lineage, RBD with a single mutation E484K); [0328] the eta variant (Nigeria variant, B.1.525 lineage); [0329] the lambda variant (Peru variant, C.37 lineage, RBD with L452Q and F490S); [0330] the theta variant (Philippine variant, P.3 lineage, RBD with E484K and N501Y); and/or [0331] the Denmark mink variant (B.1.1.298 lineage, DM, RBD with Y453). [0332] C5. The method of any one of Aspects C1 to C4, wherein the subject is a human. [0333] C6. The method of any one of Aspects C1 to C5, wherein the method comprises administering about 1 g to about 12 g of the anti-SARS-CoV antibody. [0334] C7. The method of any one of Aspects C1 to C6, wherein the method comprises administering multiple doses of the anti-SARS-CoV antibody or composition thereof. [0335] C8. The method of any one of Aspects C1 to C7, the method further comprising administering a small molecule antiviral therapeutic agent to the subject. [0336] C9. The method of Aspect C8, wherein the small molecule antiviral therapeutic agent is selected from remdesivir, molnupiravir, paxlovid, or a combination thereof.
Exemplary Immunoassay Devices
[0337] D1. An immunoassay device comprising one or more of the anti-SARS-CoV antibodies of any one of Aspects A1 to A17. [0338] D2. A lateral flow immunoassay device comprising one or more of the anti-SARS-CoV antibodies of any one of Aspects A1 to A17. [0339] D3. The immunoassay device of Aspect D1 or the lateral flow immunoassay device of Aspect D2 further comprising an anti-SARS-CoV nucleocapsid protein (NP) antibody.
Exemplary Diagnosis Method Aspects
[0340] E1. A method comprising using the anti-SARS-CoV antibody of any one of Aspects A1 to A17 or the composition of any one of Aspects B1 to B7 to diagnose a subject with SARS-CoV-1 or SARS-CoV-2. [0341] E2. A method of diagnosing a subject with SARS-CoV-1 or SARS-CoV-2, the method comprising contacting a biosample from the subject with an antibody of any one of Aspects A1 to A17 or a composition of any one of Aspects B1 to B. [0342] E3. A method of identifying a SARS-CoV-2 receptor binding domain (RBD) variant in a sample, the method comprising contacting the biosample with an antibody of any one of Aspects A1 to A17 or a composition of any one of Aspects B1 to B. [0343] E4. The method of any one of Aspects E1 to E2, the method comprising contacting the biosample with more than one antibody of any one of Aspects A1 to A17. [0344] E5. The method of Aspect E4, wherein multiple SARS-CoV-2 receptor binding domain (RBD) variants are identified simultaneously.
[0345] The present invention is illustrated by the following examples. It is to be understood that the particular examples, materials, amounts, and procedures are to be interpreted broadly in accordance with the scope and spirit of the invention as set forth herein.
EXAMPLES
[0346] All reagents, starting materials, and solvents used in the following examples were purchased from commercial suppliers (such as Sigma Aldrich, St. Louis, MO) and were used without further purification unless otherwise indicated.
Example 1
[0347] This Example describes the development and characterization of anti-SARS specific monoclonal antibodies that can bind to both SARS-CoV-2 and SARS-CoV. Antigen-down ELISA was used to demonstrate that the specificity of the antibodies. Flow cytometry was used to demonstrate the ability of these antibodies to block the binding of both SARS-CoV-2 and SARS-CoV-1 to human ACE-2.
Materials and Methods
Immunization and Hybridoma Strategy for Production of SARS-CoV-2 Antibodies:
[0348] Hybridoma cell lines were obtained by immunizing Balb/c mice with the antigens described in Table 1. Mice were immunized with 20 g total antigen per animal, administered in the footpad of the mouse in 5 boosts (4 ug per boost) twice per week (Mondays and Fridays). Three to four days after the final dose, lymphocytes were harvested from lymph nodes and immortalized, by fusion with a P3X63Ag8.653 myeloma cell.
TABLE-US-00001 TABLE 1 Clone Name Antibody Antigen 1035211.11 1035211 recombinant SARS-CoV-2 1035224.11 1035224 Spike protein S.sub.1 (aa1-666)* 1035240.11 1035240 1035414.11 1035414 recombinant SARS-CoV-2 1035419.11 1035419 Spike protein S.sub.1 RBD (aa319-541) 1035423.11 1035423 1035433.11 1035433 1035709.11 1035709 recombinant SARS-CoV-2 1035716.11 1035716 Spike protein S.sub.1 (aa1-681)* 1035740.11 1035740 1035744.11 1035744 1035752.11 1035752 1035753.11 1035753 1035755.11 1035755 1035762.11 1035762 *All amino acid ranges are with reference to UniProt P0DTC2.
Antigen-Down ELISA:
[0349] The specificity of antibodies for monomeric SARS-CoV-2 S.sub.1 RBD protein was tested using an antigen-down ELISA.
[0350] Briefly, SARS-CoV-2 S.sub.1 was titrated in 1TBS and coated on 96-well plates at the following concentrations: 400 ng/mL, 100 ng/mL, 25 ng/mL, 6.25 ng/mL, and 1.56 ng/mL. Control wells were coated in 1TBS Buffer alone. Purified mouse anti-SARS-CoV mAb candidates were added at 1 ug/ml in Capture Buffer (5 Tris Buffered Saline (TBS), 50 mg/mL BSA and 10% TWEEN). 3,3,5,5-tetramethylbenzidine (TMB) buffer alone was added to some wells as a second negative control. Goat anti-mouse/HRP-conjugated polyclonal antibody (Cat. No. HAF007, Bio-Techne, Minneapolis, MN) was used as secondary antibody in capture buffer. ELISA reactions were carried out in TMB buffer for 10 minutes.
Construction of hACE-2 HEK/eGFP and hCD26 HEK/eGFP Transfectants:
[0351] HEK-293 wild-type cells were transfected with expression plasmids containing a hACE-2 (amino acids 1-708; Accession No. Q9BYF1) cDNA insert and eGFP cDNA insert (amino acids 1-239; Accession No. U57607) downstream of a CMV promoter or a hCD26 (amino acids 1-766; Accession No. Q53TN1) cDNA insert and eGFP cDNA insert (amino acids 1-239; Accession No. U57607) downstream of a CMV promoter. Stable clones expressing hACE-2/eGFP or hCD26/eGFP were used in all assays.
[0352] The resulting GFP-labeled HEK transfectant cells stably over-expressing human ACE-2 (hACE-2 HEK/eGFP Tfx) and GFP-labeled HEK transfectant cells stably over-expressing human CD26 (hCD26 HEK/eGFP Tfx) were grown in IMDM complete selection media (5% FBS, 1Pen/Strep, and 1 g/mL puromycin).
[0353] hACE-2 HEK/eGFP Tfx were screened periodically with anti-hACE-2 antibody (MAB9332, Bio-Techne, Minneapolis, MN) to ensure continued high expression of hACE-2.
SARS-CoV-2 Antibody Blocking Assay with rSARS-CoV-2 Proteins, TSARS-CoV-1 Proteins, and rMERS Proteins:
[0354] A schematic description of the SARS-CoV-2 antibody blocking assay is shown in
[0355] The blocking assays described herein used hACE-2 HEK/eGFP Tfx or hCD26 HEK/eGFP Tfx for the cell model; rSARS-CoV-2, rSARS-CoV-1, or MERS proteins as the protein; and an antibody including, for example, the antibodies produced by the anti-SARS-CoV-2 antibody panels 10352XX, 10354XX, and 10357XX. Each monoclonal antibody tested was added at a final concentration of 25 g/mL. Proteins were added at a final concentration ranging from 50 ng/mL to 1 g/mL.
[0356] Viral proteins/antibodies were co-incubated to form a complex and then added to hACE-2 HEK/eGFP Tfx or hCD26 HEK/eGFP Tfx.
[0357] Anti-His APC or anti-Fc APC was added to the antibody/protein/Tfx samples for detection. The samples were then washed, a live/dead stain was added to exclude dead cells, and analysis was carried out on a BD LSRFortessa.
[0358] Negative controls included hACE-2 HEK/eGFP Tfx or hCD26 HEK/eGFP Tfx alone; anti-His APC+(hACE-2 HEK/eGFP Tfx or hCD26 HEK/eGFP Tfx) (
[0359] rSARS-CoV-2 S.sub.1, rSARS-CoV-2 S.sub.1 RBD, rSARS-CoV-2 active trimer, rSARS-CoV-1 S.sub.1, or rSARS-CoV-1 S.sub.1 RBD+(hACE-2 HEK/eGFP Tfx or hCD26 HEK/eGFP Tfx)+anti-His APC served as a protein binding control for rSARS-CoV-1 and rSARS-CoV-2 (
[0360] rMERS S.sub.1+(hACE-2 HEK/eGFP Tfx or hCD26 HEK/eGFP Tfx)+anti-Fc APC, or rMERS S.sub.1 RBD+(hACE-2 HEK/eGFP Tfx or hCD26 HEK/eGFP Tfx)+anti-His APC served as the protein binding controls for rMERS.
[0361] Anti-viral antibodies+viral proteins+(hACE-2 HEK/eGFP Tfx or hCD26 HEK/eGFP Tfx)+(anti-His APC or anti-Fc APC) were used to assess viral antibody blocking of hACE-2 vs. SARS-CoV-2 or SARS-CoV-1 proteins, or antibody blocking of hCD26 vs. MERS proteins (
Results
SARS-CoV-2 Monoclonal Antibody Specificity
[0362] To determine the specificity of the anti-SARS-CoV-2 monoclonal antibodies in panels 10352XX, 10354XX, and 10357XX, candidate antibodies were screened against varying concentrations of recombinant SARS-CoV-2 S.sub.1 RBD in an antigen-down ELISA.
[0363] As shown in
[0364] By comparison, antibody 1035729 (
[0365] Antibody candidates were not screened against full-length recombinant SARS-CoV-2 S.sub.1 protein by antigen-down ELISA as the full-length protein already contains the RBD motif and would be redundant.
[0366] These results demonstrate that antibodies 1035414, 1035419, 1035423, 1035433, 1035709, 1035716, 1035740, 1035744, 1035752, 1035753, 1035755, 1035762, 1035211, 1035224, and 1035240 are specific for SARS-CoV-2 S.sub.1 RBD.
Flow Cytometry Antibody/Protein Blocking Assay
[0367] To evaluate whether the anti-SARS-CoV-2 S.sub.1 RBD monoclonal antibodies identified in
[0368] Candidate antibodies, or mouse isotype-control antibodies, were pre-incubated with a pre-determined amount of his-tagged SARS-CoV-2 S.sub.1 or his-tagged SARS-CoV-2 S.sub.1 RBD to form an antibody/SARS-CoV-2 protein complex. The antibody/SARS-CoV-2 protein complex was then added to GFP-labeled HEK transfectant cells stably over-expressing human ACE-2 (hACE-2 HEK/eGFP Tfx). Protein binding was determined by staining the hACE-2 HEK/eGFP Tfx cells with a fluorescent anti-His antibody and analyzing the cells for fluorescence by flow cytometry.
[0369] In the absence of viral proteins, no anti-His fluorescence may be detected on hACE-2 HEK/eGFP Tfx cells (
SARS-COV-2 Monomeric S.sub.1 and SARS-COV-2 S.sub.1 RBD Protein Blocking by Anti-SARS-COV-2 Monoclonal Antibodies
[0370] As shown in
[0371] Similarly, in the presence of the monoclonal antibodies from fusion panel 10354XX, candidate 1035419 (
[0372] Antibodies from panels 10352XX, 10354XX, and 10357XX also demonstrated the ability to complex with SARS-CoV-2 S.sub.1 RBD and the ability to block the binding of the RBD with SARS-CoV-2 S.sub.1 to ACE-2 (
[0373] Interestingly, monoclonal antibodies 1035414, 1035423, and 1035433 showed a reduced ability to block the binding of full-length S.sub.1 protein to ACE-2 suggesting that these antibodies uniquely interfere with the RBD of the S.sub.1 protein.
[0374] These results demonstrate that monoclonal antibodies 1035211, 1035224, 1035240, 1035414, 1035419, 1035423, 1035433, 1035709, 1035716, 1035740, 1035744, 1035752, 1035753, 1035755, and 1035762 exhibit at least 50% reduction of the binding of SARS-CoV-2 S.sub.1 RBD to ACE-2 expressing cells.
[0375] These results also demonstrate that monoclonal antibodies 1035211, 1035224, 1035240, 1035419, 1035709, 1035716, 1035740, 1035744, 1035752, 1035753, 1035755, and 1035762 exhibit at least 85% reduction of the binding of SARS-CoV-2 S.sub.1 to ACE-2 expressing cells, with many of the antibodies exhibiting more than 90% reduction, as shown in Table 2.
TABLE-US-00002 TABLE 2 Antibody blocking of a recombinant monomeric SARS- CoV-2 S.sub.1-ACE-2 interaction and a recombinant monomeric SARS-CoV-2 S.sub.1 RBD-ACE-2 interaction. Target Antibody clone Host S1 blocking RBD blocking S1 1035211 Mouse 88.7% 98.7% S1 1035224 Mouse 86.6% 99.1% S1 1035240 Mouse 56.5% 99.1% RBD 1035414 Mouse 25.9% 85.2% RBD 1035419 Mouse 70.1% 90.2% RBD 1035423 Mouse 19.% 94.1% RBD 1035433 Mouse 9.3% 93.7% S1 1035709 Mouse 93.6% 94.7% S1 1035716 Mouse 93.8% 94.6% S1 1035740 Mouse 93.4% 94.6% S1 1035744 Mouse 84.2% 85.4% S1 1035752 Mouse 93.3% 94.5% S1 1035753 Mouse 94.0% 94.7% S1 1035755 Mouse 93.3% 94.1% S1 1035762 Mouse 93.2% 94.1% Percent Blocking was calculated by subtracting the percent of anti-His positive cells in the presence of each monoclonal antibody from the percent of anti-His positive cells incubated with either S.sub.1 or S.sub.1 RBD. 100% Blocking would indicate an antibody that completely prevented the binding of SARS-CoV-2 S.sub.1 or SARS-CoV-2 S.sub.1 RBD to ACE-2.
SARS-COV-2 Homotrimeric Protein Blocking by SARS-COV-2 Monoclonal Antibodies
[0376] Typically, the SARS-CoV-2 spike protein does not exist as a monomeric protein, but rather, as homotrimer that includes three 180-kDa monomers, each containing both S.sub.1 and S.sub.2 subunits (Walls et al. Cell 181, 281-292 e286 (2020)). Because the anti-SARS-CoV-2 monoclonal antibodies identified above could block the binding of recombinant S.sub.1 monomers and S.sub.1 RBD monomers to ACE-2, whether the antibodies would also be able to block the binding of recombinant homotrimeric SARS-CoV-2 spike protein to ACE-2 was also examined
[0377] Recombinant his-tagged homotrimeric SARS-CoV-2 protein was titrated on hACE-2 HEK/eGFP Tfx cells, and binding was detected using an anti-His secondary antibody (
[0378] As shown in
TABLE-US-00003 TABLE 3 Antibody blocking of a recombinant homotrimeric SARS-CoV-2 Spike protein-ACE-2 interaction SARS-CoV2 active Target Antibody clone trimer blocking S1 1035211 78.6% S1 1035224 96.6% S1 1035240 96.1% RBD 1035414 51.4% RBD 1035419 89.0% RBD 1035423 91.6% RBD 1035433 82.5% S1 1035709 96.5% S1 1035716 96.5% S1 1035740 96.5% S1 1035744 1.4% S1 1035752 91.8% S1 1035753 96.6% S1 1035755 84.6% S1 1035762 93.0% Percent Blocking was calculated by subtracting the percent of anti-His positive cells in the presence of each monoclonal antibody from the percent of anti-His positive cells incubated with homotrimeric spike protein alone. 100% Blocking would indicate an antibody that completely prevented the binding of SARS-CoV-2 spike protein to ACE-2.
SARS-COV-1 Monomeric S.SUB.1 .and RBD Blocking by Anti-SARS-COV-2 Monoclonal Antibodies
[0379] The spike proteins for the coronavirus family members SARS-CoV-2 and SARS-CoV-1 share significant homology (Zhou et al. Nature 579, 270-273 (2020); Lan et al. Nature 581, 215-220 (2020); Ou et al. Nat Commun 11, 1620 (2020)) suggesting that antibodies specific for SARS-CoV-2 spike proteins might exhibit cross-reactivity with SARS-CoV-1 spike proteins. An antigen-down ELISA assay was performed to determine whether any of the monoclonal antibodies from panels 10352XX, 10354XX, or 10357XX would bind to decreasing concentrations of SARS-CoV-1 S.sub.1 or SARS-CoV-1 S.sub.1 RBD.
[0380] As shown in
[0381] By comparison, most of the other antibodies in the three antibody fusion panels failed to bind recombinant SARS-CoV-1 S.sub.1 at any concentration. When tested against SARS-CoV-1 S.sub.1 RBD, these same five antibodies elicited some degree of binding; binding of monoclonal antibodies 1035419 (
[0382]
[0383] To determine if anti-SARS-CoV-2 monoclonal antibodies from panels 10352XX, 10354XX, and 10357XX could prevent the binding of SARS-CoV-1 S.sub.1 to ACE-2, SARS-CoV-1 S.sub.1 was titrated on hACE-2 HEK/eGFP Tfx cells and binding was detected using an anti-His secondary antibody (
[0384] The monoclonal antibodies from panels 10352XX, 10354XX, and 10357XX were then individually incubated with recombinant monomeric SARS-CoV-1 S.sub.1 protein for form a complex, and then the complex added to hACE-2 HEK/eGFP Tfx cells to determine if the antibodies could block binding of the monomeric S.sub.1 protein to ACE-2. As shown in
[0385] The ability of the monoclonal antibodies to block recombinant monomeric SARS-CoV-1 S.sub.1 RBD binding to ACE-2 was also examined. The monoclonal antibodies from panels 10352XX, 10354XX, and 10357XX were individually incubated with recombinant monomeric SARS-CoV-1 S.sub.1 RBD to form a complex, and then the complex added to hACE-2 HEK/eGFP Tfx cells to determine if the antibodies could block biding of the monomeric SARS-CoV-1 S.sub.1 RBD to ACE-2.
[0386] As shown in
TABLE-US-00004 TABLE 4 Antibody blocking of a recombinant SARS-CoV-1 S.sub.1-ACE-2 interaction and a recombinant SARS-CoV-1 S.sub.1 RBD-ACE-2 interaction. SARS-CoV S1 SARS-CoV RBD Target Antibody clone blocking blocking S1 1035211 0.0% 0.1% S1 1035224 0.0% 0.0% S1 1035240 0.0% 0.0% RBD 1035414 12.0% 0.4% RBD 1035419 88.5% 44.1% RBD 1035423 0.0% 0.0% RBD 1035433 0.0% 0.0% S1 1035709 0.0% 0.0% S1 1035716 89.5% 68.7% S1 1035740 92.4% 98.8% S1 1035744 0.6% 0.2% S1 1035752 0.0% 0.0% S1 1035753 0.0% 0.0% S1 1035755 1.3% 0.0% S1 1035762 0.0% 0.0% Percent Blocking was calculated by subtracting the percent of anti-His positive cells in the presence of each monoclonal antibody from the percent of anti-His positive cells incubated with either S.sub.1 or S.sub.1 RBD. 100% Blocking would indicate an antibody that completely prevented the binding SARS-CoV-1 S.sub.1 or SARS-CoV-1 S.sub.1 RBD to ACE-2.
MERS Monomeric S.sub.1 and S.sub.1 RBD Binding is not Blocked by Anti-SARS-CoV-2 Monoclonal Antibodies
[0387] The spike proteins for MERS and SARS-CoV-2 share approximately 22% homology (Li et al. iScience 23, 101160 (2020)) suggesting that antibodies specific for SARS-CoV-2 spike proteins might exhibit cross-reactivity with MERS spike proteins.
[0388] To determine if anti-SARS-CoV-2 monoclonal antibodies from panels 10352XX, 10354XX, and 10357XXX could prevent the binding of MERS S.sub.1 or MERS S.sub.1 RBD, MERS S.sub.1 and MERS S.sub.1 RBD were titrated on hCD26 HEK/eGFP Tfx cells and binding was detected using an anti-Fc or anti-His secondary antibody. The monoclonal antibodies from panels 10352XX, 10354XX, and 10357XX were then individually incubated with recombinant monomeric MERS S.sub.1 or MERS S.sub.1 RBD to form a complex, and then the complex was added to hCD26 HEK/eGFP Tfx cells to determine if the antibodies could block binding of the monomeric MERS S1 or monomeric MERS S1 RBD protein to CD26. No blocking was observed (Table 5).
TABLE-US-00005 TABLE 5 Summary of anti-SARS-CoV-2 antibody blocking of recombinant SARS-CoV-2 S.sub.1, SARS-CoV-2 S.sub.1 RBD, trimeric SARS-CoV-2 spike protein, SARS-CoV-1 S.sub.1, SARS-CoV-1 S.sub.1 RBD, MERS S1, and MERS S.sub.1 RBD. SARS-CoV2 SARS-CoV2 RBD SARS-CoV2 active SARS-CoV SARS-CoV MERS S1 MERS RBD Target Antibody clone S1 blocking blocking trimer blocking S1 blocking RBD blocking blocking blocking S1 1035211 88.7% 98.7% 78.6% 0.0% 0.1% 6.4% 0.8% S1 1035224 86.6% 99.1% 96.6% 0.0% 0.0% 4.9% 0.9% S1 1035240 56.5% 99.1% 96.1% 0.0% 0.0% 5.4% 1.5% RBD 1035414 25.9%% 85.2% 51.4% 12.0% 0.4% 5.4% 0.5% RBD 1035419 70.1% 90.2% 89.0% 88.5% 44.1% 5.8% 1.9% RBD 1035423 19.7% 94.1% 91.6% 0.0% 0.0% 5.4% 0.9% RBD 1035433 9.3% 93.7% 82.5% 0.0% 0.0% 6.0% 1.1% S1 1035709 93.6% 94.7% 96.5% 0.0% 0.0% 4.1% 0.9% S1 1035716 93.8% 94.6% 96.5% 89.5% 68.7% 6.0% 0.9% S1 1035740 93.4% 94.6% 96.5% 92.4% 98.8% 7.4% 1.5% S1 1035744 84.2% 85.4% 1.4% 0.6% 0.2% 6.7% 0.8% S1 1035752 93.3% 94.5% 91.8% 0.0% 0.0% 6.6% 1.1% S1 1035753 94.0% 94.7% 96.6% 0.0% 0.0% 6.4% 0.9% S1 1035755 93.3% 94.1% 84.6% 1.3% 0.0% 6.3% 1.3% S1 1035762 93.2% 94.1% 93.0% 0.0% 0.0% 6.0% 0.7%
Example 2
[0389] The antibodies described in Example 1 were sequenced. Results are shown in Tables 6-9. Sequence alignments of the various members of the antibody panel are shown in
TABLE-US-00006 TABLE6 Annotated(Kabatnumbering)variablelightchainantibodysequences.CDRregions1 thru3areboldandunderlined;FR1regions1thru4areinplainlettering. Antibody LightChain SEQIDNO: 1035211 DIKMTQSPSSMYASLGERVTITCKASQDINSYLNWFQQKPGKSPKTLIYRANRLVD 1 GVPSRFSGSGSGQDYSLTISSLEFEDMGIYYCLQYDEFPYTFGGGTKLEIK 1035224 QIVLTQSPAIMSASPGEKVTISCSASSSVSYMYWYQQKPGSSPKPWIYRTSNLAS 2 GVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQYHSYPYMYTFGGGTKLEIK 1035240 DIKMTQSPSSMYASLGERVTITCKASQDINSYLNWFQQKPGKSPKTLIYRANRLVD 3 GVPSRFSGSGSGQDYSLTISSLEYEDMGIYYCLQYDEFPYTFGGGTKLEIK 1035414 NIVLTQSPASLAVSLGQRATISCRASESVDSYGTSFMHWYQQKPGQPPKLLIYLASNLES 4 GVPASFSGSGSRTDFTLTIDPVEADDAATYYCQQNNEDPWTFGGGTKLEIK 1035419 NIVLTQSPASLAVSLGQRATISCRASESVDSYGASFMHWCQQKPGQPPKLLIYLASNLES 5 GVPARFSGSGSRTDFTLTIDPVEADDAATYYCQQNYEDPWTFGGGTKLEIK 1035423 DIVLTQSQKFMSTSVGDRVSITCKASQNVRTAVAWYQQKPGQSPKALIYLASNRHT 6 GVPDRFTGSGSGTDFTLTISNVQSEDLADYFCLQHWNYPLTFGSGTKLELK 1035433 DIVMTQAAPSVPATPGESVSISCRSSKSLLHSNGNTYLYWFLQRPGQSPQLLIFRMSNLAS 7 GVPDRFSGSGSGTAFTLRISRVEAEDVGVYYCMQHLEYPYTFGGGTKLEIK 1035709 DIQMTQSPSSLSASLGERVSLTCRASQEISGYLSWLQQKPDGTIKRLIYAASTLDS 8 GVPKRFSGSRSGSDYSLTISSLESEDFADYYCLQYASYPWTFGGGTKLEIK 1035716 DILLTQSPAILSVSPGERVSFSCRASQSIGTSIHWYQQRTNGSPRLLIKYASESIS 9 GIPSRFSGSGSGTDYTLSINSVESEDIADYYCQQSYSWPTTFGAGTKLELK 1035740 DVLLTQSPAILSVSPGERVSFSCRASQSIGTSLHWYQQRTNGSPRLLIKYVSESIS 10 GIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQSSSWPTTFGAGTKLELK 1035744-1* DIKMTQSPSSMYASLGERVTITCKASQDINSYLSWFQQKPGKSPKTLIYRANRMVD 11 GVPSRFSGSGSGQDYSLTISSLEYEDMGIYYCLQYDEFPYTFGGGTKLEIK 1035744-2* DVQITQSPSYLAASPGETITINCRVSKSISKYLAWYQEKPGKTDKLLIYSGSTLQS 12 GIPSRFSGSGSGQDYSLTISSLEYEDMGIYYCLQYDEFPYTFGGGTKLEIK 1035752 DIVMTQSQKFMSTSVGDRVSVTCKASQNVGTNVAWYQQKPGQSPKALIYSASYRYS 13 GVPDRFTGSGSGTDFTLTINNVQSEDLAEYFCQQYNRYPWTFGGGTKLEIK 1035753 DIQMTQTTSSLSASLGDRVTISCSASQGISNYLNWYQQKPDGTVKLLIYYTSSLHS 14 GVPSRFSGSGSGTDYSLTISNLEPEDIATYYCQQYSKLPFTFGGGTNLEMK 1035755 QIVLTQSPAIMSASPGEKVTISCSASSSVSYMYWYQQKPGSSPKPWIYRTSNLAS 15 GVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQYHSYPYMYTFGGGTKLEIK 1035762 DIQMTQSPSSLSASLGERVSLTCRASQEISGYLCWLQQKPDGTIKRLIYAASTLDS 16 AVPKRFSGSRSGSDYSLTISSLESEDFADFYCLQYASYPWTFGGGTKLEIK *1035744.11 appears to be bi-clonal; that is, the clone produced antibodies with one heavy chain and two light chains in repeated rounds of sequencing
TABLE-US-00007 TABLE7 Annotated(Kabatnumbering)variableheavychainantibodysequences.CDRregions1thru3 arebold,underlined,andhighlightedinyellow;FR1regions1thru4areinplainblack lettering. Antibody HeavyChain SEQIDNO: 1035211 QVQLQQSGAELARPGASVKMSCKASGYTFTNYTMHWVKQRPGQGLEWIGYINPSSGYTNYNQKFKD 17 KATLTADKSSSTAYMQLSSLTSEDSAVYYCARRNPLYAMDYWGQGTSVTVSS 1035224 EVQLQQSGAEFVRPGALVKLSCKASGFNIKDDYMHWVKQRPEQGLEWIGWIDPENGNSIYDPKFQG 18 KASITADTSSNTAYLQLSSLTSEDTAVYYCARGEYFGSGSFAYWGQGTLVTVSA 1035240 QVQLQQSGAELARPGASVKMSCKASGYTFTTYTMHWVKQRPGQGLEWIGYINPSSGYTNYNQKFKD 19 KATLTADTSSSTAYMQLSSLTSEDSAVYYCARRNPLYAMDYWGQGTSVTVSS 1035414 QVQLKQSGAELVRPGASVKLSCKTSGYIFTSYWIHWVKQRSGQGLEWIARIYPGTGNTYYNEKFKG 20 KATLTADKSSTTAYMQLSSLKSEDSAVYFCARGEDNLYYYAMDYWGQGTSVTVSS 1035419 QVQLKQSGAELVRPGASVKLSCKTSGYIFTSYWIHWIKQRSGQGLEWIARIYPGTGSTYNNEKFKG 21 KATLTADKSSSTAYMQLSSLKSEDSAVYFCARGEDNLYFYAMDYWGQGTSVTVSS 1035423 EVKLEESGGGLVQPGGSMKLSCTASGFTFSDAWMDWVRQSPEKGLEWVAEIRNKANNHATYYAESVKG 22 RFTISRDDSKSSVYLQMNSLRAEDTGIYYCILFITYAMDYWGQGTSVTVSS 1035433 QVQLQQSGPQLVRPGASVKISCKASGYSFTIYWMHWVQQRPGQGLEWIGMIDPSDSETRLNQKFKD 23 KATLTVDKSSSTAYMQLSSPTSEDSAVYYCARRGDYNFDYWGQGTTLTVSS 1035709 EVQLQQSGPELVKPGASVKISCKTSGYTFTEYTMHWVKQSHGKSLEWIGGINPNIVDTGYNQKFKG 24 KATLTVDKSSSTAYMELRSLTSEDSAVYYCARDGYPLYYAMDYWGQGTSVTVSS 1035716 EVLLQQSGPELVKPGASVKIPCKASGYTFTDYNMDWVKQSHGKSLEWIGDINPNNGGTIYNQKFKG 25 KATLTVDKSSSTAYMELRSLTSEDTAVYYCAREGYGNYFDYWGQGTTLTVSS 1035740 EVLLQQSGPELVKPGASVKIPCKASGYTFTDYNMDWVKQSHGKSLEWIGDINPNNGFTIYNQKFKG 26 KATLTVDKSSSTAYMELRSLTSEDTAVYYCAREGYGNYFDYWGQGTTLTVSS 1035744 QVQLQQSDAELVKPGASVKISCKASGYTFTDHAIHWVKQKPEQGLEWIGYISPGNGDIKYNEKFKG 27 KATLTADKSSNTAYMQLNSLTSEDSAVYFCKEDDGFYPWFVYWGQGTLVTVSA 1035752 QVQLQQPGAELVRPGASVKMSCKASGYTFTSHSIHWVKQTPGQGLEWIGAVYPGNGDTSYYQKFKG 28 KATLTADKSSSTAYMHLSSLTSEDSAVYYCARDGYSDYYAMDCWGQGTSVTVSS 1035753 EVQLQQSGAELVRPGALVKLSCKASGFNIKDYYMHWVKQRPEQGLEWIGWIDPENGNTIYDPKFLG 29 KASITADTSSNTAYLQLSSLTSEDTAVYYCARWYYYAMDSWGQGTSVTVSS 1035755 EVQLQQSGAELVRPGALVKLSCKASGFNIKDYYMHWVKQRPEQGLEWIGWIDPENGNSIYDPKFQG 30 KASITADTSSNTAYLQLSSLTSEDTAVYYCATPSATSYFDYWGQGTTLTVSS 1035762 EVQLQQSGPELVKPGASVKISCKTSGYTFTEYTMHWVKQSHGKSLEWIGGINPNNGDTGYNQKFKG 31 KATLTVDKSSSTAYMELRSLTFEDSAVYYCARDGYPLYYAMDYWGQGTSVTVSS
TABLE-US-00008 TABLE8 CDRregionsoflightchains SEQ Antibody LightChain IDNO: 1035211 CDR1 KASQDINSYLN 32 CDR2 RANRLVD 33 CDR3 LQYDEFPYT 34 1035224 CDR1 SASSSVSYMY 35 CDR2 RTSNLAS 36 CDR3 QQYHSYPYMYT 37 1035240 CDR1 KASQDINSYLN 32 CDR2 RANRLVD 33 CDR3 LQYDEFPYT 34 1035414 CDR1 RASESVDSYGTSFMH 47 CDR2 LASNLES 39 CDR3 QQNNEDPWT 48 1035419 CDR1 RASESVDSYGASFMH 38 CDR2 LASNLES 39 CDR3 QQNYEDPWT 40 1035423 CDR1 KASQNVRTAVA 41 CDR2 LASNRHT 42 CDR3 LQHWNYPLT 43 1035433 CDR1 RSSKSLLHSNGNTYLY 44 CDR2 RMSNLAS 45 CDR3 MQHLEYPYT 46 1035709 CDR1 RASQEISGYLS 49 CDR2 AASTLDS 50 CDR3 LQYASYPWT 51 1035716 CDR1 RASQSIGTSIH 52 CDR2 YASESIS 53 CDR3 QQSYSWPTT 54 1035740 CDR1 RASQSIGTSLH 55 CDR2 YVSESIS 56 CDR3 QQSSSWPTT 57 1035744-1 CDR1 KASQDINSYLS 58 CDR2 RANRMVD 59 CDR3 LQYDEFPYT 34 1035744-2 CDR1 RVSKSISKYLA 60 CDR2 SGSTLQS 61 CDR3 LQYDEFPYT 34 1035752 CDR1 KASQNVGTNVA 62 CDR2 SASYRYS 63 CDR3 QQYNRYPWT 64 1035753 CDR1 SASQGISNYLN 65 CDR2 YTSSLHS 66 CDR3 QQYSKLPFT 67 1035755 CDR1 SASSSVSYMYWY 35 CDR2 RTSNLAS 36 CDR3 QQYHSYPYMYT 37 1035762 CDR1 RASQEISGYLC 68 CDR2 AASTLDS 50 CDR3 LQYASYPWT 51
TABLE-US-00009 TABLE9 CDRregionsofheavychains SEQ Antibody HeavyChain IDNO: 1035211 CDR1 NYTMH 69 CDR2 YINPSSGYTNYNQKFKD 70 CDR3 RNPLYAMDY 71 1035224 CDR1 DDYMH 72 CDR2 WIDPENGNSIYDPKFQG 73 CDR3 GEYFGSGSFAY 74 1035240 CDR1 TYTMH 75 CDR2 YINPSSGYTNYNQKFKD 70 CDR3 RNPLYAMDY 71 1035414 CDR1 SYWIH 76 CDR2 RIYPGTGNTYYNEKFKG 85 CDR3 GEDNLYYYAMDY 86 1035419 CDR1 SYWIH 76 CDR2 RIYPGTGSTYNNEKFKG 77 CDR3 GEDNLYFYAMDY 78 1035423 CDR1 DAWMD 79 CDR2 EIRNKANNHATYYAESVKG 80 CDR3 FITYAMDY 81 1035433 CDR1 IYWMH 82 CDR2 MIDPSDSETRLNQKFKD 83 CDR3 RGDYNFDY 84 1035709 CDR1 EYTMH 87 CDR2 GINPNIVDTGYNQKFKG 88 CDR3 DGYPLYYAMDY 89 1035716 CDR1 DYNMD 90 CDR2 DINPNNGGTIYNQKFKG 91 CDR3 EGYGNYFDY 92 1035740 CDR1 DYNMD 90 CDR2 DINPNNGFTIYNQKFKG 93 CDR3 EGYGNYFDY 92 1035744 CDR1 DHAIH 94 CDR2 YISPGNGDIKYNEKFKG 95 CDR3 DDGFYPWFVY 96 1035752 CDR1 SHSIH 97 CDR2 AVYPGNGDTSYYQKFKG 98 CDR3 DGYSDYYAMDC 99 1035753 CDR1 DYYMH 100 CDR2 WIDPENGNTIYDPKFLG 101 CDR3 WYYYAMDS 102 1035755 CDR1 DYYMH 100 CDR2 WIDPENGNSIYDPKFQG 73 CDR3 PSATSYFDY 103 1035762 CDR1 EYTMH 87 CDR2 GINPNNGDTGYNQKFKG 104 CDR3 DGYPLYYAMDY 89
[0390] Significant homology was observed in FR-L3, L4, H1, and H3 regions among all the antibodies in this panel. A high degree of diversity was seen in the LC CDRs of all the antibodies. However, a closer analysis of CDR-H3 diversity indicated three distinct populations with diverse CDR H3 sequences representing structurally distinct possibilities for critical antigen engagements with a given epitope and binding modality.
Example 3
Use of the Lateral Flow Immunoassay to Characterize SARS-CoV-2 RBD-Specific Antibodies and Their Ability to React with the UK, SA, and BR P.1 Variant RBDs
[0391] Identifying anti-spike antibodies that maintain strong neutralizing activity against current dominant circulating variants and antibodies that are escaped by these variants have important implications in the development of therapeutic and diagnostic solutions as well as in improving understanding of the humoral response to SARS-CoV-2 infection. With this example, seven anti-RBD monoclonal antibodies are characterized for binding activity, pairing capability, and neutralization activity to SARS-CoV-2 and three RBD variants (UK, SA, and BR P.1) via lateral flow immunoassays. From these studies, the antibodies were classified into three distinct epitope bins. Two antibodies had strong neutralizing activity against all four RBDs and one antibody was completely escaped by the SA and BR P.1 RBDs. The antibody escaped by the SA and BR P.1 RBDs retained binding to SA and BR P.1 RBDs but was unable to induce neutralization. Further, this example demonstrated that the lateral flow immunoassay can be a rapid and effective tool for antibody characterization and determining epitope bins and antibody neutralization kinetics. From these studies, the potential contributions of the mutations (N501Y, E484K and K417N/T) contained in these variant RBDs on their antibody pairing capability, neutralization activity and therapeutic antibody targeting strategy were discussed.
Introduction
[0392] The continued emergence of SARS-CoV-2 variants has raised concerns and challenges for the control, prevention, and management of the coronavirus disease (COVID-19) (Abdool Karim et al. N Engl J Med 384, 1866-1868 (2021)). Currently, the circulating variants of greatest concern include the United Kingdom variant (B.1.1.7 lineage, UK) (Santos et al. bioRxiv, 2020.2012.2029.424708 (2021)) (Rambaut et al. nCoV-2019 Genomic EpidemiologyVirological, (2020)) the South African variant (B.1.351 lineage, SA) (Villoutreix et al. International Journal of Molecular Sciences 22, 1695 (2021)), the Brazilian variant P.1 (B.1.1.28.1 lineage, BR P.1) (Faria et al. Science 372, 815-821 (2021)), the Brazilian variant P.2 (B.1.1.28.2 lineage, BR P.2) (Voloch et al. Journal of Virology 95, e00119-00121 (2021)), the Denmark mink variant (B.1.1.298 lineage, DM) (Bayarri-Olmos et al. bioRxiv, 2021.2001.2029.428834 (2021)), the California variants (B.1.429/427 lineage, CA) (Zhang et al. JAMA 325, 1324-1326 (2021)), the New York variants (B.1.526/525 lineage, NY) (Annavajhala et al. medRxiv, 2021.2002.2023.21252259 (2021)), and the more recent Indian variant (B.1.617 lineage, IN) (Cherian et al. bioRxiv, 2021.2004.2022.440932 (2021)). In the absence of an effective strategy to curb the spread of SARS-CoV-2 virus infection and more individuals harboring the virus, it is inevitable that more variants will emerge.
[0393] The SARS-CoV-2 virus infects mammalian cells by attaching transmembrane spike proteins (S protein) to angiotensin-converting enzyme 2 receptors (ACE-2) found on the surface of human target cells (Ou et al. Nature Communications 11, 1620 (2020)) (Shang et al. Proceedings of the National Academy of Sciences 117, 11727-11734 (2020)). Hence, inhibiting the binding of SARS-CoV-2 spike protein to ACE-2 has been the primary strategy behind most SARS-CoV-2 vaccines (Jackson et al. N Engl J Med 383, 1920-1931 (2020)) (Mulligan et al. Nature 590, E26-E26 (2021)), therapeutic antibodies (Food and Drug Administration. Letter to Regeneron Pharmaceuticals, Inc. (21 Nov. 2020)) (Food and Drug Administration. Letter to Eli Lilly and Company. (10 Nov. 2020)), and therapeutic soluble ACE-2 molecules (Zoufaly et al. Lancet Respir Med 8, 1154-1158 (2020)). It is evident that the receptor binding domain (RBD) of the viral spike protein plays a critical role in the binding of SARS-CoV-2 to ACE-2.
[0394] As of May 14, 2021, there are two therapeutic neutralizing antibody cocktails in use for the treatment of COVID-19 patients that have received Emergency Use Authorization from the FDA ((Food and Drug Administration, Letter to Regeneron Pharmaceuticals, Inc. (21 Nov. 2020)) (Food and Drug Administration. Letter to Eli Lilly and Company. (10 Nov. 2020)). Regeneron's REGN-COV2 is a combination of two anti-SARS-CoV-2 RBD monoclonal antibodies (REGN10933 and REGN10987), and Eli Lily's cocktail is a combination of two anti-SARS-CoV-2 RBD monoclonal antibodies (LY-CoV555 and LY-CoV016). Unfortunately, SARS-CoV-2 variants have rendered monoclonal antibody therapies and spike protein-based vaccines less effective (Xie et al. Nature Medicine 27, 620-621 (2021)) (Hansen et al. Science 369, 1010-1014 (2020)). In fact, the FDA recently revoked the Emergency Use Authorization for the monoclonal antibody (LY-CoV555) monotherapy due to the sustained increase in COVID-19 viral variants that are resistant to LY-CoV555 (FDA Revokes Emergency Use Authorization for Monoclonal Antibody Bamlanivimab, (2020)).
[0395] Viral variants contain numerous mutations and/or deletions along the viral spike protein, this analysis focuses on the key mutations in the RBD that have a direct impact on the RBD-ACE-2 interaction and the escape mechanism of virus from the neutralizing antibodies.
[0396] To better understand how mutations mediate escape of antibody neutralizing activity and to identify anti-RBD antibodies for potential diagnostic and therapeutic uses against SARS-CoV-2 variant infection, a straightforward lateral flow immunoassay was employed to characterize seven anti-RBD monoclonal antibodies for their binding activity, pairing capability and neutralizing activity to SARS-CoV-2 RBD and UK, SA, and BR P.1 variant RBDs. The objectives were three-fold: (1) to screen and identify variant-specific antibodies or escaped neutralizing antibodies for potential diagnostic applications, (2) to characterize and identify broadly potent neutralizing antibodies against SARS-CoV-2 and the variant RBDs for improved neutralization strategies, and (3) to explore the use of rapid lateral flow-based dipstick assay and cassette assay for such studies. It is reported in this example that two of the seven antibodies studied have broad, potent neutralizing activity against SARS-CoV-2 RBD and three variant RBDs and that one antibody has strong neutralizing activity against SARS-CoV-2 RBD and UK variant RBD but has lost the neutralizing activity against the SA and BR P.1 variant RBDs.
Materials and Methods
Anti-SARS-COV-2 RBD Antibodies
[0397] Seven in-house generated anti-SARS-CoV-2 spike RBD murine monoclonal antibodies (Ab1-Ab7) were selected for this analysis. Ab1 (clone No. 1035709), Ab2 (clone No. 1035740), Ab3 (clone No. 1035753) and Ab4 (clone No. 1035762) were generated using the SF21-derived SARS-CoV-2 S1 subunit as the immunogen. Ab5 (clone No. 1035419) was generated using the HEK293-derived SARS-CoV-2 RBD (R319-F541) protein as the immunogen. Ab6 (clone No. 1035224) and Ab7 (clone No. 1035240) were generated using SARS-CoV-2 S1 subunit in a separate fusion. An anti-nucleocapsid monoclonal antibody (anti-NP, clone No. 1035138), generated in-house using the SARS-CoV-2 nucleocapsid full-length protein as immunogen, was used as negative control.
Recombinant SARS-CoV-2 and Variant RBDs
[0398] All recombinant RBD proteins were generated in-house (R&D Systems, Minneapolis, MN) corresponding to NCBI reference sequence using the HEK293 expression system, accession YP_009724390.1 (NCBI Reference Sequence). Recombinant RBD proteins include the SARS-CoV-2 RBD (R319-F541), the UK variant RBD (R319-F541 with N501Y), the SA variant RBD (R319-F541 with K417N, E484K, N501Y), and the BR P.1 variant RBD (R319-F541 with K417T, E484K, N501Y). Secreted recombinant proteins were purified from the conditioned media by nickel chelating chromatography, followed by size exclusion chromatography. All recombinant RBD constructs include a C-terminal 6-His tag.
Other Materials
[0399] Triton X-100, 30% bovine serum albumin (BSA) solution, 30% Brij-35 solution, 10 phosphate buffered saline (PBS), and other chemicals were from Millipore-Sigma (Burlington, MA). Casein solution (1%) in Tris buffer, pH 7.4, was from Thermo Fisher Scientific (Waltham, MA). Recombinant human ACE-2 protein, goat polyclonal anti-chicken IgY antibody and chicken IgY protein (cIgY) were from R&D Systems (Minneapolis, MN).
Preparation of Antibody-AuNP Conjugate
[0400] Anti-RBD antibodies were conjugated to 40 nm citrate protected gold nanoparticles (AuNP, nanoComposix, San Diego, CA) using a direct adsorption according to a procedure modified from the manufacture recommended protocol. Briefly, AuNP solution of 20 OD was combined with high purity water at 1:4 ratio (1 part of AuNP solution in 0.02 mM sodium citrate and 4 parts of water; volume/volume). Antibody solution in 1PBS was added to the AuNP solution at 5% or less of the total reaction volume, with the antibody to AuNP ratio of 50 g antibody per mL of 20 OD AuNP. Due to partial particle aggregation during the adsorption process, the amount of Ab7 was reduced to 20 g per mL 20 OD AuNP solution. For the analysis on the discriminative binding characteristic of the Ab7-Ab4 pair to the four RBDs, Ab4 and Ab5 were adsorbed at 20 jig per mL 20 OD AuNP solution. After the AuNP and antibody mixture was incubated at ambient room temperature for 30 minutes, BSA was added to a final concentration of 5 mg/mL to block the remaining AuNP surface. After another 30-minute incubation period, the AuNP and antibody conjugate solution was centrifuged at 3800 RCF for 10 minutes to pellet the AuNP-antibody conjugate. The conjugate was washed twice with wash and storage buffer, then finally resuspended in wash and storage buffer, and stored at 4 C. until use. The optical density of the conjugate solution was confirmed by an absorbance reading at 525 nm using the NanoDrop 2000 spectrophotometer. The wash and storage buffer is composed of 0.05PBS, pH 7.4, containing 0.5% (w/v) BSA and 0.05% (w/v) sodium azide.
Lateral Flow Dipstick and Assay Procedure for Antibody Pairing Capability and Epitope Binning
[0401] Dipsticks were prepared using a 60 mm300 mm FF120HP nitrocellulose membrane card (Cytiva, Marlborough, MA). The 20 mm wide adhesive with release liner was removed from the nitrocellulose card using a paper cutter. The 15 mm wide adhesive portion was attached with a 17 mm300 mm cellulose fiber sample pad strip as the absorbent pad (Millipore-Sigma, Burlington MA) with 2 mm overlapping the nitrocellulose membrane. The card assembly was cut to 40 mm wide dipsticks using a Matrix 2360 Programmable Shear. Therefore, each dipstick is composed of a plastic backing with 25 mm long nitrocellulose membrane and a 17 mm long absorbent pad.
[0402] Dipsticks were coated with a single row of nine-spot protein array, consisting of 7 spots for the anti-RBD antibodies, two spots for the anti-NP antibody and BSA, as negative controls. Each protein was diluted to 1 mg/mL in 1PBS, pH 7.4 and the protein panel were manually pipetted onto the nitrocellulose membrane at 1 L per spot. The coated dipsticks were dried at 37 C. oven with air constantly blowing for at least 30 minutes prior to use or kept in a plastic bag with desiccant.
[0403] To run the lateral flow dipstick assay for the epitope binning and pairing capability analysis, the dipstick with the protein array was placed in a reservoir, with the nitrocellulose end at the bottom, allowing the liquid to flow into the nitrocellulose membrane and then to the absorbent pad away from the point of origin where the sample was applied. Immediately prior to running an assay, a 300 L sample mixture was prepared by mixing 150 L 1 g/mL RBD protein solution made in assay run buffer, 80 L antibody-AuNP conjugate of 4 OD solution in wash and storage buffer, and 70 L assay run buffer. The sample mixture was added to the reservoir and allowed to run for 12-15 minutes until the sample mixture ran out. A second liquid of 250 L assay run buffer was added and run for another 12-15 minutes to rinse off the non-bound antibody-AuNP conjugates. Thus, each assay run took approximately 30 minutes from the addition of sample mixture to the finish of the assay rinse. The capture antibody-(RBD antigen)-antibody-AuNP complexes accumulate on the coated protein spots of the nitrocellulose membrane and form a red-colored crescent line or circular spot. The assay run buffer was made of 1PBS, pH 7.4, with 1.5% (w/v) BSA, 0.25% (w/v) Tween-20, 0.2% (w/v) casein, and 0.025% (w/v) sodium azide. The dipsticks were imaged using an iPhone camera.
[0404] For evaluating the comparative binding characteristics to four RBD proteins, the assay procedure was modified for better assay sensitivity. All steps were the same as the above procedure for the epitope binning and pairing capability analysis, except (1) the 300 L sample mixture was prepared by mixing 50 L RBD protein solution made in the Brij-35 assay buffer, 404 antibody-AuNP conjugate of 4 OD in the wash and storage buffer, and 210 L Brij-35 assay buffer; (2) 250 L Brij-35 assay buffer was used as the assay chase buffer; (3) The Brij35 assay buffer was composed of 1PBS, pH 7.4, containing 1% (w/v) BSA, 0.1% (v/v) TX-100, 0.3% (v/v) Brij-35 and 0.3% (w/v) casein and 0.05% (w/v) sodium azide.
Lateral Flow Cassette and Assay Procedure for the Neutralization Kinetics
[0405] The lateral flow neutralization test devices were developed and manufactured according to the procedures developed in-house. Briefly, recombinant human ACE-2 and goat polyclonal anti-chicken IgY antibody were striped in the test zone and the control zone as the capture agents, respectively, using an IsoFlow Reagent Dispenser. Recombinant RBD and cIgY were conjugated onto the 40 nm gold nanoparticles as the detectors for the test zone and the control zone, respectively. The AuNP-RBD and AuNP-cIgY conjugates were pooled in a drying down buffer containing salt, stabilizer and AuNP releasing agents and sprayed onto conjugate pad strips using an IsoFlow Reagent Dispenser. Sprayed conjugate pad strips were dried at 37 C. and stored in sealed foil pouches with desiccants until use. Four types of rapid neutralizing antibody test cassettes were prepared for SARS-CoV-2 RBD and UK, SA, and BR P.1 variant RBDs by alternating the AuNP-RBD conjugate while keeping other components the same.
[0406] The neutralization antibody test strip consists of a plastic backing card attached with a sample pad, a conjugate pad with dried gold conjugate detectors, a nitrocellulose membrane stripped with the capture antibodies, and an absorbent (wicking) pad. Each test strip is assembled into a plastic cassette and sealed in a foil pouch with desiccant, stored at ambient room temperature, with at least 3-month stability (longest time point tested so far). The dropper bottle used for introducing the neutralization assay buffer has a drop size of 25 L per drop. The neutralization assay buffer is composed of 1PBS, pH 7.4, containing 3% (w/v) BSA, 0.5% (v/v) Tween-20 and (w/v) sodium azide.
[0407] To run a neutralization kinetic curve for a given antibody, the antibody was diluted in neutralization assay buffer, with the antibody concentrations at 10, 2, 0.5, and 0.1 g/mL, respectively, and the zero-antibody control. The assays were run in stacking modes with each assay delaying for 30 seconds for up to 20 tests per run or delaying for 60 seconds for up to 10 tests per run. Each run took slightly more than 20 minutes, including 10 minutes of assay time and 10 minutes for reading the test cassettes using an LFA reader. For each cassette assay, an aliquot of 20 L diluted antibody solution was added to the sample port of the test cassette to start the assay. After the antibody sample absorbing for 25 seconds, three drops (75 L) of neutralization assay buffer was added to the sample port using a dropper bottle. The signal intensities of the test zone, the control zone, and a reference negative zone were measured at 10 minutes from the start of the assay using an RDS-2500 LFA reader. If the antibody has no neutralizing activity, the AuNP-RBD conjugate is captured by the immobilized ACE-2 at the test zone and a darker red colored test line is formed. If the antibody has neutralizing activity, then the antibody will bind to the AuNP-RBD and prevent it from being captured by the immobilized ACE-2, resulting in a lighter red or no red colored test line at all. The cIgY control zone serves to monitor that the added liquid to the sample port has properly flowed through the test strip and the biological reagents of the test strip are active. The reference negative zone is the entering area of the test view window of the cassette, that has no printed capture agent, but rather serves as a general flow control.
[0408] Each test will have three intensity valuesfor the control zone, the test zone, and the reference negative zone. For the comparison of the neutralizing activity against SARS-CoV-2 and three variant RBDs, four sets of data were collected for each antibody. Two or three replicates were run for each antibody concentration, except the zero-antibody control with 6-8 replicates per test condition.
Determination of the NC.SUB.50 .for the Neutralization Kinetic Curve
[0409] The NC.sub.50 in g/mL is the concentration of antibody that yields a 50% inhibition or neutralization of the maximal RBD-ACE-2 binding capacity for a given neutralization cassette type. To calculate the NC.sub.50 value per device type for each antibody, the mean signal intensity of the test zone was first calculated from the replicates of the zero-antibody concentration to represent the maximum RBD-ACE-2 binding activity (100% binding capacity or 0% neutralization). When an antibody has neutralizing activity, the binding capacity of AuNP-RBD conjugate to immobilized ACE-2 is reduced. Thus, the decreased portion of the binding activity from the maximum binding activity is the neutralization activity in percentage (% Neutralization).
[0410] The % Neutralization of each individual test was calculated from the signal intensity of the test zone using the conversion formula shown below:
% Neutralization of individual test=[Mean intensity.sub.zero-AbSignal Intensity.sub.individual test)/Mean Intensity.sub.zero-Ab].
[0411] The averaged % Neutralization and the standard deviation were then calculated from the converted % Neutralization replicate values for each test condition. A scatterplot was generated using the antibody concentration as the x-axis and the averaged % Neutralization value as the y-axis. A semi-logarithmic curve fitting was performed and used for the determination of the NC.sub.50 value of each antibody against all RBDs (
Instrumentation and Statistics
[0412] The Nanodrop 2000 spectrophotometer was purchased from Thermo Fisher Scientific (Waltham, MA). The RDS-2500 LFA reader was purchased from Detekt Biomedical LLC (Austin, TX) with the default R/G/B of 0/1/0 settings. Matrix 2360 Programmable Shear was purchased from Kinematic Automation (Sonora, CA). IsoFlow reagent dispenser was purchased from Imagene Technology (Lebanon, NH).
Results
[0413] Antibody Pairing Capability and Epitope Binning Using the SARS-CoV-2 RBD
[0414] Seven anti-SARS-CoV-2 RBD antibodies were studied for their pairing capability and epitope binning using a lateral flow dipstick immunoassay. These antibodies were spotted to lateral flow nitrocellulose membranes as capture agents, and then reacted with SARS-CoV-2 RBD in the presence of one antibody-AuNP conjugate. A non-competing antibody will pair and forms a sandwich immunocomplex with the SARS-CoV-2 RBD, appearing as a dark red colored crescent line or spot on the nitro-cellulose membrane. A competing antibody will not form a sandwich immunocomplex, appearing as a light red colored spot or no spot at all. The sandwich immunoassay principle is shown in panel A of
TABLE-US-00010 TABLE 10 Epitope bin and pairing summary. Epitope Bin A Epitope Bin B Epitope Bin C Detector Ab1 and Ab4 Ab2 and Ab5 Ab3, Ab6 and Ab7 Capture Ab2, Ab3, Ab5, Ab1, Ab3, Ab4, Ab1, Ab2, Ab4 & Ab6 & Ab7 Ab6 & Ab7 Ab5
Comparative Binding Characteristics to Three Variant RBDs Vs. SARS-CoV-2 RBD
[0415] To investigate whether the above antibody pairings could detect the UK, SA, and BR P.1 RBD variants, similar dipstick sandwich immunoassays were performed using the same capture antibody panel along with three representative epitope bin detectors, Ab4-AuNP, Ab5-AuNP, and Ab6-AuNP conjugates, respectively. The initial experiment showed that the Ab7-Ab4 (capture/detector) has a discriminative detection of the four RBDs, with the SARS-CoV-2 and UK RBDs strongly detected and the SA and BR P.1 RBDs weakly detected. All other pairing options tested showed no apparent difference in the detection of these four RBDs.
[0416] To verify these discriminative binding characteristics, dipstick immunoassays were carried out using serially diluted RBD solutions, ranging from 0.001 g/mL to 1 g/mL. Since Ab6 and Ab7 belong to the sample epitope bin, only the Ab4-AuNP and Ab5-AuNP detectors were used in this confirmatory analysis. As shown in
[0417] Interestingly, when the Ab4-AuNP detector was paired with Ab7 as the capture agent, the SARS-CoV-2 and UK RBDs were strongly detected with a detection sensitivity of 0.01 g/mL; however, the SA and BR P.1 RBDs were weakly detected with a detection sensitivity between 0.1-1.0 g/mL. This discriminative binding behavior of the Ab7-Ab4 pair for the detection of SARS-CoV-2 RBD and the three variant RBDs was also observed when Ab7 was paired with Ab1 (another bin A epitope antibody). Given the fact that the Ab5-AuNP pairing with Ab7 capture strongly detected the SA and BR P.1 RBDs and that the Ab4-AuNP pairing with antibodies Ab2, Ab3, Ab5 and Ab6 also strongly detected the SA and BR P.1 RBDs, both AB7 and Ab4 appear to bind to the SA and BR P.1 RBDs well alone. Therefore, the weak binding activity of the Ab7-Ab4 pair (and Ab7-Ab1 pair) to the SA and BR P.1 RBDs, as compared to the SARS-CoV-2 and UK RBDs, indicates that the E484K and K417N/T mutations contained in the SA and BR P.1 RBDs most likely induced conformational changes near or within the epitopes of where these antibodies bind. The conformational change could result in steric interference between Ab7 and bin A epitope antibodies.
Neutralizing Kinetics of Individual Antibody and Combination of Antibodies
[0418] To investigate the neutralization kinetics of these antibodies with the three variant RBDs in comparison to the original SARS-CoV-2 RBD, lateral flow neutralization cassette assays were carried out using rapid neutralizing antibody test devices for the SARS-CoV-2, the UK, the SA, and the BR P.1 RBDs. The lateral flow neutralization test principle is illustrated in
[0419] The neutralization kinetics of each individual antibody against SARS-CoV-2 RBD and three variant RBDs was studied using serially diluted antibody solutions targeting antibody concentrations at 10, 2, 0.5, 0.1 and 0 g/mL suspended in neutralization assay buffer (
TABLE-US-00011 TABLE 11 NC.sub.50 (g/mL) Neutralization Target Ab1 Ab2 Ab1 + Ab2 Ab3 Ab4 Ab5 Ab6 Ab7 SARS-CoV-2 RBD 0.63 1.43 0.50 1.66.sup.m 0.69 3.27.sup.m 0.66 0.34 UK variant RBD 1.08 1.35 0.82 1.51.sup.m 0.95 27.63.sup.w 2.72.sup.m 0.86 South African variant RBD 0.91 1.83.sup.m 0.66 3.19.sup.m 0.70 24.03.sup.w 1.14 ** Brazilian P.1 variant RBD 0.70 1.40 0.46 2.21.sup.m 0.69 44.79.sup.w 1.11 ** NC.sub.50 summary table. Semi-logarithmic curve fitting was used to extrapolate the NC.sub.50 values. For antibody Ab5, the range of 0.5~10 g/mL was used for curve fitting. For other six antibodies and the combined antibodies, the range of 0.1~10 g/mL was used for curve fitting. Strong neutralizing activity: NC.sub.50 < 1.5 g/mL; Moderate neutralizing activity (indicated by a superscript m): 1.5 g/mL NC.sub.50 < 15 g/mL Weak or no neutralizing activity indicated by a superscript w): NC.sub.50 15 g/mL. ** Indicate that the NC.sub.50 value was not calculated due to flat nature of the curve and the very weak neutralizing activity.
[0420] Two antibodies, Ab1 and Ab4 of bin A, maintained strong neutralizing activity against the three variant RBDs with an NC.sub.50 value between 0.69 and 1.08 g/mL, suggesting that these two antibodies target an epitope that is not affected by the mutations (N501Y, E484K and K417N/T) contained in the UK, SA, and BR P.1 variant RBDs. The remaining five monoclonal antibodies either partially or completely lost their neutralizing activity against at least one variant RBD. Ab7 showed strong neutralizing activity against the SARS-CoV-2 and UK RBDs with an NC.sub.50 value of 0.34 and 0.86 g/mL, respectively, but completely lost its neutralizing activity against the SA and BR P.1 RBDs with an NC.sub.50 value at least greater than 45 mg/mL (not able to precisely calculate due the flat curve). This indicates that the Ab7 epitope is not affected by the N501Y mutation, but very likely is affected by the E484K and/or K417N/T mutations. Ab5 had reduced neutralizing activity against SARS-CoV-2 RBD with an NC.sub.50 value of 3.27 g/mL. This reduction in neutralizing activity was even greater for the three variant RBDs with an NC50 value between 24 and 45 mg/mL. This suggests that the Ab5 epitope is in the proximity of the N501Y mutation, which is the only mutation shared among the UK, SA, and BR P.1 RBDs.
[0421] The neutralization activity of an antibody cocktail, combining Ab1 of bin A and Ab2 of bin B (
Analysis and Functional Epitope Arrangement Map
[0422] Based on the binding characteristics and the neutralization activity against SARS-CoV-2 RBD and three variant RBDs, a functional arrangement map of these seven antibodies versus each RBD was generated. Five antibodies (Ab1, Ab2, Ab4, Ab6 and Ab7) showed strong neutralizing activity with an NC.sub.50 value less than 1.5 g/mL and two antibodies (Ab3 and Ab5) showed a moderate neutralizing activity with an NC.sub.50 value between 1.5 and 15 tag/mL. Overall, these seven antibodies paired freely among the three epitope bins and showed moderate to strong neutralizing activities against the SARS-CoV-2 RBD (
[0423] Similar to SARS-CoV-2 RBD, these seven antibodies paired freely among the three epitope bins for sandwich immunodetection of UK RBD (
[0424] The SA and BR P.1 RBDs showed similar binding and neutralizing characteristics to these seven antibodies. Unlike the SARS-CoV-2 and UK RBDs, when Ab7 paired with Ab1 or Ab4 of bin A the detection of SA RBD or BR P.1 RBD in the sandwich assay format is reduced significantly (
Discussion
[0425] SARS-CoV-2 spike protein is a critical component for SARS-CoV-2 to adhere to and enter mammalian cells (Ou et al. Nature Communications 11, 1620 (2020); Shang et al. Proceedings of the National Academy of Sciences 117, 11727-11734 (2020)). The spike protein and its RBD are highly antigenic and have been the primary target of numerous recently developed vaccines and therapeutics (Jackson et al. N Engl J Med 383, 1920-1931 (2020); Mulligan et al. Nature 590, E26-E26 (2021)) (Food and Drug Administration. Letter to Regeneron Pharmaceuticals, Inc. (21 Nov. 2020), Food and Drug Administration. Letter to Eli Lilly and Company. (10 Nov. 2020)). Given that these seven antibodies evaluated in this report were generated from three distinct fusions, the classification of these antibodies into three epitope bins by virtue of their binding and neutralization characteristics suggests that their corresponding target regions on the RBD protein belong to dominant antigenic epitopes, which could elicit protective humoral immune responses to the SARS-CoV-2 infection or vaccination. The two antibodies (Ab1 (clone No. 1035709) and Ab4 (clone No. 1035762) of bin A epitope, which exhibited broad and potent neutralization activity against all four RBDs, offer a useful alternative for the development of therapeutic antibody for emerging virus variants. These studies suggest that therapeutic antibodies targeting the epitopes similar to bin A are likely to provide better protection against the UK, SA, and BR P.1 variants, while therapeutic antibodies targeting the epitopes similar to bin B and bin C are more likely be escaped by these variants. Based on studies showing that three variants (UK, SA and BR P.1 RBD mutants) escaped the therapeutic LY-CoV555 antibody and two variants (SA and BR P.1 RBD mutants) escaped the LY-CoV016 antibody, Starr et al. suggested that both the SA and the BR P.1 variants may also escape the antibody cocktail of LY-CoV555 and LY-CoV016 (Starr et al. bioRxiv, (2021)). Thus, further elucidation of the exact nature of the epitopes recognized by our bin A antibodies (Ab1 and Ab4) could provide a useful framework and insight into the development of therapeutic cocktails against constantly emerging SARS-CoV-2 variants.
[0426] Although numerous factors can affect the binding of SARS-CoV-2 spike protein to the ACE-2 receptor (Chi et al. Science 369, 650-655 (2020)), the virus spike protein RBD plays a central role for this inter-action (Ou et al. Nature Communications 11, 1620 (2020); Shang et al. Proceedings of the National Academy of Sciences 117, 11727-11734 (2020)). The N501Y mutation was first found in the UK variant (Rambaut et al, nCoV-2019 Genomic EpidemiologyVirological, (2020)). Several reports demonstrated that the RBD with N501Y mutation showed a stronger interaction force with ACE-2 receptor, which is associated with increased infectivity of the UK variant (Santos et al. bioRxiv, 2020.2012.2029.424708 (2021); Zhang et al. Jama 325, 1324-1326 (2021); Gu et al. Science 369, 1603-1607 (2020)). In regard to the impact of N501Y mutation on the escape of neutralizing antibody, Supasa et al. (Supasa et al. Cell 184, 2201-2211.e2207 (2021)) reported that the UK variant is not neutralized as easily as SARS-CoV-2 by the convalescent, vaccine sera and some anti-RBD monoclonal antibodies, while Xie et al. (Xie et al. Nature Medicine 27, 620-621 (2021)) observed only a small reduction in neutralization activity against the UK variant by sera elicited by two doses of the Pfizer vaccine BNT162b2. The present results demonstrated that Ab5 had significantly reduced neutralizing activity (NC.sub.50: >15 g/mL) against the UK, SA and BR P.1 variant RBDs, suggesting that the N501Y mutation not only increases ACE-2-RBD interaction (Santos et al. bioRxiv, 2020.2012.2029.424708 (2021)), but also induces the escape phenomenon of neutralizing antibody. Together, this may contribute to the weakened efficacy of vaccines or therapeutic antibodies against these variants.
[0427] The E484K mutation was reported to be associated with escape from neutralizing antibodies which adversely affects the efficacy of spike protein dependent COVID-19 vaccines (Weisblum et al. Elife 9, (2020)). Several studies have demonstrated that spike-targeted vaccines or convalescent plasma from SARS-CoV-2 infected human subjects are less effective in neutralizing the South African variant (Hoffmann et al. bioRxiv, 2021.2002.2011.430787 (2021)). In fact, Moderna Inc recently initiated a clinical trial using a modified version of spike RNA vaccine to counter the South African and perhaps other known variants (NIH clinical trial evaluating Moderna COVID-19 variant vaccine begins, March 2021). The present results that both the SA and BR P.1 variants RBDs completely escaped Ab7 neutralization confirmed that the E484/K417 mutations may be directly involved with the escape mechanism. Further characterization of antibody Ab7 epitope could shed light on better understanding the humoral immune response and the escape mechanism of SARS-CoV-2 and offer a potential rapid test tool for clinical diagnostics and epidemiological studies for SARS-CoV-2 variant infection.
[0428] Antibody Ab7 of bin C pairing with antibody Ab4 (and Ab1) of bin A showed very weak binding activity to the SA and BR P.1 RBDs using the sandwich immunoassay format, however Ab7 pairing with Ab5 and Ab2 of bin B did not show any apparent difference in the binding activities to the four RBDs studied. This discriminative binding behavior suggests that the E484K and/or K417N/T mutations have likely induced conformational changes near the epitopes where these antibodies bind to in the SA and BR P.1 RBDs, thus resulting in steric interference between Ab7 and bin A antibodies, but no apparent steric interference between Ab7 and bin B antibodies. Furthermore, such a mutation-induced conformational change of the spike molecule could contribute to the escape phenomenon of antibody Ab7 by the SA and the BR P.1 variant RBDs. Since the neutralization activities of bin A antibodies (Ab1 and Ab4) are not affected by the three mutations contained in the UK, SA, and BR P.1 variant RBDs, further investigation on the mechanism by which the E484K and/or K417N/T alters the binding and neutralizing activities of these antibodies may help in the identification of a better therapeutic epitope target.
[0429] Lateral flow assays are commonly used for rapid clinical testing, such as COVID-19 serological tests, antigen tests, certain molecular tests, and the neutralizing antibody test (Wang et al. Expert Rev Mol Diagn, 1-8 (2021); Lake et al. medRxiv, 2020.2012.2015.20248264 (2020); Tan et al. Nature Biotechnology 38, 1073-1078 (2020))(United States FDAIn Vitro Diagnostics EUAs, Accessed April, 2021). Indeed, Wang et al. have reported the use of a lateral flow dipstick assay with wild-type and the South African spike S.sub.1 protein for the characterization of the neutralizing activity of post-vaccination plasma samples (Wang et al. Expert Rev Mol Diagn, 1-8 (2021)). The present observation that the NC.sub.50 values of five mouse monoclonal antibodies to the SARS-CoV-2 RBD are between the 0.3 and 1.5 g/mL appears to be consistent with a reported IC50 of 1.402 g/mL for a mouse monoclonal antibody using a dipstick assays (Wang et al. Expert Rev Mol Diagn, 1-8 (2021)).
[0430] This example demonstrates that (1) sandwich-based immunoassays, such as rapid lateral flow assays and dipstick immunoassays, offer an attractive and cost-effective alternative in characterizing the antibody binding properties, epitope binning, and the in vitro neutralizing kinetics of therapeutic antibodies and cocktails; (2) lateral flow based rapid neutralizing antibody tests could potentially be used to assess the neutralizing antibody activities against SARS-CoV-2 RBD and the UK, SA, and BR P.1 variant RBDs of human blood samples; (3) anti-RBD antibodies (Ab1 and Ab4 of epitope Bin A and Ab2 of epitope Bin B) have strong and broad neutralization/inhibition activity to the binding of SARS-CoV-2 RBDs (SARS-CoV-2 RBD, UK variant or B.1.1.7 RBD, SA variant or B.1.351 RBD and BR P.1 variant RBD) to its ACE2 receptor, which could be further characterized and developed for therapeutic use for treatment of severe SARS-CoV-2 infection; and (4) these antibodies could be used for the detection of SARS-CoV-2 spike protein for diagnostic application.
[0431] The information of Example 3 is included in the publication Use of Lateral Flow Immunoassay to Characterize SARS-CoV-2 RBD-Specific Antibodies and Their Ability to React with the UK, SA and BR P.1 Variant RBDs of Tan et al., Diagnostics (Basel); 2021 Jun. 30; 11(7):1190. doi: 10.3390/diagnostics11071190.
Example 4
A Dual Antibody Combination Targeting Opposite Epitopes Near the RBD Interface Broadly and Strongly Inhibits the Binding of SARS-CoV and SARS-CoV-2 Variant RBDs to ACE2
[0432] Amino acid mutations (K417N/T, L452R, T478K, E484K/Q, and N501Y) within the receptor binding domain (RBD) of current dominant SARS-CoV-2 (severe acute respiratory syndrome coronavirus 2) variants play an important role in altering the interaction dynamics between RBD and ACE2 (Angiotensin-converting enzyme 2), thus enhancing viral adhesion and infectivity and causing viral evasion from the post-infection and post-vaccination immune protection. Identification of broadly potent neutralizing antibodies against these dominant variants will help develop effective therapeutic antibodies and better understanding the humoral immune response to SARS-CoV-2 and the variants. By use of the lateral flow surrogate neutralizing antibody assay and the multiplexed antigen array dipstick assay, the neutralizing activity and binding activity of seven anti-RBD monoclonal antibodies against SARS-CoV (severe acute respiratory syndrome associated coronavirus) RBD and ten SARS-CoV-2 and variants RBDs (including alpha, beta, gamma, delta, kappa, and iota) were studied. The neutralization study results demonstrated three main things. First, three antibodies (Ab1, Ab2 and Ab4) had strong broad potent neutralizing activity against all SARS-CoV-2 variant RBDs including the delta variant RBD. Second, two antibodies effectively cross-neutralized the SARs-COV RBD. Third, a dual anti-RBD antibody combination or cocktail targeting the opposite epitope regions near the RBD interface have strong neutralization activity against all variant RBDs studied. The antigenic stability and accessibility upon direct adsorption onto the nitrocellulose membrane by these mAbs and ACE2 were studied. These two antibodies could be further characterized and developed for therapeutic use in treatment of severe SARS-CoV-2 infection. The binding study results demonstrated that three antibodies were not able to detect the variant RBDs that contain E484K/Q, L452R or T478K mutations and two antibodies cross-detected the SARS-CoV RBD. For the adsorbed RBDs, ACE2 strongly bound to the UK, BR P.1 and the Delta variant RBDs and very weakly detected the K417E RBD and the SARS-CoV RBD. From these results, the epitopes on the RBD where these antibodies bind to were predicted and illustrated on a surface presentation of RBD protein. In addition, the use of these antibodies for the detection of SARS-CoV-2 spike antigen for potential diagnostic application and the strategy for variant specific spike antigen detection was explored.
Introduction
[0433] After over 18 months since the World Health Organization (WHO) declared COVID-19 a pandemic on Mar. 11, 2020 (Cucinotta et al. Acta Blamed 91, 157-160 (2020)), the spread of constantly emerging SARS-CoV-2 variants remains a global threat to the worldwide health and economy. As of Oct. 1, 2021, the WHO classify four variants (alpha, beta, gamma, and delta) as VOC (variants of concern), two variants (lambda and mu) as VOI (variants of interest), and eleven variants as VUM (variants under monitoring) (WHO websiteTracking SARS-CoV-2 variants). Each variant carries a specific set of mutations in their respective viral genome, particularly in the spike protein that is key to the virus adhesion to target cells. Since the RBD plays a central role in the binding of the spike protein and the viral particle to the ACE2 receptor, mutations in the RBD that result in changes of the epitope structure or conformations on the RBD, at the location where the neutralizing antibodies bind, will cause subsequent evasion of post-infection and/or post vaccination induced immune protection (Tao et al. Nat Rev Genet, 22, 757-773 (2021); Xie et al. Nat Med 27, 620-621 (2021)).
[0434] The SARS-CoV-2 RBD is a 220-amino acid fragment (Arg319-Phe541) in the S1 subunit of SARS-CoV-2 spike protein. The spike protein has two conformational statesthe pre-fusion state (closed conformation) and the post-fusion state (open conformation) (Cai et al. Science 369, 1586-1592 (2020)), and the RBD portion fluctuates between the up and down conformations (Khare et al. Front Artif Intell 4, 630955 (2021)). The RBD consists of a twisted five-stranded antiparallel sheet core with disulfide bonds and short connecting helices and loops outside as well as a looped-out extension from the 4 and 7 strands of the core (Lan et al. Nature 581, 215-220 (2020)). The looped-out extension, e.g., the receptor binding motif (RBM), forms the boat-shaped bowl structure that interacts with and holds the contacting arm of ACE2. Seventeen amino acid resides of the RBD contact their partners in ACE2. These contacting resides of the RBD include one residue from the non-RBM portion (K417) and 16 residues from the RBM portion (i.e., G446, Y449, Y453, L455, F456, A475, F486, N487, Y489, Q493, G496, Q498, T500, N501, G502, and Y505) (Lan et al. Nature 581, 215-220 (2020)). Five amino acid residues of the RBD are often mutated in currently dominant variants, including two ACE2 contacting residues (K417 and N501) and three residues near the ACE2 contacting residues (L452, T478, E484). These mutations have been shown to increase ACE2-RBD affinity, induce escape from monoclonal antibody or convalescent sera, and cause severe disease (Tao et al. Nat Rev Genet 22, 757-773 (2021); Xie et al. Nat Med 27, 620-621 (2021)).
[0435] Spike protein is highly antigenic glycosylated protein (Henderson et al. bioRxiv, (2020)). Numerous anti-spike antibodies, isolated from the sera post-infection patients, are able to neutralize the SARS-CoV-2 adhesion and reduces viral infection, alleviating the disease status (Huang et al. Antib Ther 3, 285-299 (2020); Zost et al. Nature 584, 443-449 (2020)). Most of these neutralizing antibodies belong to anti-RBD antibodies. Therefore, the identification of potent neutralizing antibodies has significant implication for the development of therapeutic antibodies and better understanding the humoral immune response to SARS-CoV-2 variants. In fact, two of the three FDA approved anti-SARS-CoV-2 monoclonal antibody products with Emergency Use Authorizations (EUAs) designation are anti-RBD antibodies. For example, the bamlanivimab (LY-CoV555) plus etesevimab (LY-CoV016) cocktail targets two different but non-overlapping epitopes on the RBD and the casirivimab (REGN10933) plus imdevimab (REGN10987) cocktail targets two nonoverlapping epitopes on the RBD. The third antibody product, sotrovimab, targets an epitope on the RBD that is conserved between SARS-CoV and SARS-CoV-2 (NIH websiteAnti-SARS-CoV-2 Monoclonal Antibodies).
[0436] Several methods have been used to characterize the neutralizing activity of therapeutic molecules, convalescent and post-vaccination plasma, and therapeutic antibodies, i.e., the authentic virus based plaque reduction neutralization test (PRNT) assay or animal model assay (Jackson et al. N Engl J Med 383, 1920-1931 (2020)), the pseudo virus based neutralizing assay (Ou et al. Nat Commun 11, 1620 (2020)), the viral antigen based total antibody serological assay, and the protein-protein interaction based surrogate neutralizing antibody assay (Embregts et al. One Health 13, 100313 (2021); Fulford et al. medRxiv, 2021.2004.2012.21255368 (2021); Tan et al. Nat Biotechnol 38, 1073-1078 (2020)). The former two methods utilize the spike-protein induced viral adhesion and fusion. The antigen based total antibody test only estimate the humoral serological response, not necessarily representative of the neutralizing activity. The surrogate assay method takes advantage of the interaction of RBD (or spike) and ACE2. Several studies have demonstrated the RBD-ACE2 based surrogate neutralization assay can predict the neutralization capability of convalescent and post-vaccine blood samples, as well as used for determination of neutralization activity of monoclonal antibodies (Embregts et al. One Health 13, 100313 (2021); Fulford et al. medRxiv, 2021.2004.2012.21255368 (2021); Tan et al. Nat Biotechnol 38, 1073-1078 (2020)). For example, an RBD-ACE2 interaction based surrogate virus neutralization gave similar or improved accuracy for qualitative delineation of the SARS-CoV-2 neutralizing activity between positive and negative samples, when compared directly with eight SARS-CoV-2 IgG serology and two live-cell neutralization tests (Tan et al. Nat Biotechnol 38, 1073-1078 (2020); Johnson et al. J Clin Virol 130, 104572 (2020); Taylor et al. J Clin Microbiol 59, (2021)). In fact, FDA has authorized one protein based surrogate assays for use (FDA lettercPass SARS-CoV-2 Neutralization Antibody Detection Kit package), to qualitatively test the neutralizing antibody activity to SARS-CoV-2 in human serum and plasma, in which a PRNT assay utilizing the SARS-CoV-2 virus (WA01/2020 isolate) was used a reference. Thus, in this analysis, the term neutralizing activity or blocking activity or inhibitory activity were interchangeably used.
[0437] In Example 3, lateral flow immunoassays were used for the characterization of anti-RBD monoclonal antibodies, including antibody pairing capability, epitope binning, and their neutralizing activity against SARS-CoV-2 and three variant RBDs (UK, SA, and BR.P.1). To address the current dominant delta variant and other variants, these on their neutralizing activity studies were expanded against six additional SARS-CoV-2 RBDs (P2, kappa, CA, delta variants; and K417E and T478K RBDs) and SARS-CoV RBD, using the rapid protein-protein interaction based surrogate neutralization assay. By use of these additional RBDs, covering 5 mutations commonly seen among current dominant SARS-CoV-2 variants, the epitope regions of the RBD where these antibodies bind to were predicted (estimated). In addition, it was shown that upon adsorption of these variant RBDs onto nitrocellulose membrane, they showed drastic difference in their detectability by these anti-RBD antibodies and ACE2. In addition, it was shown that a combination of two antibodies targeting opposite epitope regions near the RBD contact surface area showed broad and potent neutralizing activity against all the SARS-CoV-2 RBDs including the delta variant RBD and the SARS-CoV RBD.
Materials and Methods
Anti-SARS-COV-2 Antibodies
[0438] Seven anti-SARS-CoV-2 spike RBD murine monoclonal antibodies (Ab1-Ab7), as described in more detail in Examples 1 and 2 were selected for this study (see also Tan et al. Diagnostics (Basel) 11, 1190 (2021)). All antibodies used were produced by Bio-Techne Corporation (Minneapolis, MN). These antibodies include Ab1 (clone No. 1035709), Ab2 (clone No. 1035740), Ab3 (clone No. 1035753) and Ab4 (clone No. 1035762), Ab5 (clone No. 1035419), Ab6 (clone No. 1035224), and Ab7 (clone No. 1035240).
[0439] Additionally, one anti-SARS-CoV-2 spike S2 subunit antibody, MAB10557 (clone No. 1034617), generated using recombinant SARS-CoV2 Spike S2 Subunit (Met697-Pro1213) as immunogen, was used a negative control. One anti-nucleocapsid antibody (AnAb4, clone No. 1035129) was generated using recombinant SARS-CoV-2 nucleocapsid protein.
Recombinant Receptor Binding Domain Proteins
[0440] All recombinant RBD proteins were generated by Bio-Techne Corporation (Minneapolis, MN, USA), using the HEK293 expression system as described in more detail in Example 3 (see also Tan et al. Diagnostics (Basel) 11, 1190 (2021)). In addition to these four recombinant SARS-CoV-2 RBDs (CoV-2 RBD and SA, UK, BR P.1 RBDs), six additional SARS-CoV-2 RBDs and the SARS-CoV RBD were tested in this study. These proteins include the BR P.2 variant RBD (R319-F541 with E484K), the K417E RBD (R319-F541 with K417E), the L452R RBD (R319-F541 with L452R), the IN v1 variant RBD (R319-F541 with L452R, E484Q), the IN v2 variant RBD (R319-F541 with L452R, T478K), and the T478K RBD (R319-F541 with T478K).
[0441] The SARS-CoV spike RBD (R306-F527, with a C-terminal 6-His tag; based on accession #NP_828851.1), was generated using the Chinese hamster ovary (CHO) cell expression system.
Other Materials
[0442] Triton X-100, 30% bovine serum albumin (BSA) solution, 30% Brij-35 solution, 10 phosphate buffered saline (PBS), 10 casein solution in PBS, and other chemicals were purchased from Millipore-Sigma (Burlington, MA). Casein solution (1%, w/v) in a Tris buffer with a pH of 7.4 was purchased from Thermo Fisher Scientific (Waltham, MA). Recombinant human ACE2 protein, goat polyclonal anti-chicken IgY antibody, biotinylated ACE2, and chicken IgY protein (cIgY) were acquired from Bio-Techne Corporation (Minneapolis, MN). Goat anti-mIgG (GAM) antibody conjugated 40 nm gold nanoparticle (GAM-AuNP) and streptavidin conjugated 40 nm AuNP (SA-AuNP) were purchased from Arista Biological (Allentown, PA). Anti-nucleocapsid antibody M9547 was purchased from Meridian Life Science (Memphis, TN).
Preparation of Lateral Flow NAb Test Cassette and Assay Procedure for Neutralization Kinetics
[0443] Lateral flow neutralization test devices were manufactured according to the procedures described in more detail in Example 3 (see also Tan et al. Diagnostics (Basel) 11, 1190 (2021)). Briefly, recombinant human ACE2 was striped in the test zone and goat polyclonal anti-chicken IgY antibody was striped in the control zone as the capture agent on the nitrocellulose membrane card. Recombinant RBD and cIgY were conjugated to the 40 nm gold nanoparticles as the detectors for the test zone and the control zone, respectively. The AuNP-RBD and AuNP-cIgY conjugates were combined in a drying down buffer containing salt, stabilizer and AuNP releasing agents and sprayed onto conjugate pad strips. The antibody stripped card was assembled with a conjugate pad, sample pad and a wicking pad. The card assembly was then slitted into test strip that was then assembled into a plastic cassette and sealed in a foil pouch with desiccant, stored at ambient room temperature. As shown in
[0444] The strip design and neutralizing antibody test device assay principle is given in
[0445] For each data point a minimum of two replicates were performed. For the zero-analyte condition per test device type, a minimum of six replicates were performed to set up the baseline at 100% RBD-ACE2 binding activity and 0% neutralizing activity, which is used for the determination of the NC.sub.50 value for each antibody or antibody combination vs each variant RBD. The NC.sub.50 in g/mL is the concentration of antibody that yields a 50% inhibition or neutralization of the maximal RBD-ACE2 binding capacity for a given neutralization cassette type.
Lateral Flow Dipstick Assay Using Spotted RBD Protein Panel
[0446] Preparation of Lateral Flow Dipsticks with the RBD Protein Panel
[0447] The lateral flow dipstick was prepared as described in more detail in Example 3 (see also Tan et al. Diagnostics (Basel) 11, 1190 (2021)). Each 60-mm wide dipstick consisted of a polystyrene card backing with a 25-mm long nitrocellulose membrane and attached a 17-mm or 20-mm long absorbent pad. The dipsticks were spotted with a thirteen-spot protein array: ten spots for the SARS-CoV-2 and variant RBDs, one spot for the SARS-CoV RBD, one spot for the positive control (i.e, anti-S2 antibody, used as mIgG), and one spot for the negative control (i.e., BSA). Each protein was diluted to 0.5 mg/mL in 1PBS with a pH of 7.4 and manually pipetted onto the nitrocellulose membrane at 0.8 L per spot. The coated dipsticks were dried in a 37 C. oven with circulating air for a minimum of 30 min prior to use; longer term storage occurred in a plastic bag with desiccant.
Lateral Flow Dipstick Assay Procedure for Antibody Reactivity
[0448] To study the binding of anti-RBD antibodies to the immobilized RBD antigens, a 60-mm wide dipstick with the spotted antigen panel was placed in a reservoir. Three assay solutions were sequentially added. First, an aliquot of 300 L of 10 g/mL primary antibody solution was added into the reservoir to start the assay. After the primary antibody solution is completed in 1012 minutes. An aliquot of 300 L secondary antibody-AuNP conjugate solution was added and allow to run another 1012 minutes. In the end, 300 L assay run buffer was added to rinse off the non-bound GAM-AuNP conjugate. All detection solutions are prepared in the Brij-35 assay buffer. The primary antibody solution contains 3 g of anti-RBD antibody or control antibody (i.e., anti-S2 antibody). The secondary antibody solution contains 1:10 (1 part/9 parts, v/v) diluted GAM-AuNP conjugate in the same buffer. The Brij-35 assay run buffer is the same buffer as well. After all assay solutions were completed, the dipstick was examined, and an image was taken using an iPhone. The Brij-35 assay buffer consists of 1PBS with a pH of 7.4, containing 1% (w/v) BSA, (v/v) TX-100, 0.3% (v/v) Brij-35, 0.3% (w/v) casein, and 0.05% (w/v) sodium azide.
[0449] The assayed dipsticks were photographed within 60 minutes using an iPhone camera after the assay was completed to document assay results.
Lateral Flow Dipstick Assay Procedure for ACE2 Reactivity
[0450] The binding activity of ACE2 to the immobilized RBD antigens was tested similarly as for the antibody binding. Each 60-mm wide dipstick with the RBD panel was sequentially reacted with three detection solutions. The three solutions are 300 L biotinylated ACE2 solution (i.e, 10, 3.3, or 1 g/mL), 300 L 1:10 (1 part/9 parts, v/v) diluted SA-AuNP conjugate solution and 300 L assay run buffer. The neutralization assay buffer was used for the dilutions and the assay run buffer.
[0451] The assayed dipsticks were photographed within 60 minutes using an iPhone camera after the assay was completed to document the assay results.
Evaluation of an S/N Dual Antigen Lateral Flow Assay for SARS-CoV-2 Detection
[0452] The S/N (spike and nucleocapsid proteins) dual antigen test cassettes were prepared similarly as the neutralizing antibody test cassettes, with the exceptions below. Anti-RBD monoclonal antibody (Ab2, clone No. 1035224) and anti-nucleocapsid (NP) monoclonal antibody (AnAb4, clone No. 1035129) were used as the capture agents for RBD and NP, respectively. These two antibodies were stripped onto the nitrocellulose membrane at 0.5 mg/mL in PBS and at a flow rate of 0.06 L/mm using an ISOFlow dispenser, Anti-RBD monoclonal antibody Ab6 and anti-NP monoclonal antibody M9547 were adsorbed to 40-nm gold nanoparticles and used as the detectors for RBD and NP, respectively. The test strip assembly consists of an antibody stripped NCM with plastic banking, a sample pad, a conjugate pad, and a wick pad, was cut into 4.2 mm wide test strip and assembled into plastic cassette (Kinbio) and used in the same day or stored with descant in foil pouch.
[0453] For the assay, the RBD antigen was diluted into a PBS containing 3% BSA (w/v), 0.5% Tween-20 (v/v), 1 casein (Sigma brand), and 0.05% NaN.sub.3, targeting concentrations of 1000, 100, 10, 1, 0.1 ng/mL and zero analyte condition. An aliquot of 75 L samples was added into the sample port and the assay signal was read at 10 minutes after the sample was added using an RDS-2500 reader and the assayed cassette image was taken using an iPhone camera within 60 min after the assay was completed.
Instrumentation and Statistics
[0454] The Nanodrop 2000 spectrophotometer was purchased from Thermo Fisher Scientific (Waltham, MA, USA). The RDS-2500 lateral flow reader was purchased from Detekt Biomedical LLC (Austin, TX, USA).
Results
[0455] SARS-CoV-2 Variants and Key Mutations in their RBD
[0456] This example identifies potent neutralizing antibodies against current dominant SARS-CoV-2 variants and prediction of the epitope region on the RBD where these anti-RBD antibodies bind to. Current dominant SARS-CoV-2 variants contain five common amino acid mutations in their RBDs, i.e., K417N/T, L452R, T478K, E484K/Q, and N510Y. To characterize the impact of these single mutations on the neutralizing activity of these anti-RBD antibodies, a total of ten SARS-CoV-2 and variant RBDs were used. These include the epsilon variant RBD (B.1.427/9, with L452R only), the zeta variant RBD (P.2, with E484K only), the alpha variant RBD (B.1.1.7, with N501Y only), K417E RBD and T478K RBD. These RBDs with single amino acid mutation are important in the predication of the epitopes on the RBD where these antibodies bind to. SARS-CoV-2 variant RBDs with double or triple mutations include the beta variant RBD (B.1.351, with K417N, E484K, and N501Y), the gamma variant RBD (P.1, with K417T, E484K, and N501Y), the delta variant RBD (B.1.617.2, with L452R and T478K), the kappa variant (B1.617.1, with L452R and E484Q). SARS-CoV RBD was included to investigate if any of our seven mAbs bind to both SARS-CoV2 and SARS-CoV RBD as evidence of a conserved epitope between the two.
Neutralizing Activities of Anti-RBD Antibodies Against SARS-CoV and SARS-CoV-2 RBDs
[0457] To investigate the neutralizing or inhibitory activity of these anti-RBD antibodies to the binding of RBDs of SARS-CoV, SARS-CoV-2, and current dominant variant strains to ACE2, the neutralization kinetics of each antibody and a dual antibody combination against these RBDs was studied using serially diluted antibody solutions targeting antibody concentrations at 10, 2, 0.5, 0.1, and 0 g/mL suspended in a neutralization assay buffer (
TABLE-US-00012 TABLE 12 IC.sub.50 or NC.sub.50 (g/mL) Mutations in RBD Ab1 RBD name M-1 M-2 M-3 M-4 M-5 Ab1 Ab4 Ab2 Ab5 Ab3 Ab6 Ab7 &Ab2 SARS- * SARS-CoV-2 wildtype 0.63 0.69 1.43 3.27 1.66 0.66 0.34 0.50 CoV-2 RBD RBD * UK (B.1.1.7) Alpha N501Y 1.08 0.95 1.35 27.63 1.51 2.72 0.86 0.82 variants RBD * SA (B.1.351) Beta K417N E484K .sup.b N501Y 0.91 0.70 1.83 24.03 3.19 1.14 ** .sup.b 0.66 RBD * P.1 (B.1.1.28.1) Gamma K417T E484K .sup.b N501Y 0.70 0.69 1.40 44.79 2,21 1.11 ** .sup.b 0.46 RBD P.2 (B.1.1.28.2) Zeta/Eta E484K .sup.b 0.61 0.85 1.48 6.48 3.22 0.54 ** .sup.b 0.39 RBD B.1.617.1 RBD Kappa L452R .sup.c E484K .sup.b 0.66 0.77 1.79 16.54 .sup.c ** .sup.c ** .sup.c ** .sup.bc 0.35 K417E RBD n/a K417E 0.38 0.49 1.09 1.51 0.89 0.38 0,33 0.38 L452R RBD Epsilon L452R .sup.c 0.92 0.73 1.17 20.58 .sup.c ** .sup.c ** .sup.c ** .sup.c 0.49 B.1.617.2 RBD Delta L452R .sup.c T478K .sup.d 2.33 .sup.d 2.57 .sup.d 1.61 33.25 .sup.c ** .sup.c ** .sup.c ** .sup.c 0.68 T478K RBD n/a T478K .sup.d 1.35 3.77 .sup.d 1.21 9.01 2.29 0.76 0.61 0.60 SARS-CoV RBD willtype ** ** 0.84 2.86 ** ** ** 0.93 Antibody neutralization NC.sub.50 summary table. The data for CoV-2, UK, SA, and BR P.1 RBDs are from Example 3 (see also Tan et al. Diagnostics (Basel) 11, 1190 (2021)) and all other data were newly generated. Semi-logarithmic curve fitting was used to extrapolate the NC.sub.50 values. For antibodies Ab1, Ab6, Ab7, and the Ab1&Ab2 antibody cocktail, the range of 0.1~2 g/mL was used for curve fitting. For antibodies Ab2, Ab3 and Ab5, the range of 0.5~10 g/mL was used for curve fitting. For antibody Ab4, the range of 0.1~10 g/mL was used. Neutralizing activity level designation: Strong neutralizing activity: NC50 < 1.5 g/mL. Moderate neutralizing activity: 1.5 g/mL NC.sub.50 < 15 g/mL Weak or no neutralizing activity: NC.sub.50 15 g/mL. * Indicates that the data of these four RBDs were from Example 3 and included here for side-by-side comparison purposes. ** indicates that the NC.sub.50 value was not calculated due to the flat nature of the curve and the very weak neutralizing activity. The predicated correlation pattern between the mutations and the NC.sub.50 values are designated with a superscripted a, b, c, and d for mutations N501Y, E484K/Q, L452R and T478K, respectively.
[0458] For SARS-CoV-2 RBD, five antibodies (Ab1, Ab2, Ab4, Ab6, and Ab7) showed strong neutralizing activity, with NCH) values between 0.34 and 1.43 g/mL, and two antibodies (Ab3 and Ab5) showed a moderate neutralizing activity with an NC.sub.50 value of 1.66 and 3.27 g/mL, respectively, indicating that the epitopes of these seven antibodies were all near or in the RBD interface zone.
[0459] Ab1 and Ab4 had similar neutralization activity profile. These two antibodies did not neutralize the binding of ACE2 to SARS-CoV RBD, moderately inhibited the binding of ACE2 to two T478-bearing variants RBDs (T478K RBD and Delta RBD with L452R and T478K), strongly neutralized the binding of ACE2 to SARS-CoV-2 RBD and seven variant RBDs. These results suggest that the epitope(s) of Ab1 and Ab4 is in a region near the T478 residue but not much affected by the T478K mutation and away from other four commonly mutated residues (K417, L452, E484, and N501).
[0460] Ab2 and Ab5 shared similar neutralization activity profile. These two antibodies strongly or moderately neutralized the binding of ACE2 to SARS-CoV RBD, with NC.sub.50 of 0.84 and 2.86 g/m, respectively. Ab2 strongly or moderately neutralized the binding of ACE2 to all SARS-CoV-2 variant RBDs, with NC.sub.50 values between 1.09 and 1.83 g/mL antibody. In contrast, Ab5 moderately neutralized the binding of ACE2 to four variant RBD (SARS-CoV-2 RBD, E484K RBD, K417E RBD, and T478K RBD), with NC.sub.50 values between 1.51. and 9.01 g/mL antibody, and weakly neutralized six variant RBDs that contain either the N501Y or the L452R mutation), with NC.sub.50 values between 16.54 and 44.79 g/mL. The loss of neutralizing activity of Ab5 with the variant RBDs containing N501Y or L452R, suggesting that the N501 and L452 residues are likely part of the of the Ab5 epitope. Given the facts that (a) Ab2 and Ab5 neutralize the binding of ACE2 SARS-CoV RBD, and (b) A2 and Ab5 compete in sandwich assay format for the detection of SARS-CoV-2 RBD (Example 3; Tan et al. Diagnostics (Basel) 11, 1190 (2021)), the Ab2 epitope partially overlaps with the Ab5 epitope.
[0461] Ab3 and Ab6 had similar neutralization activity profile. These two antibodies both inhibit the binding of ACE2 to SARS-CoV RBD. Ab3 and Ab6 did not inhibit the binding of ACE2 to variant RBDs (L452R, Kappa and Delta RBDs) that contain the L452R mutation. Ab3 showed strong neutralization against K417E RBD, with an NC.sub.50 value of 0.89 g/mL and moderately inhibited six remaining RBDs with NC.sub.50 values between 1.51. and 3.22 g/mL. In contrast, Ab6 strongly neutralized four RBDs (CoV-2 RBD, E484K RBD, K417E RBD and T478K RBD), with NC.sub.50 values between 0.38 and 0.66 g/mL and strongly neutralized other three RBDs (UK, SA, and BR P.1 RBDs) that contain the N510Y mutation, with NC.sub.50 values between 1.11 and 2.72 g/mL. These results suggest that Ab6 epitope is in the region near or at the L452 and N501 residues. As Ab3 and Ab6 antibodies compete when used as a pair for the detection of SARS-CoV-2 RBD (Example 3 and Tan et al., Diagnostics (Basel) 11, 1190 (2021)) and that Ab3 had slightly weaker neutralizing activity overall than that of Ab6, the Ab3 epitope overlaps the Ab6 epitope, but the Ab3 epitope is likely more outward of the RBD interface than the Ab6 epitope.
[0462] Ab7 did not inhibit the binding of ACE2 to SARS-CoV RBD, strongly inhibited the binding of ACE2 to four SARS-CoV-2 RBDs (wild-type, UK, K417E, and T478K), and failed to inhibit the binding of ACE2 to six other SARS-CoV-2 RBDs that contained E494K/Q and/or L452R mutations. These results suggest that the Ab7 epitope is located near the E484 and L452 amino acid residues.
Antibody Reactivity and ACE2 Binding to the Adsorbed RBD Proteins on the Nitrocellulose Membrane.
[0463] To investigate if the adsorbed variants RBDs differ in their reactivity with these seven anti-RBD antibodies and the ACE2, the RBDs were directly adsorbed onto the NCM at pH 7.4. Specifically, each RBD protein was diluted to a concentration of 0.5 mg/mL concentration in 1PBS, spotted onto the FF120 lateral flow nitrocellulose membrane and dried. The adsorbed RBD protein arrays were reacted with anti-RBD monoclonal antibody and then detected by GAM-AuNP conjugate. The results are given in
[0464] RBD binds to ACE2 through their contact interface. Mutations in the RBD, especially the more accessible RBM, may alter the protein-surface interaction and the accessibility. To assess the reactivity of adsorbed RBDS by ACE2, the dipstick RBD protein array was reacted with biotinylated ACE2, then detected with SA-AuNP. If the ACE2 interface of the adsorbed RBD proteins is functional and accessible by biotinylated ACE2, then upon detection by SA-AuNP, a complex of RBD-ACE2-bt-SA-AuNP complex will be formed, forming a red-colored circular spot. As shown in
Surface Presentation of SARS-CoV-2 RBD and the Predicted Epitopes on the RBD Surface
[0465] In order to visualize and predict the epitopes of these seven antibodies, surface diagrams were created for the ACE2 contacting area and two side surfaces of the SARS-CoV-2 RBD. The surface diagrams, key residues and the predicted epitope areas are given in
[0466] In summary, the five common mutations (K417N/T/E, L452R, T478K, E484K/Q, and N501Y) of recent SARS-CoV-2 variants differ in their impact on the neutralization and binding activities of the seven antibodies to the SARS-CoV-2 variant RBDs studied. The K417N/TIE mutation has no impact on the neutralization and binding activities of seven antibodies. The L452R mutation abolished the neutralization and binding activities of antibodies (Ab3, Ab6, and Ab7) and largely reduced the neutralizing activity of Ab5. The T478K mutation slightly reduced the neutralization and binding activities of Ab1 and Ab4. The E494K/Q abolished the neutralization and binding activities of Ab7. The N501Y mutation largely reduced the neutralization and binding activities of Ab5 and slightly reduced the neutralization and binding activities of Ab6.
Diagnostic Application of these Anti-RBD Monoclonal Antibodies and Construction of a Rapid S/N Dual Antigen Assay for SARS-CoV-2 Diagnostics
[0467] To evaluate if these antibodies can be used in sandwich immunoassay for the detection of SARS-CoV-2 spike or RBD protein and nucleocapsid protein, a S/N (spike and nucleocapsid) dual antigen test strip was prepared. The anti-RBD Ab2 was used as the capture and the anti-RBD antibody Ab6 was conjugated to 40-nm AuNP as the detector. The use of the Ab2-Ab6 antibody pair was based on initial antibody pairing studies. At the time when the strip was prepared, knowledge on the neutralization/inhibition of these antibodies on the binding of 10 SARS-CoV-2 variant RBD to ACE2 was not yet available. The RBD was diluted in a PBS buffer containing BSA, Tween-20 and casein, targeting concentrations of 1000, 100, 10, 1, 0.1 ng/mL and zero analyte condition. An aliquot of 75 L of each diluted sample was used for each assay, with no additional assay chase buffer added. As shown in
Discussion
[0468] According to the CDC's national SARS-CoV-2 genomic surveillance program report, since July of 2021 (CDC genomic data tracking variant) the Delta variant has become the super dominant variant circulating in the United States, constituting over 98% of all the weekly collected genomic sequences data. Several studies have reported that the Delta variant had reduced sensitivity to antibody neutralization and the post-infection and post-vaccination human plasma samples (Planas et al. Nature 596, 276-280 (2021)). Identification of broad potent antibodies that can neutralize the delta and other variants of SARS-CoV-2 has been one of recent research focuses. Wang et al. isolated two ultra-potent antibodies against 23 variants (Wang et al. Science 373, (2021)). Tortorici et al. described a human monoclonal antibody designated S2X259 (Tortorici et al. Science 370, 950-957 (2020)), which recognizes a highly conserved cryptic epitope of RBD and broadly neutralizes spike-mediated cell entry of SARS-CoV-2. The epitope A antibodies (Ab1 and Ab4) were found to resist the impact of the five common mutations and neutralize all 10 RBD variants investigated in this example. These two antibodies appear to share similar binding and neutralization behavior as the reported ultra-potent antibody (B1-182.1) (Wang et al. Science 373, (2021)). Moreover, the epitopes of our Ab1/Ab4 and the B1-182.1 antibody are likely located at the RBD interface contact region 1. Indeed, the FDA approved dual antibody cocktail targeting non-overlapping epitopes on the RBD has been confirmed to provide broader and more potent protection than another approved dual antibody cocktail that targets partially overlapping epitopes (Starr et al., Cell Reports Medicine. 2 (4): 100255.doi:10.1016/j.xcrm.2021.100255. PMC 8020059. PMID 33842902; Starr et al. Science 371, 850-854 (2021)).
[0469] The RBD interact with ACE2 through the RBM that forms a boat shaped bowl surface.
[0470] Most neutralizing antibodies interfere the RBD-ACE2 interaction by binding to the RBD and especially the area close to the RBD contact area. The ACE2 contacting area of the RBM is further described as three contact regions: the outer extended knob (CR1), the middle-concaved base (CR3, and the outer expanded tip (CR2) (Deshpande et al. Front Immunol 12, 691715 (2021); Pegu et al. Science 373, 1372-1377 (2021); Wang et al. Proc Natl Acad Sci USA 117, 13967-13974 (2020); Yang et al. arXiv preprint arXiv:2103.06578, (2021)). One FDA approved therapeutic antibody cocktail target non-overlapping epitopes and the 2.sup.nd cocktail targets partially overlapped epitopes on RBD. The epitope A antibodies (Ab1 and Ab4) bind to the contact region 1 and the epitope B antibodies (Ab2 and Ab5) bind to the contact region 2 of the RBD interface area. Based on the neutralization study and the binding study, three anti-RBD antibodies were identified (i.e., Ab1 and Ab4 of epitope A and Ab2 of epitope B) that have strong or moderate neutralizing activity gains all SARS-CoV-2 variant RBDs, included in this study. As the epitope A is near the contact region 1 and the epitope B is near the contact region 2 and that both regions are on the outer surface with better accessibility, a dual antibody cocktail was designed by combining Ab1 and Ab2, targeting the opposite epitope regions near the RBD interface. This example demonstrated this dual antibody combo strongly neutralized the ACE2 binding to all SARS-CoV-1 variant RBDs studied, including alpha, beta, gamma, delta, kappa, and iota variants. In addition, this dual antibody combo also had strong neutralizing activity against SARS-CoV RBD. It reasonable to predict that the Ab4/Ab2 combination may achieve similar effect. These two antibodies maybe further optimized for development of an effective anti-COVID therapeutic antibody recipe. In fact, Nie et al. even used a combination of three epitope-distinct human antibodies from RenMab mice to effectively neutralize SARS-CoV-2 and cooperatively minimize the escape of mutants (Nie et al. Cell Discov 7, 53 (2021)).
[0471] In this Example, a spike and nucleocapsid dual antigen assay was constructed using anti-RBD antibody Ab2 (clone No. 1035740) and anti-nucleocapsid antibody (AnAb4 clone No. 1035129) as captures and anti-RBD antibody Ab6 (clone No. 1035224) and anti-nucleocapsid antibody M47 as detectors. The use of the recombinant SARS-CoV-2 RBD antigen demonstrated that this 10-min rapid S/N dual antigen test has a detection sensitivity of 0.1-1 ng/ml RBDs in buffer system. These studies indicate that these antibodies can be used for diagnostic sandwich immunoassay for the detection of SARS-CoV-2 spike protein. It is possible that a spike/nucleocapsid dual antigen assay can enhance the detection sensitivity of SARS-CoV-2.
[0472] Currently molecular and antigen tests are used to demonstrate the presence of viral particle in a patient specimen for SARS-CoV-2 infection. Molecular test is beyond the discussion of this study. Current SARS-CoV-2 rapid antigen tests mostly detect the viral nucleocapsid antigen. In fact, out of 36 FDA-approved EUA antigens assays, except one test for detection of the spike antigen and another test for the detection of spike and nucleocapsid antigens, all other tests detect the presence of nucleocapsid protein (FDAIn Vitro Diagnostics EUAsAntigen Diagnostic Tests for SARS-CoV-2). However, the nucleocapsid assay cannot differentiate among the SARS-CoV-2 variants. In contrast, proper selection of anti-spike (RBD) antibody pair may provide a rapid tool to detect certain specific SARS-CoV-2 variant. This example demonstrates that pairing antibody Ab1 or Ab4 with antibody Ab2 will enable a test for broad detection of all variant spike proteins. Secondly, pairing Ab1 or Ab2 or Ab4 with an anti-S2 antibody will also help for the detection of all variants. The Ab2-Ab6 antibody pair used in our proof-of-concept study was initially selected without the knowledge of their reactivities with SARS-CoV-2 variant RBDs.
[0473] The multiplex RBD protein array used for the antibody and ACE2 binding studies may be further developed into a lateral flow based rapid multiplexed test for IgG, IgM, or IgG specific serological response to variant RBDs and a lateral flow based rapid multiplexed neutralizing antibody screening test based on the interaction of RBD and ACE2.
[0474] This example demonstrated (1) that a dual antibody cocktail (Ab1 and Ab2) broadly and strongly inhibits the binding of ten SARS-CoV-2 variant RBDs and SARS-CoV-2 RBD to ACE2. These two antibodies could be further developed for therapeutic use in treatment of COVID-19 disease; (2) these anti-RBD monoclonal antibodies can be used for preparation of diagnostics test kits for SARS-CoV-2 diagnostic use. Upon further characterization and development, these antibodies may be used for SARS-CoV-2 variant specific screening test; (3) a multiplex RBD panel dipstick assay can be used for variant-specific serological assays and variant specific neutralizing antibody assay.
Example 5
Select Anti-Severe Acute Respiratory Syndrome Coronavirus Antibodies Block SARS-COV-2 Variant Protein Binding to ACE-2
[0475] With the global expansion of the COVID-19 pandemic, amino acid mutations within the spike and receptor binding domains of the SARS-CoV2 virus have given rise to local variants of the virus such as the Alpha, Beta, Gamma and Delta variants (Lauring and Malani. JAMA 326(9), 880 (2021)). The emergence of these variants of concern (Cherian et al. bioRxiv 2021.04.22.440932 (2021)) has had the medical and scientific communities racing to discover antibodies that recognize multiple SARS-CoV2 variants which can be used to diagnosis clinical disease and be used a post-exposure prophylactic therapies to combat an ever growing global health and humanitarian crisis. A select group of SARS-CoV2 viral antibodies that prevent the binding of SARS-CoV2 S.sub.1 protein, SARS-CoV S1 protein and SARS-CoV S.sub.1 RBD protein to human ACE-2, the human receptor for the SARS-CoV2 virus has been described here. Interestingly, when recombinant SARS-CoV2 S1 and RBD proteins that were derived from the original Wuhan virus were used, all 15 of the SARS-CoV2 viral antibodies described blocked the binding of SARS-CoV2 S.sub.1 RBD to ACE-2,
[0476] To further identify potential diagnostic and therapeutic antibodies that recognize multiple variants of the SARS-CoV2 virus, the ability of the antibodies to block SARS-CoV2:human ACE-2 binding was characterized using recombinant SARS-CoV2 51 and RBD proteins derived from five additional SARS-CoV2 variants: the SARS-CoV2 Alpha B.1.1.7 variant (UK/London variant; Davies et al. Science 372 (2021)), SARS-CoV2 N439 variant (Scotland variant; Thomson et al. Cell 184(5), 1171-1187 (2021)), the D614G variant (an offshoot of Scotland and London variants; Volz, et al. Cell 184, 64-75 (2021)), the Gamma P.1 variant (Brazilian variant; Hoffmann et al. Cell 184(9), 2384-2393 (2021)), and the Delta B.1.617.2 variant (Indian variant; Cherian et al. bioRxiv 2021.04.22.440932 (2021)). All 15 antibodies clones blocked the binding of SARS-CoV2 S1 RBD D614G to ACE-2, albeit to varying degrees. Notably, of the 15 SARS-CoV2 antibodies described, two of the 15 clones tested, clones 1035716 and 1035740, were found to have broad cross reactivity, and were able to block the binding of all 5 variant viral proteins to ACE-2.
Materials and Methods:
[0477] The blocking assays described herein used hACE-2 HEK/eGFP Tfx for the cell model; rSARS-CoV-2 C-His tagged variants (rSARS2 RBD aa319-541, N439K; rSARS2-S1 aa16-681, D614G; rSARS2-B.1.1.7 S aa16-1211 2aa mut.; rSARS2-B.1.1.7 S aa16-1211 4aa mut.; P.1 RBD aa319-541 3aa mut.; rSARS2-B.1.617.2 RBD aa319-541 L452R T478K; rSARS2-B.1.617.2 S aa16-1211 10+4aa mut.) as a protein; and an antibody including, for example, the antibodies produced by the anti-SARS-CoV-2 antibody panels 10352XX, 10354XX, and 10357XX Monoclonal antibodies were added at a concentration in a range of 10 ng/mL to 50 ng/mL. Proteins were added at a concentration in a range of 50 ng/mL to 500 ng/mL.
[0478] Viral proteins/antibodies were co-incubated to form a complex and then added to hACE-2 HEK/eGFP Tfx. Anti-His APC was added to the antibody/protein/Tfx samples for detection. The samples were then washed, a live/dead stain was added to exclude dead cells, and analysis was carried out on a BD LSRFortessa.
[0479] Negative controls included hACE-2 HEK/eGFP Tfx alone; anti-His APC+(hACE-2 HEK/eGFP Tfx (
[0480] Each of the variant His-tagged proteins+anti-His APC served as a protein binding control for rSARS-CoV-2.
[0481] Anti-viral antibodies+viral proteins+(hACE-2 HEK/eGFP Tfx)+(anti-His APC) were used to assess viral antibody blocking of hACE-2 vs. SARS-CoV-2 proteins (
[0482]
[0483]
[0484]
[0485]
[0486]
[0487]
[0488]
[0489] A summary of anti-SARS-CoV-2 antibody blocking of a recombinant SARS-CoV-2 S.sub.1 RBD N439K, SARS-CoV-2 S.sub.1D614G, SARS-CoV-2 S B.1.1.7 2, SARS-CoV-2 S B.1.1.7 4, SARS-CoV-2 S.sub.1 RBD P.1, SARS-CoV-2 S.sub.1 RBD B.1.617.2, and SARS-CoV-2 S RBD B.1.617.2 variant protein binding to ACE-2 is shown in Table 13 below.
TABLE-US-00013 TABLE 13 SARS-CoV2 S1 SARS-CoV2 SARS-CoV2 S SARS-CoV2 S SARS-CoV2 S1 RBD SARS-CoV2 S Target Antibody clone RBD N439K S1 D614G B.1.1.7 2x B.1.1.7 4x S1 RBD P.1 B.1.617.2 B.1.617.2 S1 1035211 18.1 86.6 76.3 72.4 0 1.7 0 S1 1035224 96.1 86.7 33.9 74.1 88 0 0 S1 1035240 49 86.8 91.2 78.6 0 0.7 0 RBD 1035423 34.6 86.6 71.1 75.9 22 81.4 89.5 S1 1035709 90.8 86.7 92.1 80.7 90 5.3 58.8 S1 1035716 96.2 86.7 94.4 81.5 95 96.5 89.3 S1 1035740 96 86.8 94.3 82.1 95 96.5 89.6 S1 1035752 53 86.7 81.4 74.4 77.2 0.8 0 S1 1035753 96.2 86.7 93.6 81.2 90.4 0 0 S1 1035755 25.2 86.6 12 35.8 14.9 0.9 0 S1 1035762 42.7 86.6 75.7 75.2 40.5 1.5 18.7 RBD 1035414 43 78 17.8 4.8 0.4 37.4 73.5 RBD 1035419 69.3 85.8 21.8 33.3 8.7 72.5 78.5 RBD 1035433 0.9 81.4 82.0 23.5 0 18.4 93.8 S1 1035744 36.5 67.7 6.2 0 0 32.6 14.1 Summary of anti-SARS-CoV-2 antibody blocking. Percent Blocking was calculated by subtracting the percent of anti-His positive cells in the presence of each monoclonal antibody from the percent of anti-His positive cells incubated with each of the rSARS-CoV-2 variant proteins.
[0490] As new mutations occur resulting in the emergence of novel variants of the SARS-CoV2 virus, broadly cross-reactive antibodies that can identify multiple SARS-CoV2 variants and prevent their binding to the human ACE-2 will be in high demand. Disclosed herein are 15 novel antibody clones that recognize the S1 and/or RBD proteins of the original Wuhan strain of the SARS-CoV2 virus and prevent the binding of these viral proteins in a human ACE2 over-expression system. Also described herein is the ability of these 15 clones to recognize S, S1 and/or RBD proteins from five prevalent SARS-CoV2 variants, the SARS-CoV2 Alpha B.1.1.7 variant (UK/London variant); the SARS-CoV2 N439 variant (Scotland variant); the D614G variant (an offshoot of Scotland and London variants); the Gamma P.1 variant (Brazilian variant); and the Delta B.1.617.2 variant (Indian variant) and prevent the binding of these viral proteins in the same human ACE-2 over-expression system.
[0491] Of the 15 SARS-CoV2 antibodies tested, two of the 15 clones tested, clones 1035716 and 1035740, were found to have the most broad cross reactivity, and were each able to block the binding of all 5 variant viral proteins to ACE-2: the SARS-CoV2 Alpha B. 1.1.7 UK/London variant (80-95% blocking); the SARS-CoV2 N439 Scotland variant (>95% blocking); the D614G Scotland/UK variant (>85% blocking); the Gamma P.1 Brazilian variant (95% blocking); and the Delta B.1.617.2 Indian variant (89%-95% blocking). Notably, while all clones failed to block MERS protein binding to its human receptor, CD26, most likely due to the low homology between the SARS and MERS viruses, clone 1035740 exhibited the highest percentage of blocking against all SARS-CoV and SARS-CoV2 S.sub.1 and RBD proteins tested.
[0492] Two other clones, 103224 and 103753, showed modest to good blocking against four of the SARS-CoV2 variants, the SARS-CoV2 Alpha B.1.1.7 UK/London variant; the SARS-CoV2 N439 Scotland variant; the D614G Scotland/UK variant; the Gamma P.1 Brazilian variant (95% blocking), but completely failed to blocking binding of the Delta B.1.617.2 Indian variant proteins. Moreover, most of the clones (9 out of 15) showed relatively poor blocking against the Delta B.1.617.2 Indian variant proteins highlighting the unique nature of clones 1035716 and 1035740 which effectively blocked binding of Delta variant proteins. The noticeable lack of cross-reactivity of our 15 antibody clones with the Delta variant viral proteins may also offer a potential explanation as to why the Delta variant has been suggested to be more contagious than other SARS-CoV2 variants (Li et al. medRxiv 2021.07.07.21260122 (2021)) and how patients in two different studies that were infected with the Delta variant were more likely to be hospitalized than patients infected with Alpha or the original virus strains where pre-existing immunity to the original SARS-CoV2 virus may provide little protection (Fisman and Tuite. medRxiv 2021.07.05.21260050 (2021); Bernal et al. N Engl J Med 385:585-594 (2021); Mlcochova et al. Nature 599, 114-119 (2021)).
[0493] All 15 viral SARS-CoV2 antibodies blocked binding of SARS-CoV2 S.sub.1 RBD D614G to ACE-2. 12 of the 15 clones blocked SARS-CoV2 51 RBD D614G by more than 85% while the remaining three clones blocked binding between 65% and 81%. In general, antibodies that were originally generated by immunizing with the full S1 protein of the original Wuhan SARS-CoV2 virus displayed greater overall cross reactivity with the five SARS-CoV2 variants whether the variant protein being blocked were the S, full length S1 protein or the shorter RBD protein. For example, 14 or the 15 clones reduced binding of the N439K variant RBD protein. Antibody clones generated by immunizing with the full S.sub.1 protein of the original Wuhan SARS-CoV2 virus reduced the binding of the SARS-CoV2 N439K variant RBD protein an average of 64%. By comparison, antibody clones generated by immunizing with the shorter RBD protein of the original Wuhan SARS-CoV2 virus reduced the binding of the SARS-CoV2 N439K variant RBD protein only by an average of 37%.
[0494] A similar trend was seen when using the Brazilian P.1 variant; however, only 10 of the 15 clones reduced viral protein binding. In this scenario, antibody clones generated against the full Wuhan SARS-CoV2 S.sub.1 protein reduced the binding of the SARS-CoV2 P.1 variant RBD protein an average of 54%. By comparison, antibody clones generated against the shorter RBD protein of the original Wuhan virus reduced the binding of the SARS-CoV2 P.1 variant RBD protein only by an average of 8%.
[0495] Interestingly, this trend was reversed when the blocking of Delta variant S and RBD proteins was assayed. Both recombinant S and RBD proteins were available only for the Delta variant at the time these assays were performed. For the N439K, D614G, and P.1 variants, either recombinant S1 or RBD proteins were used, but not both. When S1 Wuhan strain antibodies were assayed for blocking against recombinant S Delta variant protein, only five clones were able to reduce Delta S1 binding, resulting in an average blocking of only 25%. Similarly, only three of the S1 clones were able to block recombinant RBD Delta variant protein, resulting in an average blocking of only 21%. However, when the RBD Wuhan strain antibodies were assays for blocking, they performed much better. All four RBD clones were able to reduce recombinant Delta variant RBD protein binding by an average of 52 percent and this improved dramatically when assayed against recombinant Delta variant S protein where the same four clones reduced Delta variant S1 protein binding by an average of 83%. This again likely highlights the unique nature of, and the challenges posed by, the SARS-CoV2 Delta variant virus.
[0496] While the overall trend was reversed when the blocking of Delta variant S and RBD proteins was assayed, it is worth noting that the two antibody clones that were found to have the most broad cross reactivity were generated by immunizing against the full length Wuhan strain S.sub.1 protein and showed potent blocking against both Delta variant S (clone 1035716=89.3% blocking; clone 1035740=89.6% blocking) and RBD proteins (clone 1035716=96.5% blocking; clone 1035740=96.5% blocking).
[0497] The complete disclosure of all patents, patent applications, and publications, and electronically available material (including, for instance, nucleotide sequence submissions in, e.g., GenBank and RefSeq, and amino acid sequence submissions in, e.g., SwissProt, PIR, PRF, PDB, and translations from annotated coding regions in GenBank and RefSeq) cited herein are incorporated by reference. In the event that any inconsistency exists between the disclosure of the present application and the disclosure(s) of any document incorporated herein by reference, the disclosure of the present application shall govern. The foregoing detailed description and examples have been given for clarity of understanding only. No unnecessary limitations are to be understood therefrom. The invention is not limited to the exact details shown and described, for variations obvious to one skilled in the art will be included within the invention defined by the claims.
SEQUENCE FREE LISTING
[0498] SEQ ID NO: 1 Amino acid sequence light chain 1035211 antibody [0499] SEQ ID NO: 2 Amino acid sequence light chain 1035224 antibody [0500] SEQ ID NO: 3 Amino acid sequence light chain 1035240 antibody [0501] SEQ ID NO: 4 Amino acid sequence light chain 1035414 antibody [0502] SEQ ID NO: 5 Amino acid sequence light chain 1035419 antibody [0503] SEQ ID NO: 6 Amino acid sequence light chain 1035423 antibody [0504] SEQ ID NO: 7 Amino acid sequence light chain 1035433 antibody [0505] SEQ ID NO: 8 Amino acid sequence light chain 1035709 antibody [0506] SEQ ID NO: 9 Amino acid sequence light chain 1035716 antibody [0507] SEQ ID NO: 10 Amino acid sequence light chain 1035740 antibody [0508] SEQ ID NO: 11 Amino acid sequence light chain 1035744-1 antibody [0509] SEQ ID NO: 12 Amino acid sequence light chain 1035744-2 antibody [0510] SEQ ID NO: 13 Amino acid sequence light chain 1035752 antibody [0511] SEQ ID NO: 14 Amino acid sequence light chain 1035753 antibody [0512] SEQ ID NO: 15 Amino acid sequence light chain 1035755 antibody [0513] SEQ ID NO: 16 Amino acid sequence light chain 1035762 antibody [0514] SEQ ID NO: 17 Amino acid sequence heavy chain 1035211 antibody [0515] SEQ ID NO: 18 Amino acid sequence heavy chain 1035224 antibody [0516] SEQ ID NO: 19 Amino acid sequence heavy chain 1035240 antibody [0517] SEQ ID NO: 20 Amino acid sequence heavy chain 1035414 antibody [0518] SEQ ID NO: 21 Amino acid sequence heavy chain 1035419 antibody [0519] SEQ ID NO: 22 Amino acid sequence heavy chain 1035423 antibody [0520] SEQ ID NO: 23 Amino acid sequence heavy chain 1035433 antibody [0521] SEQ ID NO: 24 Amino acid sequence heavy chain 1035709 antibody [0522] SEQ ID NO: 25 Amino acid sequence heavy chain 1035716 antibody [0523] SEQ ID NO: 26 Amino acid sequence heavy chain 1035740 antibody [0524] SEQ ID NO: 27 Amino acid sequence heavy chain 1035744 antibody [0525] SEQ ID NO: 28 Amino acid sequence heavy chain 1035752 antibody [0526] SEQ ID NO: 29 Amino acid sequence heavy chain 1035753 antibody [0527] SEQ ID NO: 30 Amino acid sequence heavy chain 1035755 antibody [0528] SEQ ID NO: 31 Amino acid sequence heavy chain 1035762 antibody [0529] SEQ ID NO: 32 Amino acid sequence light chain CDR 1 of 1035211 and 1035240 antibodies [0530] SEQ ID NO: 33 Amino acid sequence light chain CDR 2 of 1035211 and 1035240 antibodies [0531] SEQ ID NO: 34 Amino acid sequence light chain CDR 3 of 1035211, 1035240, 1035744-1, and 1035744-2 antibodies [0532] SEQ ID NO: 35 Amino acid sequence light chain CDR 1 of 1035224 and 1035755 antibodies [0533] SEQ ID NO: 36 Amino acid sequence light chain CDR 2 of 1035224 and 1035755 antibodies [0534] SEQ ID NO: 37 Amino acid sequence light chain CDR 3 of 1035224 and 1035755 antibodies [0535] SEQ ID NO: 38 Amino acid sequence light chain CDR 1 of 1035419 antibody [0536] SEQ ID NO: 39 Amino acid sequence light chain CDR 2 of 1035419 and 1035414 antibodies [0537] SEQ ID NO: 40 Amino acid sequence light chain CDR 3 of 1035419 antibody [0538] SEQ ID NO: 41 Amino acid sequence light chain CDR 1 of 1035423 antibody [0539] SEQ ID NO: 42 Amino acid sequence light chain CDR 2 of 1035423 antibody [0540] SEQ ID NO: 43 Amino acid sequence light chain CDR 3 of 1035423 antibody [0541] SEQ ID NO: 44 Amino acid sequence light chain CDR 1 of 1035433 antibody [0542] SEQ ID NO: 45 Amino acid sequence light chain CDR 2 of 1035433 antibody [0543] SEQ ID NO: 46 Amino acid sequence light chain CDR 3 of 1035433 antibody [0544] SEQ ID NO: 47 Amino acid sequence light chain CDR 1 of 1035414 antibody [0545] SEQ ID NO: 48 Amino acid sequence light chain CDR 3 of 1035414 antibody [0546] SEQ ID NO: 49 Amino acid sequence light chain CDR 1 of 1035709 antibody [0547] SEQ ID NO: 50 Amino acid sequence light chain CDR 2 of 1035709 and 1035762 antibodies [0548] SEQ ID NO: 51 Amino acid sequence light chain CDR 3 of 1035709 and 1035762 antibodies [0549] SEQ ID NO: 52 Amino acid sequence light chain CDR 1 of 1035716 antibody [0550] SEQ ID NO: 53 Amino acid sequence light chain CDR 2 of 1035716 antibody [0551] SEQ ID NO: 54 Amino acid sequence light chain CDR 3 of 1035716 antibody [0552] SEQ ID NO: 55 Amino acid sequence light chain CDR 1 of 1035740 antibody [0553] SEQ ID NO: 56 Amino acid sequence light chain CDR 2 of 1035740 antibody [0554] SEQ ID NO: 57 Amino acid sequence light chain CDR 3 of 1035740 antibody [0555] SEQ ID NO: 58 Amino acid sequence light chain CDR 1 of 1035744-1 antibody [0556] SEQ ID NO: 59 Amino acid sequence light chain CDR 2 of 1035744-1 antibody [0557] SEQ ID NO: 60 Amino acid sequence light chain CDR 1 of 1035744-2 antibody [0558] SEQ ID NO: 61 Amino acid sequence light chain CDR 2 of 1035744-2 antibody [0559] SEQ ID NO: 62 Amino acid sequence light chain CDR 1 of 1035752 antibody [0560] SEQ ID NO: 63 Amino acid sequence light chain CDR 2 of 1035752 antibody [0561] SEQ ID NO: 64 Amino acid sequence light chain CDR 3 of 1035752 antibody [0562] SEQ ID NO: 65 Amino acid sequence light chain CDR 1 of 1035753 antibody [0563] SEQ ID NO: 66 Amino acid sequence light chain CDR 2 of 1035753 antibody [0564] SEQ ID NO: 67 Amino acid sequence light chain CDR 3 of 1035753 antibody [0565] SEQ ID NO: 68 Amino acid sequence light chain CDR 1 of 1035762 antibody [0566] SEQ ID NO: 69 Amino acid sequence heavy chain CDR 1 of 1035211 antibody [0567] SEQ ID NO: 70 Amino acid sequence heavy chain CDR 2 of 1035211 and 1035240 antibodies [0568] SEQ ID NO: 71 Amino acid sequence heavy chain CDR 3 of 1035211 and 1035240 antibodies [0569] SEQ ID NO: 72 Amino acid sequence heavy chain CDR 1 of 1035224 antibody [0570] SEQ ID NO: 73 Amino acid sequence heavy chain CDR 2 of 1035224 and 1035755 antibodies [0571] SEQ ID NO: 74 Amino acid sequence heavy chain CDR 3 of 1035224 antibody [0572] SEQ ID NO: 75 Amino acid sequence heavy chain CDR 1 of 1035240 antibody [0573] SEQ ID NO: 76 Amino acid sequence heavy chain CDR 1 of 1035414 and 1035419 antibodies [0574] SEQ ID NO: 77 Amino acid sequence heavy chain CDR 2 of 1035419 antibody [0575] SEQ ID NO: 78 Amino acid sequence heavy chain CDR 3 of 1035419 antibody [0576] SEQ ID NO: 79 Amino acid sequence heavy chain CDR 1 of 1035423 antibody [0577] SEQ ID NO: 80 Amino acid sequence heavy chain CDR 2 of 1035423 antibody [0578] SEQ ID NO: 81 Amino acid sequence heavy chain CDR 3 of 1035423 antibody [0579] SEQ ID NO: 82 Amino acid sequence heavy chain CDR 1 of 1035433 antibody [0580] SEQ ID NO: 83 Amino acid sequence heavy chain CDR 2 of 1035433 antibody [0581] SEQ ID NO: 84 Amino acid sequence heavy chain CDR 3 of 1035433 antibody [0582] SEQ ID NO: 85 Amino acid sequence heavy chain CDR 2 of 1035414 antibody [0583] SEQ ID NO: 86 Amino acid sequence heavy chain CDR 3 of 1035414 antibody [0584] SEQ ID NO: 87 Amino acid sequence heavy chain CDR 1 of 1035709 and 1035762 antibodies [0585] SEQ ID NO: 88 Amino acid sequence heavy chain CDR 2 of 1035709 antibody [0586] SEQ ID NO: 89 Amino acid sequence heavy chain CDR 3 of 1035709 and 1035762 antibodies [0587] SEQ ID NO: 90 Amino acid sequence heavy chain CDR 1 of 1035716 and 1035740 antibodies [0588] SEQ ID NO: 91 Amino acid sequence heavy chain CDR 2 of 1035716 antibody [0589] SEQ ID NO: 92 Amino acid sequence heavy chain CDR 3 of 1035716 and 1035740 antibodies [0590] SEQ ID NO: 93 Amino acid sequence heavy chain CDR 2 of 1035740 antibody [0591] SEQ ID NO: 94 Amino acid sequence heavy chain CDR 1 of 1035744 antibody [0592] SEQ ID NO: 95 Amino acid sequence heavy chain CDR 2 of 1035744 antibody [0593] SEQ ID NO: 96 Amino acid sequence heavy chain CDR 3 of 1035744 antibody [0594] SEQ ID NO: 97 Amino acid sequence heavy chain CDR 1 of 1035752 antibody [0595] SEQ ID NO: 98 Amino acid sequence heavy chain CDR 2 of 1035752 antibody [0596] SEQ ID NO: 99 Amino acid sequence heavy chain CDR 3 of 1035752 antibody [0597] SEQ ID NO: 100 Amino acid sequence heavy chain CDR 1 of 1035753 and 1035755 antibodies [0598] SEQ ID NO: 101 Amino acid sequence heavy chain CDR 2 of 1035753 antibody [0599] SEQ ID NO: 102 Amino acid sequence heavy chain CDR 3 of 1035753 antibody [0600] SEQ ID NO: 103 Amino acid sequence heavy chain CDR 3 of 1035755 antibody [0601] SEQ ID NO: 104 Amino acid sequence heavy chain CDR 2 of 1035762 antibody