SULFAMATE MODULATORS OF PIN1 ACTIVITY AND USES THEREOF
20230406837 ยท 2023-12-21
Assignee
Inventors
Cpc classification
International classification
Abstract
Provided herein are Sulfamate compounds for use in modulating an activity of peptidyl-prolyl isomerase NIMA-interacting-1 (Pin1).
Claims
1. A Sulfamate compound represented by the structure of Formula I: ##STR00056## or a pharmaceutically acceptable salt thereof; wherein, the represents a saturated or non-saturated bond; Y and are each independently selected from the group consisting of O, S and NH; each of R.sub.2 and Ra, Rb and Rc are independently selected from the group consisting of hydrogen, alkyl, alkenyl, alkynyl, cycloalkyl, aryl, heteroaryl, heterocyclic, halo, hydroxy, alkoxy, aryloxy, thiohydroxy, thioalkoxy, thioaryloxy, sulfinyl, sulfonyl, sulfonate, sulfate, cyano, nitro, azide, phosphonyl, phosphinyl, carbonyl, thiocarbonyl, a urea group, a thiourea group, O-carbamyl, N-carbamyl, O-thiocarbamyl, N-thiocarbamyl, C-amido, N-amido, C-carboxy, O-carboxy, sulfonamido, guanyl, guanidinyl, hydrazine, hydrazide, thiohydrazide, and amino, or alternatively, R.sub.2 is absent when the dashed line represents an unsaturated bond; each of R.sub.1, R.sub.3 and R.sub.4 are each independently selected from the group consisting of hydrogen, OH, any group that forms a urea, an amide, a thiourea, hydrazide or hydroxamic acid (via the nitrogen), substituted or unsubstituted linear or branched alkyl, alkenyl, alkynyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryl and substituted or unsubstituted heteroaryl, or R.sub.3 and R.sub.4 form together a five or six membered ring with the nitrogen; n is 1, 2, 3 or 4; L.sub.1 is a bond, substituted or unsubstituted linear or branched alkylene, substituted or unsubstituted linear or branched alkenylene, substituted or unsubstituted linear or branched alkynylene, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocyclic, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, or an ether group; L.sub.2 is substituted or unsubstituted linear or branched alkylene, substituted or unsubstituted linear or branched alkenylene, substituted or unsubstituted linear or branched alkynylene, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocyclic, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, or an ether group; W is O, S or NR.sub.5; and R.sub.5 is selected from the group consisting of hydrogen, alkyl, alkenyl, alkynyl, cycloalkyl, heterocyclic, aryl and heteroaryl.
2. The Sulfamate compound according to claim 1, wherein the Sulfamate compound is represented by the structure of Formula II: ##STR00057## or a pharmaceutically acceptable salt thereof; wherein, R.sub.1, R.sub.2, R.sub.3, R.sub.4, L.sub.1, L.sub.2, W, Y and Z are defined in claim 1.
3. The Sulfamate compound according to claim 1, wherein the Sulfamate compound is represented by the structure of Formula III: ##STR00058## or a pharmaceutically acceptable salt thereof wherein, R.sub.1, R.sub.2, R.sub.3, L.sub.2 and W are defined in claim 1.
4. The Sulfamate compound according to claim 1, wherein the Sulfamate compound is represented by the structure of Formula IV: ##STR00059## or a pharmaceutically acceptable salt thereof; wherein, R.sub.1 and R.sub.3, are as defined in claim 1.
5. The Sulfamate compound or pharmaceutically acceptable salt thereof according to claim 1, wherein n is 2.
6. The Sulfamate compound or pharmaceutically acceptable salt thereof according to claim 1, wherein Y and Z are each O (oxygen).
7. The Sulfamate compound or pharmaceutically acceptable salt thereof according to claim 1, wherein the a saturated bond.
8. The Sulfamate compound or pharmaceutically acceptable salt thereof according to claim 1, wherein L.sub.1 is a bond.
9. The Sulfamate compound or pharmaceutically acceptable salt thereof according to claim 1, wherein R.sub.4 is a hydrogen.
10. The Sulfamate compound or pharmaceutically acceptable salt thereof according to claim 1, wherein L.sub.2 is methylene.
11. The Sulfamate compound or pharmaceutically acceptable salt thereof according to claim 1, wherein R.sub.3 is a substituted or unsubstituted alkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroalicyclic, or substituted or unsubstituted heteroaryl.
12. The Sulfamate compound or pharmaceutically acceptable salt thereof according to claim 11, wherein R.sub.3 is C.sub.1-C.sub.10 alkyl, benzyl, or substituted or unsubstituted phenyl.
13. The Sulfamate compound or pharmaceutically acceptable salt thereof according to claim 11, wherein R.sub.3 is selected from the group consisting of C.sub.1-C.sub.3 alkyl, benzyl, or phenyl, wherein the C.sub.1-C.sub.3 alkyl of R.sub.3 is unsubstituted or substituted with halo, hydroxy, alkoxy, cyano, or oxo; and the benzyl or phenyl of R.sub.3 is unsubstituted or substituted with halo, alkyl, hydroxy, alkoxy, or cyano.
14. The Sulfamate compound or pharmaceutically acceptable salt thereof according to claim 12, wherein said substituted phenyl is substituted with alkyl or halo.
15. The Sulfamate compound or pharmaceutically acceptable salt thereof according to claim 11, wherein R.sub.3 is unsubstituted C.sub.1-C.sub.3 alkyl, unsubstituted benzyl, or phenyl, wherein the phenyl of R.sub.3 is unsubstituted or substituted with halo or C.sub.1-C.sub.3 alkyl.
16. The Sulfamate compound or pharmaceutically acceptable salt thereof according to claim 11, wherein R.sub.3 is methyl.
17. The Sulfamate compound or pharmaceutically acceptable salt thereof according to claim 11, wherein R.sub.3 is benzyl.
18. The Sulfamate compound or pharmaceutically acceptable salt thereof according to claim 11, wherein R.sub.3 is phenyl, unsubstituted or substituted with halo or C.sub.1-C.sub.3 alkyl.
19. The Sulfamate compound or pharmaceutically acceptable salt thereof according to claim 1, wherein R.sub.1 is represented by Formula A:
CH.sub.2-Q Formula A wherein Q is selected from the group consisting of alkyl, alkenyl, alkynyl, cycloalkyl, aryl, heteroaryl, heteroalicyclic, halo, hydroxy, alkoxy, aryloxy, thiohydroxy, thioalkoxy, thioaryloxy, sulfinyl, sulfonyl, sulfonate, sulfate, cyano, nitro, azide, phosphonyl, phosphinyl, carbonyl, thiocarbonyl, a urea group, a thiourea group, O-carbamyl, N-carbamyl, O-thiocarbamyl, N-thiocarbamyl, C-amido, N-amido, C-carboxy, O-carboxy, sulfonamido, guanyl, guanidinyl, hydrazine, hydrazide, thiohydrazide, and amino.
20. The Sulfamate compound or pharmaceutically acceptable salt thereof according to claim 19, wherein Q is a tertiary alkyl, alkenyl, alkynyl, cycloalkyl, or heterocyclic.
21. The Sulfamate compound or pharmaceutically acceptable salt thereof according to claim 19, wherein Q is a substituted or unsubstituted t-butyl or substituted or unsubstituted cycloalkyl.
22. The sulfamate compound or pharmaceutically acceptable salt thereof according to claim 19, wherein Q is C.sub.4-C.sub.6 alkyl or C.sub.5-C.sub.7 cycloalkyl, each of which is unsubstituted or substituted by halo, hydroxy, alkoxy, cyano, or oxo.
23. The sulfamate compound or pharmaceutically acceptable salt thereof according to claim 19, wherein the alkyl of Q is secondary or tertiary.
24. The sulfamate compound or pharmaceutically acceptable salt thereof according to claim 23, wherein the alkyl of Q is tertiary.
25. The sulfamate compound or pharmaceutically acceptable salt thereof according to claim 19, wherein Q is tert-butyl.
26. The Sulfamate compound or pharmaceutically acceptable salt thereof according to claim 19, wherein Q is cyclohexyl.
27. The Sulfamate compound or pharmaceutically acceptable salt thereof according to claim 19, wherein Q is a triazole.
28. The Sulfamate compound or pharmaceutically acceptable salt thereof according to claim 27, wherein said triazole has Formula B: ##STR00060## wherein R.sub.6 is selected from the group consisting of alkyl, alkenyl, alkynyl, cycloalkyl, heteroalicyclic, aryl and heteroaryl.
29. The Sulfamate compound or pharmaceutically acceptable salt thereof according to claim 1, wherein the Sulfamate compound is represented by the structure of compound: ##STR00061## or a pharmaceutically acceptable salt thereof.
30. A method of modulating the activity of Pin1 comprising contacting Pin1 with the sulfamate compound or pharmaceutically acceptable salt thereof according to claim 1, or a pharmaceutically acceptable salt thereof.
31. The method according to claim 30, wherein a covalent bond is formed between Cys113 residue of said Pin1 and a carbon near the sulfamate group (electrophilic site), wherein releasing a sulfamic acid leaving group; and wherein hydrogen bonds are formed between Gln131 and His 157 residues of said Pin1 and the sulfur ring; and between protein Pin1 and the sulfamate group.
32. The method according to claim 30, for use in treating a condition in which modulating an activity of Pin1 is beneficial.
33. A pharmaceutical composition comprising the Sulfamate compound according to claim 1, or pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable carrier or excipient.
34. A method of treating a disease or condition associated with Pin1 activity, comprising administering to a subject in need thereof the compound of claim 1, or a or pharmaceutically acceptable salt thereof, or a pharmaceutical composition of claim 33.
35. The method of claim 34, wherein the disease or condition is a proliferative disease or disorder.
36. The method of claim 34, wherein the disease is a cancer.
37. The method of claim 34, wherein the disease is selected from the group consisting of a pancreatic cancer, a neuroblastoma, a prostate cancer, an ovarian carcinoma, and a breast adenocarcinoma.
38. The method of claim 34, wherein the disease or condition is an immune disease or disorder.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0035] The subject matter directed to the sulfonate and sulfamate compounds and uses thereof is particularly pointed out and distinctly claimed in the concluding portion of the specification. The synthetic compounds and uses thereof, however, both as to organization and method of operation, together with objects, features, and advantages thereof, may best be understood by reference to the following detailed description when read with the accompanying drawings in which:
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056] It will be appreciated that for simplicity and clarity of illustration, elements shown in the figures have not necessarily been drawn to scale. Further, where considered appropriate, reference numerals may be repeated among the figures to indicate corresponding or analogous elements.
DETAILED DESCRIPTION
[0057] This invention is directed to pharmacology, and more particularly, but not exclusively, to newly designed compounds that covalently bind to, and/or modulate the activity of, Pin1 and to uses thereof in, for example, treating diseases associated with Pin1 activity.
Sulfonate and Sulfamate Compounds
[0058] In some embodiments, this invention is directed to sulfonate and sulfamate-compounds represented by the structure of Formula IA:
E-L-G(Formula IA)
or a pharmaceutically acceptable salt thereof;
wherein, [0059] G is a rigid moiety represented by the following formula (sulfopin derivative):
##STR00005## [0060] E is an electrophilic moiety represent by the following structure:
##STR00006## [0061] L is a bond or a linking moiety, [0062] the represents a saturated or non-saturated bond; [0063] Y and Z are each independently selected from the group consisting of O, S and NH; [0064] Q is selected from the group consisting of substituted or unsubstituted linear or branched alkyl, substituted or unsubstituted linear or branched alkyl, substituted or unsubstituted linear or branched alkenyl, substituted or unsubstituted linear or branched alkynyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocyclic, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl and NR.sub.3R.sub.4; [0065] each of R.sub.2, Ra, Rb and Rc are independently selected from the group consisting of hydrogen, alkyl, alkenyl, alkynyl, cycloalkyl, aryl, heteroaryl, heterocyclic, halo, hydroxy, alkoxy, aryloxy, thiohydroxy, thioalkoxy, thioaryloxy, sulfinyl, sulfonyl, sulfonate, sulfate, cyano, nitro, azide, phosphonyl, phosphinyl, carbonyl, thiocarbonyl, a urea group, a thiourea group, O-carbamyl, N-carbamyl, O-thiocarbamyl, N-thiocarbamyl, C-amido, N-amido, C-carboxy, O-carboxy, sulfonamido, guanyl, guanidinyl, hydrazine, hydrazide, thiohydrazide, and amino, or alternatively, R.sub.2 is absent when the dashed line represents an unsaturated bond; [0066] R.sub.1, R.sub.3 and R.sub.4 are each independently selected from the group consisting of hydrogen, OH, any group that forms a urea, an amide, a thiourea, hydrazide or hydroxamic acid (via the nitrogen), substituted or unsubstituted linear or branched alkyl, alkenyl, alkynyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl, or R.sub.3 and R.sub.4 forms together a five or six membered ring with the nitrogen; [0067] n is 1, 2, 3 or 4; [0068] L.sub.2 is substituted or unsubstituted linear or branched alkylene, substituted or unsubstituted linear or branched alkenylene, substituted or unsubstituted linear or branched alkynylene, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocyclic, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, or an ether group; [0069] L.sub.3 is a bond or CW, wherein W is O, S or NRs; and [0070] R.sub.5 is selected from the group consisting of hydrogen, alkyl, alkenyl, alkynyl, cycloalkyl, heterocyclic, aryl and heteroaryl.
[0071] In another embodiment, the linking moiety represented by L may optionally be any linking group described herein and known in the art, optionally a hydrocarbon (as defined herein). In another embodiment, the linking moiety is substituted or unsubstituted linear or branched alkylene, substituted or unsubstituted linear or branched alkenylene, substituted or unsubstituted linear or branched alkynylene, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocyclic, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, or an ether group.
[0072] In some embodiments, this invention is directed to Sulfamate compound represented by the structure of Formula IB:
##STR00007##
or a pharmaceutically acceptable salt thereof;
wherein, [0073] the represents a saturated or non-saturated bond; [0074] Y and Z are each independently selected from the group consisting of O, S and NH; [0075] X.sub.1 and X.sub.2 are each independently O, N, or CH; [0076] Q is selected from the group consisting of substituted or unsubstituted linear or branched alkyl, substituted or unsubstituted linear or branched alkyl, substituted or unsubstituted linear or branched alkenyl, substituted or unsubstituted linear or branched alkynyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocyclic, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl and NR.sub.3R.sub.4; [0077] each of R.sub.2 and Ra, Rb and Rc are independently selected from the group consisting of hydrogen, alkyl, alkenyl, alkynyl, cycloalkyl, aryl, heteroaryl, heterocyclic, halo, hydroxy, alkoxy, aryloxy, thiohydroxy, thioalkoxy, thioaryloxy, sulfinyl, sulfonyl, sulfonate, sulfate, cyano, nitro, azide, phosphonyl, phosphinyl, carbonyl, thiocarbonyl, a urea group, a thiourea group, O-carbamyl, N-carbamyl, O-thiocarbamyl, N-thiocarbamyl, C-amido, N-amido, C-carboxy, O-carboxy, sulfonamido, guanyl, guanidinyl, hydrazine, hydrazide, thiohydrazide, and amino, or alternatively, R.sub.2 is absent when the dashed line represents an unsaturated bond; [0078] each of R.sub.1, R.sub.3 and R.sub.4 are independently selected from the group consisting of hydrogen, OH, any group that forms a urea, an amide, a thiourea, hydrazide or hydroxamic acid (via the nitrogen), substituted or unsubstituted linear or branched alkyl, alkenyl, alkynyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl, or R.sub.3 and R.sub.4 forms together a five or six membered ring with the nitrogen; wherein when X.sub.2 is O then R.sub.1 is absent. [0079] n is 1, 2, 3 or 4; [0080] L.sub.1 is a bond, substituted or unsubstituted linear or branched alkylene, substituted or unsubstituted linear or branched alkenylene, substituted or unsubstituted linear or branched alkynylene, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocyclic, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, or an ether group; [0081] L.sub.2 is substituted or unsubstituted linear or branched alkylene, substituted or unsubstituted linear or branched alkenylene, substituted or unsubstituted linear or branched alkynylene, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocyclic, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, or an ether group; [0082] W is O, S or NRs; and [0083] R.sub.5 is selected from the group consisting of hydrogen, alkyl, alkenyl, alkynyl, cycloalkyl, heterocyclic, aryl and heteroaryl.
[0084] In some embodiments, this invention is directed to Sulfamate compound represented by the structure of Formula I.
##STR00008##
or a pharmaceutically acceptable salt thereof; [0085] wherein, [0086] the represents a saturated or non-saturated bond; [0087] Y and Z are each independently selected from the group consisting of O, S and NH; [0088] each of R.sub.2, Ra, Rb and Rc are independently selected from the group consisting of hydrogen, alkyl, alkenyl, alkynyl, cycloalkyl, aryl, heteroaryl, heterocyclic, halo, hydroxy, alkoxy, aryloxy, thiohydroxy, thioalkoxy, thioaryloxy, sulfinyl, sulfonyl, sulfonate, sulfate, cyano, nitro, azide, phosphonyl, phosphinyl, carbonyl, thiocarbonyl, a urea group, a thiourea group, O-carbamyl, N-carbamyl, O-thiocarbamyl, N-thiocarbamyl, C-amido, N-amido, C-carboxy, O-carboxy, sulfonamido, guanyl, guanidinyl, hydrazine, hydrazide, thiohydrazide, and amino, or alternatively, R.sub.2 is absent when the dashed line represents an unsaturated bond; [0089] each of R.sub.1, R.sub.3 and R.sub.4 are independently selected from the group consisting of hydrogen, OH, any group that forms a urea, an amide, a thiourea, hydrazide or hydroxamic acid (via the nitrogen), substituted or unsubstituted linear or branched alkyl, alkenyl, alkynyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl, or R.sub.3 and R.sub.4 forms together a five or six membered ring with the nitrogen; [0090] n is 1, 2, 3 or 4; [0091] L.sub.1 is a bond, substituted or unsubstituted linear or branched alkylene, substituted or unsubstituted linear or branched alkenylene, substituted or unsubstituted linear or branched alkynylene, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocyclic, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, or an ether group; [0092] L.sub.2 is substituted or unsubstituted linear or branched alkylene, substituted or unsubstituted linear or branched alkenylene, substituted or unsubstituted linear or branched alkynylene, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocyclic, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, or an ether group; [0093] W is O, S or NRs; and [0094] R.sub.5 is selected from the group consisting of hydrogen, alkyl, alkenyl, alkynyl, cycloalkyl, heterocyclic, aryl and heteroaryl.
[0095] In some embodiments, this invention is directed to Sulfamate compound represented by the structure of Formula II:
##STR00009##
or a pharmaceutically acceptable salt thereof,
wherein, [0096] the represents a saturated or non-saturated bond; [0097] Y and Z are each independently selected from the group consisting of O, S and NH; [0098] R.sub.2 is selected from the group consisting of hydrogen, alkyl, alkenyl, alkynyl, cycloalkyl, aryl, heteroaryl, heterocyclic, halo, hydroxy, alkoxy, aryloxy, thiohydroxy, thioalkoxy, thioaryloxy, sulfinyl, sulfonyl, sulfonate, sulfate, cyano, nitro, azide, phosphonyl, phosphinyl, carbonyl, thiocarbonyl, a urea group, a thiourea group, O-carbamyl, N-carbamyl, O-thiocarbamyl, N-thiocarbamyl, C-amido, N-amido, C-carboxy, O-carboxy, sulfonamido, guanyl, guanidinyl, hydrazine, hydrazide, thiohydrazide, and amino, or alternatively, R.sub.2 is absent when the dashed line represents an unsaturated bond; [0099] each of R.sub.1, R.sub.3 and R.sub.4 are independently selected from the group consisting of hydrogen, OH, any group that forms a urea, an amide, a thiourea, hydrazide or hydroxamic acid (via the nitrogen), substituted or unsubstituted linear or branched alkyl, alkenyl, alkynyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl, or R.sub.3 and R.sub.4 forms together a five or six membered ring with the nitrogen; [0100] L.sub.1 is a bond, substituted or unsubstituted linear or branched alkylene, substituted or unsubstituted linear or branched alkenylene, substituted or unsubstituted linear or branched alkynylene, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocyclic, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, or an ether group; [0101] L.sub.2 is substituted or unsubstituted linear or branched alkylene, substituted or unsubstituted linear or branched alkenylene, substituted or unsubstituted linear or branched alkynylene, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocyclic, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, or an ether group; [0102] W is O, S or NR.sub.5; and [0103] R.sub.5 is selected from the group consisting of hydrogen, alkyl, alkenyl, alkynyl, cycloalkyl, heterocyclic, aryl and heteroaryl.
[0104] In some embodiments, this invention is directed to Sulfamate compound represented by the structure of Formula III:
##STR00010## [0105] or a pharmaceutically acceptable salt thereof; [0106] wherein, [0107] the represents a saturated or non-saturated bond; [0108] R.sub.2 is selected from the group consisting of hydrogen, alkyl, alkenyl, alkynyl, cycloalkyl, aryl, heteroaryl, heterocyclic, halo, hydroxy, alkoxy, aryloxy, thiohydroxy, thioalkoxy, thioaryloxy, sulfinyl, sulfonyl, sulfonate, sulfate, cyano, nitro, azide, phosphonyl, phosphinyl, carbonyl, thiocarbonyl, a urea group, a thiourea group, O-carbamyl, N-carbamyl, O-thiocarbamyl, N-thiocarbamyl, C-amido, N-amido, C-carboxy, O-carboxy, sulfonamido, guanyl, guanidinyl, hydrazine, hydrazide, thiohydrazide, and amino, or alternatively, R.sub.2 is absent when the dashed line represents an unsaturated bond; [0109] each of R.sub.1 and R.sub.3 are independently selected from the group consisting of hydrogen, OH, any group that forms a urea, an amide, a thiourea, hydrazide or hydroxamic acid (via the nitrogen), substituted or unsubstituted linear or branched alkyl, alkenyl, alkynyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl; [0110] L.sub.2 is substituted or unsubstituted linear or branched alkylene, substituted or unsubstituted linear or branched alkenylene, substituted or unsubstituted linear or branched alkynylene, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocyclic, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, or an ether group; [0111] W is O, S or NRs; and [0112] R.sub.5 is selected from the group consisting of hydrogen, alkyl, alkenyl, alkynyl, cycloalkyl, heterocyclic, aryl and heteroaryl.
[0113] In some embodiments, this invention is directed to Sulfamate compound represented by the structure of Formula IV:
##STR00011## [0114] or a pharmaceutically acceptable salt thereof, [0115] wherein, [0116] each of R.sub.1 and R.sub.3 are independently selected from the group consisting of hydrogen, OH, any group that forms a urea, an amide, a thiourea, hydrazide or hydroxamic acid (via the nitrogen), substituted or unsubstituted linear or branched alkyl, alkenyl, alkynyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl.
[0117] In some embodiments of the compounds represented by Formula (IA), (IB), (I), (II), and (III), represents a single bond or a double bond. In some embodiments of the compounds represented by Formula (IA), (IB), (I), (II), and (III),
represents a single bond. In some embodiments of the compounds represented by Formula (IA), (IB), (I), (II), and (III),
represents a double bond.
[0118] In some embodiments, R.sub.1 of the compound represented by Formula IA, IB, I, II, III, or IV is selected from the group consisting of hydrogen, substituted or unsubstituted linear or branched alkyl, alkenyl, alkynyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. In another embodiment, R.sub.1 is hydrogen. In another embodiment, R.sub.1 is substituted or unsubstituted linear or branched alkyl. In another embodiment, R.sub.1 is C.sub.1-C.sub.6 alkyl which is unsubstituted or substituted by C.sub.4-C.sub.7 cycloalkyl, halo, hydroxy, alkoxy, cyano, or oxo. In another embodiment, R.sub.1 is C.sub.1-C.sub.6 alkyl which is unsubstituted or substituted by C.sub.5-C.sub.6 cycloalkyl, halo, hydroxy, alkoxy, cyano, or oxo. In another embodiment, R.sub.1 is unsubstituted C.sub.5-C.sub.6 alkyl. In another embodiment, R.sub.1 is C.sub.1-C.sub.3 alkyl which is unsubstituted or substituted by C.sub.5-C.sub.6 cycloalkyl, halo, hydroxy, alkoxy, cyano, or oxo. In another embodiment, R.sub.1 is C.sub.1-C.sub.2 alkyl which is unsubstituted or substituted by C.sub.5-C.sub.6 cycloalkyl, halo, hydroxy, alkoxy, cyano, or oxo. In another embodiment, R.sub.1 is C.sub.1-C.sub.2 alkyl which is substituted by C.sub.5-C.sub.6 cycloalkyl, halo, hydroxy, alkoxy, cyano, or oxo. In another embodiment, R.sub.1 is unsubstituted C.sub.5-C.sub.6 alkyl or C.sub.1-C.sub.2 alkyl which is substituted by C.sub.5-C.sub.6 cycloalkyl, halo, hydroxy, alkoxy, cyano, or oxo. In another embodiment, R.sub.1 is CH.sub.2C(CH.sub.3).sub.3. In another embodiment, R.sub.1 is CH.sub.2CH(CH.sub.3).sub.2. In another embodiment, R.sub.1 is alkenyl. In another embodiment, R.sub.1 is alkynyl. In another embodiment, R.sub.1 is substituted or unsubstituted cycloalkyl. In another embodiment, R.sub.1 is substituted or unsubstituted heterocyclyl. In another embodiment, R.sub.1 is substituted or unsubstituted aryl. In another embodiment, R.sub.1 is substituted or unsubstituted heteroaryl.
[0119] In another embodiment, R.sub.1 of the compound represented by Formula IA, IB, I, II, III, or IV is substituted or unsubstituted linear alkyl represented by Formula A:
CH.sub.2-Q(Formula A),
wherein Q is selected from the group consisting of alkyl, alkenyl, alkynyl, cycloalkyl, aryl, heteroaryl, heteroalicyclic, halo, hydroxy, alkoxy, aryloxy, thiohydroxy, thioalkoxy, thioaryloxy, sulfinyl, sulfonyl, sulfonate, sulfate, cyano, nitro, azide, phosphonyl, phosphinyl, carbonyl, thiocarbonyl, a urea group, a thiourea group, O-carbamyl, N-carbamyl, O-thiocarbamyl, N-thiocarbamyl, C-amido, N-amido, C-carboxy, O-carboxy, sulfonamido, guanyl, guanidinyl, hydrazine, hydrazide, thiohydrazide, and amino. Each represent a separate embodiment of this invention. In another embodiment, Q is tertiary alkyl, alkenyl, alkynyl, cycloalkyl or heterocyclic. In another embodiment Q is heteroaryl. In another embodiment Q is a substituted or unsubstituted t-butyl, or substituted or unsubstituted cycloalkyl. In another embodiment, Q is C.sub.4-C.sub.6 alkyl or C.sub.5-C.sub.7 cycloalkyl, each of which is unsubstituted or substituted by halo, hydroxy, alkoxy, cyano, or oxo. In another embodiment, Q is secondary or tertiary C.sub.4-C.sub.6 alkyl, or C.sub.5-C.sub.7 cycloalkyl, each of which is unsubstituted or substituted by halo, hydroxy, alkoxy, cyano, or oxo. In another embodiment, Q is tertiary C.sub.4-C.sub.6 alkyl, or C.sub.5-C.sub.7 cycloalkyl, each of which is unsubstituted or substituted by halo, hydroxy, alkoxy, cyano, or oxo. In another embodiment Q is tert butyl. In another embodiment Q is cyclohexyl.
[0120] According to some of any of the embodiments described herein relating to Formula IA, IB, I, II, III or IV Q is a tertiary alkyl, alkenyl, alkynyl, cycloalkyl, heterocycloalkyl, or heteroaryl.
[0121] In another embodiment, R.sub.1 or Q is heteroaryl, wherein the heteroaryl is a triazole.
[0122] According to some of any of the embodiments described herein relating to a triazole, the triazole has Formula B:
##STR00012##
wherein R.sub.6 is selected from the group consisting of alkyl, alkenyl, alkynyl, cycloalkyl, heteroalicyclic, aryl and heteroaryl. Each represent a separate embodiment of this invention.
[0123] In another embodiment, R.sub.6 of Formula B is a substituted or unsubstituted phenyl. In another embodiment, R.sub.6 is a phenyl substituted by a substituent selected from hydroxy, hydroxyalkyl, halo, alkoxy, carbonyl, carboxy or sulfonamido. In another embodiment, R.sub.6 is p-methoxycarbonylphenyl.
[0124] In some embodiments, the dashed line of compound of Formula IA, IB, I, II or III represents a saturated bond. In some embodiments, the dashed line of compound of Formula IA, IB, I, II or III represents a non-saturated bond.
[0125] In some embodiments, R.sub.2 of the compound represented by Formula IA, IB, I, II, III, or IV is selected from the group consisting of hydrogen, alkyl, alkenyl, alkynyl, cycloalkyl, aryl, heteroaryl, heterocyclic, halo, hydroxy, alkoxy, aryloxy, thiohydroxy, thioalkoxy, thioaryloxy, sulfinyl, sulfonyl, sulfonate, sulfate, cyano, nitro, azide, phosphonyl, phosphinyl, carbonyl, thiocarbonyl, a urea group, a thiourea group, O-carbamyl, N-carbamyl, O-thiocarbamyl, N-thiocarbamyl, C-amido, N-amido, C-carboxy, O-carboxy, sulfonamido, guanyl, guanidinyl, hydrazine, hydrazide, thiohydrazide, and amino, or alternatively, R.sub.2 is absent when the dashed line represents an unsaturated bond. Each represent a separate embodiment of this invention. In another embodiment, R.sub.2 is hydrogen. In another embodiment, R.sub.2 is C.sub.1-C.sub.10 alkyl. In another embodiment, R.sub.2 is C.sub.1-C.sub.6 alkyl. In another embodiment, R.sub.2 is H or C.sub.1-C.sub.6 alkyl. In another embodiment, R.sub.2 is C.sub.1-C.sub.3 alkyl. In another embodiment, R.sub.2 is H or C.sub.1-C.sub.3 alkyl.
[0126] In some embodiments, R.sub.3 of the compound of Formula IA, IB, I, II, III, or IV is selected from the group consisting of hydrogen, OH, any group that forms a urea, an amide, a thiourea, hydrazide or hydroxamic acid via the nitrogen, substituted or unsubstituted linear or branched alkyl, alkenyl, alkynyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl. Each represent a separate embodiment of this invention. In some embodiments, R.sub.3 is selected from the group consisting of C.sub.1-C.sub.10 alkyl, benzyl, or phenyl, wherein the C.sub.1-C.sub.10 alkyl of R.sub.3 is unsubstituted or substituted with halo, hydroxy, alkoxy, cyano, or oxo; and the benzyl or phenyl of R.sub.3 is unsubstituted or substituted with halo, alkyl, hydroxy, alkoxy, or cyano. In some embodiments, R.sub.3 is selected from the group consisting of unsubstituted C.sub.1-C.sub.10 alkyl, unsubstituted benzyl, or phenyl, wherein the phenyl of R.sub.3 is unsubstituted or substituted with halo or C.sub.1-C.sub.3 alkyl. In some embodiments, R.sub.3 is selected from the group consisting of C.sub.1-C.sub.3 alkyl, benzyl, or phenyl, wherein the C.sub.1-C.sub.3 alkyl of R.sub.3 is unsubstituted or substituted with halo, hydroxy, alkoxy, cyano, or oxo; and the benzyl or phenyl of R.sub.3 is unsubstituted or substituted with halo, alkyl, hydroxy, alkoxy, or cyano. In some embodiments, R.sub.3 is selected from the group consisting of unsubstituted C.sub.1-C.sub.3 alkyl, unsubstituted benzyl, or phenyl, wherein the phenyl of R.sub.3 is unsubstituted or substituted with halo or C.sub.1-C.sub.3 alkyl. In another embodiment, R.sub.3 is C.sub.1-C.sub.10 alkyl. In another embodiment, R.sub.3 is methyl. In another embodiment, R.sub.3 is substituted or unsubstituted benzyl. In another embodiment, R.sub.3 is benzyl. In another embodiment, R.sub.3 is substituted or unsubstituted aryl. In another embodiment, R.sub.3 is substituted or unsubstituted phenyl. In another embodiment, R.sub.3 is halo substituted phenyl. In another embodiment, the halo is selected from I, Br, Cl or F. In another embodiment, R.sub.3 is 4-bromo-phenyl. In another embodiment, R.sub.3 is alkyl substituted phenyl. In another embodiment, R.sub.3 is 4-methyl-phenyl. In another embodiment, R.sub.3 is OH. In another embodiment, R.sub.3 is any group that forms a urea, an amide, a thiourea, hydrazide or hydroxamic acid (via the nitrogen). In some embodiments, any group that forms a urea indicates that R.sub.3 is C(O)NR.sub.xR.sub.y; any group that forms an amide indicates that R.sub.3 is C(O)R.sub.y; and any group that forms a thiourea indicates that R.sub.3 is C(S)NR.sub.xR.sub.y. In some embodiments, any group that forms a hydrazide indicates that R.sub.3 is NR.sub.xC(O)R.sub.y, or that R.sub.3 is C(O)R.sub.y and R.sub.4 is NR.sub.xR.sub.y. In some embodiments, any group that forms a hydroxamic acid indicates that R.sub.3 is C(O)R.sub.y and R.sub.4 is OH. In some embodiments of the foregoing, each R.sub.x is independently H or is selected from C.sub.1-C.sub.6 alkyl or C.sub.4-C.sub.7 cycloalkyl, each of which is unsubstituted or substituted by halo, hydroxy, alkoxy, cyano, or oxo; and each R.sub.y is independently selected from C.sub.1-C.sub.6 alkyl or C.sub.4-C.sub.7 cycloalkyl, each of which is unsubstituted or substituted by halo, hydroxy, alkoxy, cyano, or oxo. In some embodiments, R.sub.3 of the compound of Formula IA, IB, I, II, III or IV is selected from the group consisting of hydrogen, unsubstituted C.sub.1-C.sub.10 alkyl, substituted C.sub.1-C.sub.10 alkyl, unsubstituted aryl, and substituted aryl. In some embodiments, R.sub.3 of the compound of Formula IA, IB, I, II, III, or IV is selected from the group consisting of hydrogen, unsubstituted C.sub.1-C.sub.6 alkyl, substituted C.sub.1-C.sub.6 alkyl, unsubstituted phenyl, and substituted phenyl. In some embodiments, R.sub.3 of the compound of Formula IA, IB, I, II, III, or IV is selected from the group consisting of hydrogen, unsubstituted C.sub.1-C.sub.6 alkyl, substituted C.sub.1-C.sub.6 alkyl, unsubstituted phenyl, and substituted phenyl. In some embodiments, R.sub.3 of the compound of Formula IA, IB I, II, III, or IV is selected from the group consisting of hydrogen, unsubstituted C.sub.1-C.sub.3 alkyl, benzyl, unsubstituted phenyl, and phenyl substituted with halo or C.sub.1-C.sub.3 alkyl.
[0127] In some embodiments, R.sub.4 of the compound of Formula IA, IB, I, or II is selected from the group consisting of hydrogen, substituted or unsubstituted linear or branched alkyl, alkenyl, alkynyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. Each represent a separate embodiment of this invention. In another embodiment, R.sub.4 is a hydrogen. In another embodiment, R.sub.4 is C.sub.1-C.sub.10 alkyl. In another embodiment, R.sub.4 is methyl. In another embodiment, R.sub.4 is substituted or substituted benzyl. In another embodiment, R.sub.4 is benzyl. In another embodiment, R.sub.4 is substituted or substituted aryl. In another embodiment, R.sub.4 is substituted or substituted benzyl. In another embodiment, R.sub.4 is benzyl. In another embodiment, R.sub.4 is substituted or unsubstituted phenyl. In another embodiment, R.sub.4 is halo substituted phenyl. In another embodiment, R.sub.4 is 4-bromo-phenyl. In another embodiment, R.sub.4 is alkyl substituted phenyl. In another embodiment, R.sub.4 is 4-methyl-phenyl. In another embodiment, R.sub.4 is OH. In another embodiment, R.sub.4 is any group that forms a urea, an amide, a thiourea, hydrazide or hydroxamic acid (via the nitrogen). In some embodiments, R.sub.4 of the compound of Formula IA, IB, I, II, III or IV is selected from the group consisting of hydrogen, unsubstituted C.sub.1-C.sub.10 alkyl, substituted C.sub.1-C.sub.10 alkyl, substituted or unsubstituted benzyl, unsubstituted aryl, and substituted aryl. In some embodiments, R.sub.4 of the compound of Formula IA, IB, I, II, III or IV is selected from the group consisting of hydrogen, unsubstituted C.sub.1-C.sub.6 alkyl, substituted C.sub.1-C.sub.6 alkyl, unsubstituted phenyl, and substituted phenyl. In some embodiments, R.sub.4 of the compound of Formula IA, IB, I, II, III or IV is selected from the group consisting of hydrogen, unsubstituted C.sub.1-C.sub.6 alkyl, substituted C.sub.1-C.sub.6 alkyl, substituted or unsubstituted benzyl, unsubstituted phenyl, and substituted phenyl. In some embodiments, R.sub.4 of the compound of Formula IA, IB I, II, III or IV is selected from the group consisting of hydrogen, unsubstituted C.sub.1-C.sub.3 alkyl, benzyl, unsubstituted phenyl, and phenyl substituted with halo or C.sub.1-C.sub.3 alkyl.
[0128] In some embodiments, R.sub.3 of the compound of Formula IA, IB, I, or II is selected from the group consisting of hydrogen, unsubstituted C.sub.1-C.sub.10 alkyl, substituted C.sub.1-C.sub.10 alkyl, unsubstituted aryl, and substituted aryl; and R.sub.4 is hydrogen. In some embodiments, R.sub.3 of the compound of Formula IA, IB, I, or II is selected from the group consisting of hydrogen, unsubstituted C.sub.1-C.sub.6 alkyl, substituted C.sub.1-C.sub.6 alkyl, unsubstituted phenyl, and substituted phenyl; and R.sub.4 is hydrogen. In some embodiments, R.sub.3 of the compound of Formula IA, IB, I, or II is selected from the group consisting of hydrogen, unsubstituted C.sub.1-C.sub.6 alkyl, substituted C.sub.1-C.sub.6 alkyl, unsubstituted phenyl, and substituted phenyl; and R.sub.4 is hydrogen. In some embodiments, R.sub.3 of the compound of Formula IA, IB, I, or II is selected from the group consisting of hydrogen, unsubstituted C.sub.1-C.sub.3 alkyl, benzyl, unsubstituted phenyl, and phenyl substituted with halo or C.sub.1-C.sub.3 alkyl; and R.sub.4 is hydrogen.
[0129] In some embodiments, R.sub.3 of the compound of Formula III or Formula IV is selected from the group consisting of C.sub.1-C.sub.10 alkyl, benzyl, or phenyl, wherein the C.sub.1-C.sub.10 alkyl of R.sub.3 is unsubstituted or substituted with halo, hydroxy, alkoxy, cyano, or oxo; and the benzyl or phenyl of R.sub.3 is unsubstituted or substituted with halo, alkyl, hydroxy, alkoxy, or cyano; and R.sub.1 is of Formula A. In some embodiments, R.sub.3 of the compound of Formula III or Formula IV is selected from the group consisting of C.sub.1-C.sub.10 alkyl, benzyl, or phenyl, wherein the C.sub.1-C.sub.10 alkyl of R.sub.3 is unsubstituted or substituted with halo, hydroxy, alkoxy, cyano, or oxo; and the benzyl or phenyl of R.sub.3 is unsubstituted or substituted with halo, alkyl, hydroxy, alkoxy, or cyano; and R.sub.1 is of Formula A wherein Q is tertiary C.sub.4-C.sub.6 alkyl, or C.sub.5-C.sub.7 cycloalkyl, each of which is unsubstituted or substituted by halo, hydroxy, alkoxy, cyano, or oxo. In some embodiments, R.sub.3 of the compound of Formula III or Formula IV is selected from the group consisting of C.sub.1-C.sub.10 alkyl, benzyl, or phenyl, wherein the C.sub.1-C.sub.10 alkyl of R.sub.3 is unsubstituted or substituted with halo, hydroxy, alkoxy, cyano, or oxo; and the benzyl or phenyl of R.sub.3 is unsubstituted or substituted with halo, alkyl, hydroxy, alkoxy, or cyano; and R.sub.1 is of Formula A wherein Q is tert-butyl or cyclohexyl. In some such embodiments, Q is tert-butyl.
[0130] In some embodiments, R.sub.3 of the compound of Formula III or Formula IV is selected from the group consisting of C.sub.1-C.sub.3 alkyl, benzyl, or phenyl, wherein the C.sub.1-C.sub.3 alkyl of R.sub.3 is unsubstituted or substituted with halo, hydroxy, alkoxy, cyano, or oxo; and the benzyl or phenyl of R.sub.3 is unsubstituted or substituted with halo, alkyl, hydroxy, alkoxy, or cyano; and R.sub.1 is of Formula A. In some embodiments, R.sub.3 of the compound of Formula III or Formula IV is selected from the group consisting of C.sub.1-C.sub.3 alkyl, benzyl, or phenyl, wherein the C.sub.1-C.sub.3 alkyl of R.sub.3 is unsubstituted or substituted with halo, hydroxy, alkoxy, cyano, or oxo; and the benzyl or phenyl of R.sub.3 is unsubstituted or substituted with halo, alkyl, hydroxy, alkoxy, or cyano; and R.sub.1 is of Formula A, wherein Q is tertiary C.sub.4-C.sub.6 alkyl, or C.sub.5-C.sub.7 cycloalkyl, each of which is unsubstituted or substituted by halo, hydroxy, alkoxy, cyano, or oxo. In some embodiments, R.sub.3 of the compound of Formula III or Formula IV is selected from the group consisting of C.sub.1-C.sub.3 alkyl, benzyl, or phenyl, wherein the C.sub.1-C.sub.3 alkyl of R.sub.3 is unsubstituted or substituted with halo, hydroxy, alkoxy, cyano, or oxo; and the benzyl or phenyl of R.sub.3 is unsubstituted or substituted with halo, alkyl, hydroxy, alkoxy, or cyano; and R.sub.1 is of Formula A, wherein Q is tert-butyl or cyclohexyl. In some such embodiments, Q is tert-butyl.
[0131] In some embodiments, R.sub.3 of the compound of Formula III or Formula IV is selected from the group consisting of unsubstituted C.sub.1-C.sub.3 alkyl, unsubstituted benzyl, or phenyl, wherein the phenyl of R.sub.3 is unsubstituted or substituted with halo, C.sub.1-C.sub.3 alkyl, hydroxy, alkoxy, or cyano; and R.sub.1 is of Formula A, wherein Q is tertiary C.sub.4-C.sub.6 alkyl, or C.sub.5-C.sub.7 cycloalkyl, each of which is unsubstituted or substituted by halo, hydroxy, alkoxy, cyano, or oxo. In some embodiments, R.sub.3 of the compound of Formula III or Formula IV is selected from the group consisting of unsubstituted C.sub.1-C.sub.3 alkyl, unsubstituted benzyl, or phenyl, wherein the phenyl of R.sub.3 is unsubstituted or substituted with halo, C.sub.1-C.sub.3 alkyl, hydroxy, alkoxy, or cyano; and R.sub.1 is of Formula A, wherein Q is tert-butyl or cyclohexyl. In some such embodiments, Q is tert-butyl.
[0132] In some embodiments, R.sub.3 of the compound of Formula III or Formula IV is selected from the group consisting of unsubstituted C.sub.1-C.sub.3 alkyl, unsubstituted benzyl, or phenyl, wherein the phenyl of R.sub.3 is unsubstituted or substituted with halo or C.sub.1-C.sub.3 alkyl; and R.sub.1 is of Formula A, wherein Q is tertiary C.sub.4-C.sub.6 alkyl, or C.sub.5-C.sub.7 cycloalkyl, each of which is unsubstituted or substituted by halo, hydroxy, alkoxy, cyano, or oxo. In some embodiments, R.sub.3 of the compound of Formula III or Formula IV is selected from the group consisting of unsubstituted C.sub.1-C.sub.3 alkyl, unsubstituted benzyl, or phenyl, wherein the phenyl of R.sub.3 is unsubstituted or substituted with halo or C.sub.1-C.sub.3 alkyl; and R.sub.1 is of Formula A, wherein Q is tert-butyl or cyclohexyl. In some such embodiments, Q is tert-butyl.
[0133] In some embodiments R.sub.3 and R.sub.4 of formula IA, IB, I or II form together a five or six membered ring together with the nitrogen. The ring can be substituted or unsubstituted. Non limited rings include: pyridine, piperidine, pyperazine, morpholine, pyrrolidine or pyrimidine.
[0134] In some embodiments, L.sub.1 of the compound of Formula IB, I, or II, is a bond, substituted or unsubstituted linear or branched alkylene, substituted or unsubstituted linear or branched alkenylene, substituted or unsubstituted linear or branched alkynylene, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocyclic, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, or an ether group. Each represent a separate embodiment of this invention. In another embodiment, L.sub.1 is a bond.
[0135] In some embodiments, L.sub.2 of the compound of Formula IA, IB, I, II, or III is substituted or unsubstituted linear or branched alkylene, substituted or unsubstituted linear or branched alkenylene, substituted or unsubstituted linear or branched alkynylene, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocyclic, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, or an ether group. Each represent a separate embodiment of this invention. In another embodiment, L.sub.2 is C.sub.1-C.sub.10 alkylene. In another embodiment, L.sub.2 is C.sub.1-C.sub.5 alkylene. In another embodiment, L.sub.2 is C.sub.1-C.sub.3 alkylene. In another embodiment L.sub.2 is methylene.
[0136] In some embodiments, W of the compound of Formula IA, IB, I, II, or III is O, S or NRs. Each represent a separate embodiment of this invention. In another embodiment, W is O. In another embodiment, W is S. In another embodiment, W is NR.sub.5. In another embodiment, R wherein W is NR.sub.5 is selected from the group consisting of hydrogen, alkyl, alkenyl, alkynyl. Each represent a separate embodiment of this invention.
[0137] In some embodiments, Y and Z of the compound of Formula IA, IB, I, or II are each independently selected from the group consisting of O, S and NH. Each represent a separate embodiment of this invention. In some embodiments, Y and Z are each independently selected from the group consisting of O and NH. In some embodiments, Y is O and Z is O or NH. In some embodiments, Y is O and Z is O. In another embodiment, Y is O. In another embodiment, Z is O. In some of any of the respective embodiments described herein, Y and Z are each oxygen, thus forming a cyclic sulfone. In some such embodiments, n is 2 such that the cyclic sulfone is a sulfolane or sulfolene. In some such embodiments, n is 2 such that the cyclic sulfone is a sulfolane.
[0138] In some embodiments, Ra, Rb and Rc of the compound of Formula IA, IB, or I are each independently selected from the group consisting of hydrogen, alkyl, alkenyl, alkynyl, cycloalkyl, aryl, heteroaryl, heterocyclic, halo, hydroxy, alkoxy, aryloxy, thiohydroxy, thioalkoxy, thioaryloxy, sulfinyl, sulfonyl, sulfonate, sulfate, cyano, nitro, azide, phosphonyl, phosphinyl, carbonyl, thiocarbonyl, a urea group, a thiourea group, O-carbamyl, N-carbamyl, O-thiocarbamyl, N-thiocarbamyl, C-amido, N-amido, C-carboxy, O-carboxy, sulfonamido, guanyl, guanidinyl, hydrazine, hydrazide, thiohydrazide, and amino. Each represent a separate embodiment of this invention. In another embodiments, Ra is hydrogen. In another embodiments, Rb is hydrogen. In another embodiment, Rb and Rc are each hydrogen. In some embodiment, Ra, Rb and Rc are each hydrogen.
[0139] In some embodiments, n of the compound of Formula IA, 1, or I is an integer between 1-4. In another embodiment, n is 1. In another embodiment, n is 2. In another embodiment, n is 3. In another embodiment, n is 4.
[0140] In some embodiments, X.sub.1 and X.sub.2 of the compound of Formula TB are each independently O, N, or CH. Each represent a separate embodiment of this invention. In another embodiment, X.sub.1 is O. In another embodiment, X.sub.1 is N. In another embodiment, X.sub.1 is CHI. In another embodiment, X.sub.2 is N. In another embodiment, X.sub.2 is O. In another embodiment, X.sub.2 is CHI. In another embodiment, if X.sub.2 is O, then R.sub.1 is nothing/absent.
[0141] In some embodiments, the compound of this invention is presented by the structures of Formula IA, IB, I, II, III, IV, or a pharmaceutically acceptable salt thereof.
[0142] In some embodiments, exemplified compounds of the compounds of Formula IA, IB, I, II, III and IV of this invention are represented in Table 1 (
TABLE-US-00001 TABLE 1 Exemplified compounds of the compounds of Formula IA, IB, I, II, III and IV. Compound number Structure 4b
Synthesis of Sulfamate Compounds
[0143] In some embodiments, provided herein is a synthesis of Sulfamate compounds of this invention, as shown in scheme 1:
##STR00019##
wherein, [0144] X is a leaving group; [0145] the represents saturated or non-saturated bond; [0146] Y and Z are each independently selected from the group consisting of O, S and NH; [0147] each of R.sub.2, Ra, Rb and Rc are independently selected from the group consisting of hydrogen, alkyl, alkenyl, alkynyl, cycloalkyl, aryl, heteroaryl, heterocyclic, halo, hydroxy, alkoxy, aryloxy, thiohydroxy, thioalkoxy, thioaryloxy, sulfinyl, sulfonyl, sulfonate, sulfate, cyano, nitro, azide, phosphonyl, phosphinyl, carbonyl, thiocarbonyl, a urea group, a thiourea group, O-carbamyl, N-carbamyl, O-thiocarbamyl, N-thiocarbamyl, C-amido, N-amido, C-carboxy, O-carboxy, sulfonamido, guanyl, guanidinyl, hydrazine, hydrazide, thiohydrazide, and amino, or alternatively, R.sub.2 is absent when the dashed line represents an unsaturated bond; [0148] each of R.sub.1, R.sub.3 and R.sub.4 are independently selected from the group consisting of hydrogen, OH, any group that forms a urea, an amide, a thiourea, hydrazide or hydroxamic acid (via the nitrogen), substituted or unsubstituted linear or branched alkyl, alkenyl, alkynyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl; [0149] n is 1, 2, 3 or 4; and [0150] L.sub.1 is a bond, substituted or unsubstituted linear or branched alkylene, substituted or unsubstituted linear or branched alkenylene, substituted or unsubstituted linear or branched alkynylene, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocyclic, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, or an ether group.
[0151] In some embodiments, DIPEA (N,N-diisopropylethylamine) is added to the reaction.
[0152] In some embodiments, X is a halo group. In another embodiment, X is Cl. In another embodiment, X is Br. In another embodiment, X is F. In another embodiment, X is I.
Modulation of the Activity of Pint
[0153] According to some embodiments of the present invention, a compound as described herein has high affinity to the catalytic binding site of Pin1.
[0154] In some embodiments, there is provided a compound for use in modulating an activity of Pin1, the compound comprising an electrophilic moiety (E) and rigid moiety (G), wherein the electrophilic moiety and the rigid moiety are arranged such that the electrophilic moiety is capable of covalently binding to the Cys113 residue of Pin1, and the rigid moiety is capable of forming hydrogen bonds with the Gln131 and His 157 residues of Pin1; and the sulfamate group forms hydrogen bonds with Pin1.
[0155] In another embodiment, the sulfamate group forms additional hydrogen bonds with protein Pin1 (according to the modeling in
[0156] In some embodiments, the sulfamate compounds of this invention show advantages over conventional electrophiles such as acrylamides and chloroacetamides in terms of tunability of its intrinsic thiol reactivity, amino acid selectivity, and buffer/metabolic stability. Further, acrylamides, including ibrutinib[Scheers, E.; Leclercq, L.; de Jong, J.; Bode, N.; Bockx, M.; Laenen, A.; Cuyckens, F.; Skee, D.; Murphy, J.; Sukbuntherng, J.; Mannens, G. Absorption, Metabolism, and Excretion of Oral 14C Radiolabeled Ibrutinib: An Open-Label, Phase I, Single-Dose Study in Healthy Drug Metab. Dispos. 2015, 43 (2), 289-297, which is incorporated herein by reference], are oxidatively metabolized to epoxides, which are extremely reactive. Although such epoxides are rapidly destroyed by hydrolysis or GSH conjugation, they could potentially react with proteins resulting in haptenization. [Tang, L. W. T.; Fu, J.; Koh, S. K.; Wu, G.; Zhou, L.; Chan, E. C. Y. Drug Metabolism and Disposition. 2022, pp 931-941. https.//doi.org/, which is incorporated herein by reference]. By contrast, it seems plausible that sulfamate-acetamides would not be converted into even more reactive metabolites. In some embodiments, the sulfamic acid leaving group can self-immolatively dissociate into an amine functionality with the release of sulfur trioxide allowing further functionalization.
[0157] In some embodiment, the rigid moiety is capable of forming a hydrogen bond with a backbone amide hydrogen of the Gln131 and/or with an imidazole NH of the His157 or Pin1.
[0158] In some embodiments, the rigid moiety is or comprises a sulfolane or a sulfolene.
[0159] According to some of any of the embodiments described herein, the compound further comprises a hydrophobic moiety. In some embodiments, R.sub.1 of Formula IA, IB, I, II, III and IV is a hydrophobic moiety.
[0160] According to some of any of the embodiments described herein relating to a hydrophobic moiety, the hydrophobic moiety forms a hydrophobic interaction with Ser115, Leu122 and/or Met130 of Pin1.
[0161] According to an aspect of some embodiments of the invention, there is provided a method of modulating an activity of Pin1, the method comprising contacting the Pin1 with a compound according to any of the respective embodiments described herein.
[0162] In some embodiments, the compounds of this invention of Formula IA, IB, I, II, III, IV or a pharmaceutically acceptable salt thereof are suitable for in vivo covalent targeting. In some embodiments, the compounds of this invention are suitable for in vivo covalent targeting of Pin 1.
[0163] In some embodiments, the Sulfamate compound for use as modulating Pin1 forms a covalent bond between the Cys113 residue of Pin1 and a carbon near the sulfamate group (electrophilic site), and releases a sulfamic acid leaving group; and hydrogen bonds are formed between Gln131 and His 157 residues of Pin1 and the sulfolane ring; and between protein Pin1 and the sulfamate side-chain.
[0164] In some embodiments, the additional side-chain of the sulfamate can mediate additional interactions with the protein and improve the reversible affinity. (
[0165] In another embodiment, said sulfamic acid leaving group will dissociate into sulfur trioxide and free amine [Benson, G. A., Anthony Benson, G. & Spillane, W. J. Chemical Reviews vol. 80 151-186 (1980), which is incorporated herein by reference].
[0166] In some embodiments, the present invention refers to compounds of Formula IA, IB, I, II, III, IV or a pharmaceutically acceptable salt thereof, selective modulators of Pin1 activity, wherein the compounds of this invention are covalent inhibitors of Pin1. In some embodiments, the compound of this invention of Formula IA, IB, I, II, III, IV, 4a-4g, or a pharmaceutically acceptable salt thereof is selective covalent active site (catalytic domain) inhibitor of Pin1, as well as the effects of selective modulation of Pin1 activity in various physiological models.
[0167] As used herein, the phrase catalytic domain describes a region of an enzyme, Pin1, in which the catalytic reaction occurs. This phrase therefore describes this part of an enzyme in which the substrate and/or other components that participate in the catalytic reaction interacts with the enzyme. In the context of the present embodiments, this phrase is particularly used to describe this part of an enzyme (a Pin1) to which the substrate binds during the catalytic activity (e.g., phosphorylation). This phrase is therefore also referred to herein and in the art, interchangeably, as substrate binding pocket, catalytic site active site and the like.
[0168] As used herein, the phrases binding site, catalytic binding site or binding subsite, which are used herein interchangeably, describe a specific site in the catalytic domain that includes one or more reactive groups through which the interactions of the enzyme with the substrate and/or an inhibitor can be effected. Typically, the binding site is composed of one or two amino acid residues, whereby the interactions typically involve reactive groups at the side chains of these amino acids.
[0169] As is well known in the art, when an enzyme interacts with a substrate or an inhibitor, the initial interaction rapidly induces conformational changes, in the enzyme and/or substrate and/or inhibitor, that strengthen binding and bring enzyme's binding sites close to functional groups in the substrate or inhibitor. Enzyme-substrate/inhibitor interactions orient reactive groups present in both the enzyme and the substrate/inhibitor and bring them into proximity with one another. The binding of the substrate/inhibitor to the enzyme aligns the reactive groups so that the relevant molecular orbitals overlap.
[0170] Thus, an inhibitor of an enzyme is typically associated with the catalytic domain of the enzyme such that the reactive groups of the inhibitor are positioned in sufficient proximity to corresponding reactive groups (typically side chains of amino acid residues) in the enzyme catalytic binding site, so as to allow the presence of an effective concentration of the inhibitor in the catalytic binding site and, in addition, the reactive groups of the inhibitor are positioned in a proper orientation, to allow overlap and thus a strong chemical interaction and low dissociation. An inhibitor therefore typically includes structural elements that are known to be involved in the interactions, and may also have a restriction of its conformational flexibility, so as to avoid conformational changes that would affect or weaken its association with catalytic binding site.
[0171] The present inventors have uncovered that a series of structurally similar small molecules efficiently bind, covalently, to the Cys113 residue of Pin1, and have designed, based on these findings, and successfully practiced, small molecules that are capable of interacting with Pin1. The present inventors have identified that the structural features of the newly designed compounds that allow efficient interaction within the catalytic domain of Pin1, for example, such that reactivity with Cys113 is far higher than with other thiol groups.
[0172] In some embodiments, the compounds of the present invention, such as compounds of Formula I, IA, IB, II, III, or IV are selective inhibitors of Pin1. In some embodiments, the compounds of the present invention, such as compounds of Formula I, II, III, or IV are selective inhibitors of Pin1. In some embodiments, the compounds of the present invention, such as compounds of Formula I, IA, IB, II, III, IV, 4a-4g or pharmaceutically acceptable salt thereof are selective inhibitors of Pin1.
[0173] In some embodiments, the compound is such that, upon contacting the Pin1 catalytic binding site, one of its functional groups covalently binds the Cys113 residue of Pin1, and one or more other functional groups are in a proximity and orientation, as defined hereinabove, with respect to at least one another amino acid residue within the catalytic binding site of Pin1.
[0174] By proximity and orientation it is meant that, as discussed hereinabove, the functional group(s) are sufficiently close and properly oriented so as to strongly interact with the one or more amino acid residues (e.g., other than the Cys113) within the catalytic domain of the enzyme.
[0175] By interacting or interact, in the context of a functional group of the compound and an amino acid residue in the catalytic domain, it is meant a chemical interaction as a result of, for example, non-covalent interactions such as, but not limited to, hydrophobic interactions, including aromatic interactions, electrostatic interactions, Van der Waals interactions and hydrogen bonding. The interaction is such that results in the low dissociation constant of the compound-enzyme complex as disclosed herein.
[0176] The compounds described in some embodiments of any of the aspects of the present embodiments, and any combination thereof are characterized by electrophilic moiety and a rigid moiety that comprises at least one functional group that is capable of interacting with one or more amino acid residues in the catalytic domain of Pin1.
[0177] In some embodiments, the functional group(s) of the rigid moiety is/are capable of forming hydrogen bonds with hydrogen atoms of one or more amino acid residues in the catalytic domain of Pin1.
[0178] In some embodiments, the electrophilic moiety and the rigid moiety are arranged such that the electrophilic moiety is capable of covalently binding to the Cys113 residue of the Pin1 (SEQ ID NO: 1), and the rigid moiety is capable of forming hydrogen bonds with the Gln131 and His 157 residues of Pin1 (having the following amino acid sequence:
TABLE-US-00002 (SEQIDNO:1) MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQ GEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKS GEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMS GPVFTDSGIHIILRTE.
[0179] In some embodiments, the compound is such that when it contacts Pin1, the functional group(s) of the rigid moiety are in proximity and orientation with respect to the electrophilic group (prior to its covalent binding to Cys113), and to amino acid residues in the catalytic domain of Pin1 (e.g., the Gln131 and His 157 residues of Pin1), e.g., via hydrogen bonding, such that the electrophilic group is in proximity and orientation with respect to Cys113, thereby facilitating covalent binding of the Cys113 to the electrophilic group.
[0180] In some embodiments, the compound is such that when it contacts Pin1, the functional group(s) of the rigid moiety are in proximity and orientation with respect to the electrophilic group after its covalent binding to Cys113, that allow interaction, e.g., via hydrogen bonding, with other amino acid residues in the catalytic domain of Pin1 (e.g., with the Gln131 and His 157 residues of Pin1).
[0181] In some embodiments, the functional group (comprised by the rigid moiety) is capable of forming a hydrogen bond with a backbone amide hydrogen of the Gln131 and/or with an imidazole NH of the His157. In some embodiments, the rigid moiety comprises a functional group capable of forming a hydrogen bond with a backbone amide hydrogen of the Gln131, and another functional group capable of forming a hydrogen bond with an imidazole NH of the His157. In some embodiments, a distance between an atom of the functional group (e.g., O, S or N) and a nitrogen atom of Gln131 or His157 linked to the functional group via a hydrogen bond is in a range of from about 2.5 to 3.5 , optionally in a range of from about 2.7 to 3.3 .
[0182] Herein throughout, numbering of the amino acid residues of Pin1 is in accordance with SEQ ID NO: 1.
[0183] As used herein and known in the art, a hydrogen bond is a relatively weak bond that forms a type of dipole-dipole attraction which occurs when a hydrogen atom bonded to a strongly electronegative atom exists in the vicinity of another electronegative atom with a lone pair of electrons.
[0184] The hydrogen atom in a hydrogen bond is partly shared between two relatively electronegative atoms.
[0185] Hydrogen bonds typically have energies of about 1-3 kcal mol.sup.1 (4-13 kJ mol.sup.1), and their bond distances (measured from the hydrogen atom) typically range from about 1.5 to 2.6 .
[0186] A hydrogen-bond donor is the group that includes both the atom to which the hydrogen is more tightly linked and the hydrogen atom itself, whereas a hydrogen-bond acceptor is the atom less tightly linked to the hydrogen atom. The relatively electronegative atom to which the hydrogen atom is covalently bonded pulls electron density away from the hydrogen atom so that it develops a partial positive charge (.sup.+). Thus, it can interact with an atom having a partial negative charge (.sup.) through an electrostatic interaction.
[0187] Atoms that typically participate in hydrogen bond interactions, both as donors and acceptors, include oxygen, nitrogen and fluorine. These atoms typically form a part of chemical group or moiety such as, for example, carbonyl, carboxylate, amide, hydroxyl, amine, imine, alkyl fluoride, F.sub.2, and more. However, other electronegative atoms and chemical groups or moieties containing same may participate in hydrogen bonding.
[0188] In some of any of the embodiments described herein, the compound further comprising a hydrophobic moiety, e.g., attached to the electrophilic moiety and/or to the rigid moiety. In some embodiments, the hydrophobic moiety forms a hydrophobic interaction with Ser115, Leu122 and/or Met130 of Pin1.
[0189] Herein, the term hydrophobic moiety refers to a moiety for which a corresponding compound (i.e., a compound consisting of the moiety and one or more hydrogen atoms attached thereto) is water-insoluble, that is, a solubility of such a compound in water is less than 1 weight percent, e.g., at room temperature (at a pH of about 7). In some embodiments, R.sub.1 of Formulas IA, IB, I, II, III or IV is hydrophobic moiety.
[0190] In some of any of the embodiments described herein, the functional moiety forming hydrogen bonds is an oxygen atom (O), a sulfur atom (S) and/or NH.
[0191] A plurality of functional moieties may optionally be the same or different and may optionally be attached to the same position in the rigid moiety (e.g., cyclic moiety) and/or at different positions.
[0192] In some of any of the embodiments described herein, two or more functional moieties forming hydrogen bonds are attached to the same atom, for example, a sulfur atom, in the rigid moiety. In some embodiments, the functional moieties are oxygen atoms, and two oxygen atoms attached to the sulfur atom form a sulfone (S(O).sub.2) group. In some embodiments, the sulfur atom of the sulfone is a member of a ring, that is, a cyclic sulfone (e.g., a sulfolane or sulfolene).
[0193] In some embodiments, exemplified compounds of the compounds of Formula IA, IB, I, II, III and IV of this invention include compounds 4b-4g.
[0194] In some embodiments, the compounds of this invention the compounds of Formula IA, IB, I, II, III and IV or a pharmaceutically acceptable salt thereof or a pharmaceutically acceptable salt thereof or compounds 4b-4g or a pharmaceutically acceptable salt thereof show prolonged buffer stability than Sulfopin.
[0195] In some embodiments, the compounds of Formula IA, IB, I, II, III and IV or compounds 4b-4g or a pharmaceutically acceptable salt thereof show lower off-target thiol reactivity and higher selectivity for Pin1 relative to Sulfopin (
[0196] In some embodiments, and not to be bound to any theory, the compound of Formula IA, IB, I, II, III and IV or a pharmaceutically acceptable salt thereof or compounds 4b-4g or a pharmaceutically acceptable salt thereof bind to bind to a secondary pocket near the active site of Pin1. (
[0197] In some embodiments, the Sulfamate compounds provided herein show similar proteomic selectivity and cellular engagement to Sulfopin.
[0198] According to some of any of the embodiments described herein, the compound of Formula IA, IB, I, II, III, IV or a pharmaceutically acceptable salt thereof is for use in modulating an activity of Pin1.
[0199] According to some of any of the embodiments described herein, the compound of Formula IA, IB, I, II, III, IV or a pharmaceutically acceptable salt thereof is for use in treating a condition in which modulating an activity of Pin1 is beneficial.
[0200] According to some of any of the embodiments described herein relating to a condition in which modulating an activity of Pin1 is beneficial, the condition is a proliferative disease or disorder and/or an immune disease or disorder.
[0201] According to some of any of the embodiments described herein relating to a proliferative disease or disorder, the proliferative disease or disorder is a cancer.
[0202] According to some of any of the embodiments described herein relating to a proliferative disease or disorder, the proliferative disease or disorder is selected from the group consisting of a pancreatic cancer, a neuroblastoma, a prostate cancer, an ovarian carcinoma, and a breast adenocarcinoma.
[0203] According to some of any of the embodiments described herein relating to a proliferative disease or disorder, the proliferative disease or disorder is a pancreatic cancer.
[0204] According to some of any of the embodiments described herein relating to a proliferative disease or disorder, the proliferative disease or disorder is a neuroblastoma.
[0205] Unless otherwise defined, all technical and/or scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the invention pertains. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of embodiments of the invention, exemplary methods and/or materials are described below. In case of conflict, the patent specification, including definitions, will control. In addition, the materials, methods, and examples are illustrative only and are not intended to be necessarily limiting.
[0206] Herein, the terms electrophile and electrophilic moiety refer to any moiety capable of reacting with a nucleophile (e.g., a moiety having a lone pair of electrons, a negative charge, a partial negative charge and/or an excess of electrons, for example a thiol group.
[0207] A leaving group as used herein and in the art describes a labile atom, group or chemical moiety that readily undergoes detachment from an organic molecule during a chemical reaction, while the detachment is typically facilitated by the relative stability of the leaving atom, group or moiety thereupon. In other embodiments, the leaving group is sulfamic acid.
[0208] In some embodiments, a compound exhibiting low reactivity with a thiol is a compound for which the rate constant k is no more than about 310.sup.7 M/sec. In some embodiments, the rate constant k is no more than about 210.sup.7 M/sec. In some embodiments, the rate constant k is no more than about 10.sup.7 M/sec. In some embodiments, the rate constant k is no more than about 510.sup.8 M/sec. In some embodiments, the rate constant k is no more than about 310.sup.8 M/sec. In some embodiments, the rate constant k is no more than about 210.sup.8 M/sec. In some embodiments, the rate constant k is no more than about 10.sup.8 M/sec. In some embodiments, the rate constant k is no more than about 510.sup.9 M/sec.
[0209] The present invention, in some embodiments thereof, relates to pharmacology, and more particularly, but not exclusively, to compounds of Formula IA, IB, I, II, III, IV or a pharmaceutically acceptable salt thereof that covalently bind to, and/or modulate the activity of, Pin1 and to uses thereof in, for example, treating diseases associated with Pin1 activity.
[0210] The present inventors have uncovered new compounds for effectively and selectively modulating the activity of Pin1, by laboriously screening compounds capable of covalently reacting with the protein and studying the relationship between structure and activity and off-target toxicity. While reducing the present invention to practice, the inventors have uncovered exemplary compounds which selectively and covalently react with the active site (catalytic domain) of Pin1, as well as the effects of selective modulation of Pin1 activity in various physiological models.
[0211] As used herein, the phrase catalytic domain describes a region of an enzyme, Pin1, in which the catalytic reaction occurs. This phrase therefore describes this part of an enzyme in which the substrate and/or other components that participate in the catalytic reaction interacts with the enzyme. In the context of the present embodiments, this phrase is particularly used to describe this part of an enzyme (a Pin1) to which the substrate binds during the catalytic activity (e.g., phosphorylation). This phrase is therefore also referred to herein and in the art, interchangeably, as substrate binding pocket, catalytic site active site and the like.
[0212] As used herein, the phrases binding site, catalytic binding site or binding subsite, which are used herein interchangeably, describe a specific site in the catalytic domain that includes one or more reactive groups through which the interactions of the enzyme with the substrate and/or an inhibitor can be affected. Typically, the binding site is composed of one or two amino acid residues, whereby the interactions typically involve reactive groups at the side chains of these amino acids.
[0213] As is well known in the art, when an enzyme interacts with a substrate or an inhibitor, the initial interaction rapidly induces conformational changes, in the enzyme and/or substrate and/or inhibitor, that strengthen binding and bring enzyme's binding sites close to functional groups in the substrate or inhibitor. Enzyme-substrate/inhibitor interactions orient reactive groups present in both the enzyme and the substrate/inhibitor and bring them into proximity with one another. The binding of the substrate/inhibitor to the enzyme aligns the reactive groups so that the relevant molecular orbitals overlap.
[0214] Thus, an inhibitor of an enzyme is typically associated with the catalytic domain of the enzyme such that the reactive groups of the inhibitor are positioned in sufficient proximity to corresponding reactive groups (typically side chains of amino acid residues) in the enzyme catalytic binding site, so as to allow the presence of an effective concentration of the inhibitor in the catalytic binding site and, in addition, the reactive groups of the inhibitor are positioned in a proper orientation, to allow overlap and thus a strong chemical interaction and low dissociation. An inhibitor therefore typically includes structural elements that are known to be involved in the interactions, and may also have a restriction of its conformational flexibility, so as to avoid conformational changes that would affect or weaken its association with catalytic binding site.
[0215] Embodiments of the present invention therefore generally relate to newly designed small molecules and to uses thereof, e.g., in modulating an activity of Pin1. The present inventors have identified that the Sulfamate compounds that allow efficient interaction within the catalytic domain of Pin1, for example, such that reactivity with Cys113 is far higher than with other thiol groups.
[0216] According to some embodiments of the present invention, the Sulfamate compound provided herein provides strong association with the catalytic binding site of Pin1.
[0217] In some embodiments, the compound is such that, upon contacting the Pin1 catalytic binding site, one of its functional groups covalently binds the Cys113 residue of Pin1, and one or more other functional groups are in a proximity and orientation, as defined hereinabove, with respect to at least one another amino acid residue within the catalytic binding site of Pin1.
[0218] According to an aspect of some embodiments of the invention, there is provided a use of one or more compounds according to any of the embodiments described herein in the manufacture of a medicament for treating a condition in which modulating an activity of Pin1 is beneficial.
[0219] According to an aspect of some embodiments of the invention, there is provided a method of treating a condition in which modulating an activity of Pin1 is beneficial, the method comprising administering to a subject in need thereof one or more Sulfamate compound according to any of the embodiments described herein.
[0220] According to an aspect of some embodiments of the invention, there is provided a method of modulating an activity of Pin1, the method comprising contacting the Pin1 with one or more Sulfamate compound according to any of the embodiments described herein. Modulation of Pin1 activity may optionally be effected in vitro (e.g., for research purposes) or in vivo (e.g., wherein contacting is effected by administration to a subject in need thereof).
[0221] Herein, the term modulation encompasses up-regulation as well as down-regulation (e.g., by antagonistic binding) of an activity (e.g., of Pin1), and may be effected, e.g., by interacting with an active site (e.g., of Pin1) or by modulating degradation of the protein.
[0222] In some embodiments, provided herein is a method of treating a disease or condition associated with Pin1 activity, comprising administering a compound of this invention, or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition of this invention. In another embodiment, the compound of this invention is I, II, III, or IV. In another embodiment, the compound of this inventions is I, IA, IB, II, III, or IV.
[0223] In some embodiments, provided herein is a method of treating a disease or condition associated with Pin1 activity, comprising administering a compound of Formula I, II, III, or IV or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition comprising a compound of Formula I, II, III, or IV or a pharmaceutically acceptable salt thereof.
[0224] In some embodiments, provided herein is a method of treating a disease or condition associated with Pin1 activity, comprising administering a compound of this invention, or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition of this invention, wherein the disease or condition is a proliferative disease or disorder.
[0225] In some embodiments, provided herein is a method of treating a disease or condition associated with Pin1 activity, comprising administering a compound of this invention, or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition of this invention, wherein the disease is a cancer.
[0226] In some embodiments, provided herein is a method of treating a disease or condition associated with Pin1 activity, comprising administering a compound of this invention, or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition of this invention, wherein the disease is selected from the group consisting of a pancreatic cancer, a neuroblastoma, a prostate cancer, an ovarian carcinoma, and a breast adenocarcinoma.
[0227] In some embodiment, provided herein is a method of treating a disease or condition associated with Pin1 activity, comprising administering a compound of this invention, or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition of this invention, wherein the disease or condition is an immune disease or disorder. In some of any of the respective embodiments described herein, according to any of the aspects described herein, modulating an activity of Pin1 comprises inhibiting an activity of Pin1.
[0228] The term treating refers to inhibiting, preventing or arresting the development of a pathology (disease, disorder or condition) and/or causing the reduction, remission, or regression of a pathology. Those of skill in the art will understand that various methodologies and assays can be used to assess the development of a pathology, and similarly, various methodologies and assays may be used to assess the reduction, remission or regression of a pathology.
[0229] As used herein, the term preventing refers to keeping a disease, disorder or condition from occurring in a subject who may be at risk for the disease but has not yet been diagnosed as having the disease.
[0230] As used herein, the term subject includes mammals, optionally human beings at any age which suffer from the pathology. Optionally, this term encompasses individuals who are at risk to develop the pathology.
[0231] Examples of conditions in which modulating an activity of Pin1 may be beneficial include, without limitation, proliferative diseases or disorders and immune diseases or disorders. The proliferative disease or disorder may be, for example, a cancer or pre-cancer.
[0232] In some of any of the respective embodiments described herein, treatment is for inhibiting initiation of a tumor (optionally neuroblastoma), for example, inhibiting metastases.
[0233] Non-limiting examples of Pin1-associated cancers which can be treated according to some of the respective embodiments of the invention can be any solid or non-solid cancer and/or cancer metastasis, including, but is not limiting to, tumors of the gastrointestinal tract (colon carcinoma, rectal carcinoma, colorectal carcinoma, colorectal cancer, colorectal adenoma, hereditary nonpolyposis type 1, hereditary nonpolyposis type 2, hereditary nonpolyposis type 3, hereditary nonpolyposis type 6; colorectal cancer, hereditary nonpolyposis type 7, small and/or large bowel carcinoma, esophageal carcinoma, tylosis with esophageal cancer, stomach carcinoma, pancreatic carcinoma, pancreatic endocrine tumors), endometrial carcinoma, dermatofibrosarcoma protuberans, gallbladder carcinoma, Biliary tract tumors, prostate cancer, prostate adenocarcinoma, renal cancer (e.g., Wilms' tumor type 2 or type 1), liver cancer (e.g., hepatoblastoma, hepatocellular carcinoma, hepatocellular cancer), bladder cancer, embryonal rhabdomyosarcoma, germ cell tumor, trophoblastic tumor, testicular germ cells tumor, immature teratoma of ovary, uterine, epithelial ovarian, sacrococcygeal tumor, choriocarcinoma, placental site trophoblastic tumor, epithelial adult tumor, ovarian carcinoma, serous ovarian cancer, ovarian sex cord tumors, cervical carcinoma, uterine cervix carcinoma, small-cell and non-small cell lung carcinoma, nasopharyngeal, breast carcinoma (e.g., ductal breast cancer, invasive intraductal breast cancer, sporadic; breast cancer, susceptibility to breast cancer, type 4 breast cancer, breast cancer-1, breast cancer-3; breast-ovarian cancer), squamous cell carcinoma (e.g., in head and neck), neurogenic tumor, astrocytoma, ganglioblastoma, neuroblastoma, lymphomas (e.g., Hodgkin's disease, non-Hodgkin's lymphoma, B cell, Burkitt, cutaneous T cell, histiocytic, lymphoblastic, T cell, thymic), gliomas, adenocarcinoma, adrenal tumor, hereditary adrenocortical carcinoma, brain malignancy (tumor), various other carcinomas (e.g., bronchogenic large cell, ductal, Ehrlich-Lettre ascites, epidermoid, large cell, Lewis lung, medullary, mucoepidermoid, oat cell, small cell, spindle cell, spinocellular, transitional cell, undifferentiated, carcinosarcoma, choriocarcinoma, cystadenocarcinoma), ependimoblastoma, epithelioma, erythroleukemia (e.g., Friend, lymphoblast), fibrosarcoma, giant cell tumor, glial tumor, glioblastoma (e.g., multiforme, astrocytoma), glioma hepatoma, heterohybridoma, heteromyeloma, histiocytoma, hybridoma (e.g., B cell), hypernephroma, insulinoma, islet tumor, keratoma, leiomyoblastoma, leiomyosarcoma, leukemia (e.g., acute lymphatic, acute lymphoblastic, acute lymphoblastic pre-B cell, acute lymphoblastic T cell leukemia, acute-megakaryoblastic, monocytic, acute myelogenous, acute myeloid, acute myeloid with eosinophilia, B cell, basophilic, chronic myeloid, chronic, B cell, eosinophilic, Friend, granulocytic or myelocytic, hairy cell, lymphocytic, megakaryoblastic, monocytic, monocytic-macrophage, myeloblastic, myeloid, myelomonocytic, plasma cell, pre-B cell, promyelocytic, subacute, T cell, lymphoid neoplasm, predisposition to myeloid malignancy, acute nonlymphocytic leukemia), lymphosarcoma, melanoma, mammary tumor, mastocytoma, medulloblastoma, mesothelioma, metastatic tumor, monocyte tumor, multiple myeloma, myelodysplastic syndrome, myeloma, nephroblastoma, nervous tissue glial tumor, nervous tissue neuronal tumor, neurinoma, neuroblastoma, oligodendroglioma, osteochondroma, osteomyeloma, osteosarcoma (e.g., Ewing's), papilloma, transitional cell, pheochromocytoma, pituitary tumor (invasive), plasmacytoma, retinoblastoma, rhabdomyosarcoma, sarcoma (e.g., Ewing's, histiocytic cell, Jensen, osteogenic, reticulum cell), schwannoma, subcutaneous tumor, teratocarcinoma (e.g., pluripotent), teratoma, testicular tumor, thymoma and trichoepithelioma, gastric cancer, fibrosarcoma, glioblastoma multiforme; multiple glomus tumors, Li-Fraumeni syndrome, liposarcoma, lynch cancer family syndrome II, male germ cell tumor, mast cell leukemia, medullary thyroid, multiple meningioma, endocrine neoplasia myxosarcoma, paraganglioma, familial nonchromaffin, pilomatricoma, papillary, familial and sporadic, rhabdoid predisposition syndrome, familial, rhabdoid tumors, soft tissue sarcoma, and Turcot syndrome with glioblastoma.
[0234] Pancreatic cancer (e.g., pancreatic adenocarcinoma) is an exemplary type of cancer treatable according to some embodiments of the invention.
[0235] Pre-cancers are well characterized and known in the art (refer, for example, to Berman J J. and Henson D E., 2003. Classifying the precancers: a metadata approach. BMC Med Inform Decis Mak. 3:8, which is incorporated herein by reference in its entirety). Classes of pre-cancers amenable to treatment via the method of the invention include acquired small or microscopic pre-cancers, acquired large lesions with nuclear atypia, precursor lesions occurring with inherited hyperplastic syndromes that progress to cancer, and acquired diffuse hyperplasias and diffuse metaplasias. Examples of small or microscopic pre-cancers include HGSIL (High grade squamous intraepithelial lesion of uterine cervix), AIN (anal intraepithelial neoplasia), dysplasia of vocal cord, aberrant crypts (of colon), PIN (prostatic intraepithelial neoplasia). Examples of acquired large lesions with nuclear atypia include tubular adenoma, AILD (angioimmunoblastic lymphadenopathy with dysproteinemia), atypical meningioma, gastric polyp, large plaque parapsoriasis, myelodysplasia, papillary transitional cell carcinoma in-situ, refractory anemia with excess blasts, and Schneiderian papilloma. Examples of precursor lesions occurring with inherited hyperplastic syndromes that progress to cancer include atypical mole syndrome, C cell adenomatosis and MEA. Examples of acquired diffuse hyperplasias and diffuse metaplasias include AIDS, atypical lymphoid hyperplasia, Paget's disease of bone, post-transplant lymphoproliferative disease and ulcerative colitis.
[0236] Therapeutic regimens for treatment of cancer suitable for combination with one or more sulfonate or sulfamate compounds according to any of the respective embodiments of the invention include, but are not limited to chemotherapy, radiotherapy, phototherapy and photodynamic therapy, surgery, nutritional therapy, ablative therapy, combined radiotherapy and chemotherapy, brachiotherapy, proton beam therapy, immunotherapy, cellular therapy and photon beam radiosurgical therapy.
[0237] Alternative or additional chemotherapeutic drugs (e.g., anti-cancer drugs) that may optionally be co-administered with the Sulfamate compounds of the invention include, but are not limited to acivicin, aclarubicin, acodazole, acronine, adozelesin, aldesleukin, altretamine, ambomycin, ametantrone, aminoglutethimide, amsacrine, anastrozole, anthramycin, asparaginase, asperlin, azacitidine, azetepa, azotomycin, batimastat, benzodepa, bicalutamide, bisantrene, bisnafide, bizelesin, bleomycin, brequinar, bropirimine, busulfan, cactinomycin, calusterone, caracemide, carbetimer, carboplatin, carmustine, carubicin, carzelesin, cedefingol, chlorambucil, cirolemycin, cisplatin, cladribine, crisnatol, cyclophosphamide, cytarabine, dacarbazine, dactinomycin, daunorubicin, decitabine, dexormaplatin, dezaguanine, diaziquone, docetaxel, doxorubicin, droloxifene, dromostanolone, duazomycin, edatrexate, eflornithine, elsamitrucin, enloplatin, enpromate, epipropidine, epirubicin, erbulozole, esorubicin, estramustine, etanidazole, etoposide, etoprine, fadrozole, fazarabine, fenretinide, floxuridine, fludarabine, fluorouracil, flurocitabine, fosquidone, fostriecin, gemcitabine, hydroxyurea, idarubicin, ifosfamide, ilmofosine, interferon alfa-2a, interferon alfa-2b, interferon alfa-n1, interferon alfa-n3, interferon beta-Ia, interferon gamma-Ib, iproplatin, irinotecan, lanreotide, letrozole, leuprolide, liarozole, lometrexol, lomustine, losoxantrone, masoprocol, maytansine, mechlorethamine, megestrol, melengestrol, melphalan, menogaril, mercaptopurine, methotrexate, metoprine, meturedepa, mitindomide, mitocarcin, mitocromin, mitogillin, mitomalcin, mitomycin, mitosper, mitotane, mitoxantrone, mycophenolic acid, nocodazole, nogalamycin, ormaplatin, oxisuran, paclitaxel, pegaspargase, peliomycin, pentamustine, peplomycin, perfosfamide, pipobroman, piposulfan, piroxantrone, plicamycin, plomestane, porfimer, porfiromycin, prednimustine, procarbazine, puromycin, pyrazofurin, riboprine, rogletimide, safingol, semustine, simtrazene, sparfosate, sparsomycin, spirogermanium, spiromustine, spiroplatin, streptonigrin, streptozocin, sulofenur, talisomycin, tecogalan, tegafur, teloxantrone, temoporfin, teniposide, teroxirone, testolactone, thiamiprine, thioguanine, thiotepa, tiazofurin, tirapazamine, topotecan, toremifene, trestolone, triciribine, trimetrexate, triptorelin, tubulozole, uracil mustard, uredepa, vapreotide, verteporfin, vinblastine, vincristine, vindesine, vinepidine, vinglycinate, vinleurosine, vinorelbine, vinrosidine, vinzolidine, vorozole, zeniplatin, zinostatin, zorubicin, and any pharmaceutically acceptable salts thereof. Additional antineoplastic agents include those disclosed in Chapter 52, Antineoplastic Agents (Paul Calabresi and Bruce A. Chabner), and the introduction thereto, 1202-1263, of Goodman and Gilman's The Pharmacological Basis of Therapeutics, Eighth Edition, 1990, McGraw-Hill, Inc. (Health Professions Division), which are hereby incorporated by reference in their entirety.
[0238] It is expected that during the life of a patent maturing from this application many relevant drugs will be developed and the scope of the terms anti-cancer agent, chemotherapeutic drug, antineoplastic agent and the like are intended to include all such new technologies apriori.
[0239] In some embodiments, an additional anti-cancer agents may optionally be selected in accordance with the condition to be treated, for example, by selecting an agent for use in treating a condition for which the agent (per se) has already been approved, e.g., as indicated in Table 2
TABLE-US-00003 TABLE 2 Anti-cancer agents Aldesleukin Proleukin alitretinoin Panretin Topical treatment of cutaneous lesions in patients with AIDS-related Kaposi's sarcoma. allopurinol Zyloprim Patients with leukemia, lymphoma and solid tumor malignancies who are receiving cancer therapy which causes elevations of serum and urinary uric acid levels and who cannot tolerate oral therapy. altretamine Hexalen Single agent palliative treatment of patients with persistent or recurrent ovarian cancer following first-line therapy with a cisplatin and/or alkylating agent based combination. amifostine Ethyol To reduce the cumulative renal toxicity associated with repeated administration of cisplatin in patients with advanced ovarian cancer amifostine Ethyol To reduce post-radiation xerostomia for head and neck cancer where the radiation port includes a substantial portion of the parotid glands. anastrozole Arimidex Treatment of advanced breast cancer in postmenopausal women with disease progression following tamoxifen therapy. anastrozole Arimidex For first-line treatment of postmenopausal women with hormone receptor positive or hormone receptor unknown locally advanced or metastatic breast cancer. arsenic trioxide Trisenox Second line treatment of relapsed or refractory APL following ATRA plus an anthracycline. Asparaginase Elspar ELSPAR is indicated in the therapy of patients with acute lymphocytic leukemia. This agent is useful primarily in combination with other chemotherapeutic agents in the induction of remissions of the disease in pediatric patients. BCG Live TICE BCG bexarotene capsules Targretin For the treatment by oral capsule of cutaneous manifestations of cutaneous T-cell lymphoma in patients who are refractory to at least one prior systemic therapy. bexarotene gel Targretin For the topical treatment of cutaneous manifestations of cutaneous T-cell lymphoma in patients who are refractory to at least one prior systemic therapy. bleomycin Blenoxane Sclerosing agent for the treatment of malignant pleural effusion (MPE) and prevention of recurrent pleural effusions. busulfan intravenous Busulfex Use in combination with cyclophoshamide as conditioning regimen prior to allogeneic hematopoietic progenitor cell transplantation for chronic myelogenous leukemia. busulfan oral Myleran Chronic Myelogenous Leukemia- palliative therapy calusterone Methosarb capecitabine Xeloda Initial therapy of patients with metastatic colorectal carcinoma when treatment with fluoropyrimidine therapy alone is preferred. Combination chemotherapy has shown a survival benefit compared to 5-FU/LV alone. A survival benefit over 5_FU/LV has not been demonstrated with Xeloda monotherapy. capecitabine Xeloda Treatment in combination with docetaxel of patients with metastatic breast cancer after failure of prior anthracycline containing chemotherapy carboplatin Paraplatin Palliative treatment of patients with ovarian carcinoma recurrent after prior chemotherapy, including patients who have been previously treated with cisplatin. carboplatin Paraplatin Initial chemotherapy of advanced ovarian carcinoma in combination with other approved chemotherapeutic agents. carmustine BCNU, BiCNU carmustine with Gliadel Wafer For use in addition to surgery to prolong Polifeprosan 20 Implant survival in patients with recurrent glioblastoma multiforme who qualify for surgery. chlorambucil Leukeran Chronic Lymphocytic Leukemia- palliative therapy cisplatin Platinol Metastatic testicular-in established combination therapy with other approved chemotherapeutic agents in patients with metastatic testicular tumors whoc have already received appropriate surgical and/or radiotherapeutic procedures. An established combination therapy consists of Platinol, Blenoxane and Velbam. cisplatin Platinol Metastatic ovarian tumors - in established combination therapy with other approved chemotherapeutic agents: Ovarian-in established combination therapy with other approved chemotherapeutic agents in patients with metastatic ovarian tumors who have already received appropriate surgical and/or radiotherapeutic procedures. An established combination consists of Platinol and Adriamycin. Platinol, as a single agent, is indicated as secondary therapy in patients with metastatic ovarian tumors refractory to standard chemotherapy who have not previously received Platinol therapy. cisplatin Platinol as a single agent for patients with transitional cell bladder cancer which is no longer amenable to local treatments such as surgery and/or radiotherapy. cladribine Leustatin, 2-CdA Treatment of active hairy cell leukemia. cyclophosphamide Cytoxan, Neosar cyclophosphamide Cytoxan Injection cyclophosphamide Cytoxan Tablet cytarabine Cytosar-U dacarbazine DTIC-Dome dactinomycin, Cosmegan actinomycin D Darbepoetin alfa Aranesp Treatment of anemia associated with chronic renal failure. Darbepoetin alfa Aranesp Aranesp is indicated for the treatment of anemia in patients with non- myeloid malignancies where anemia is due to the effect of concomitantly administered chemotherapy. daunorubicin liposomal DanuoXome First line cytotoxic therapy for advanced, HIV related Kaposi's sarcoma. daunorubicin, Daunorubicin Leukemia/myelogenous/monocytic/erythroid daunomycin of adults/remission induction in acute lymphocytic leukemia of children and adults. daunorubicin, Cerubidine In combination with approved anticancer daunomycin drugs for induction of remission in adult ALL. dexrazoxane Zinecard Accel. Approv. (clinical benefit subsequently established) Prevention of cardiomyopathy associated with doxorubicin administration dexrazoxane Zinecard reducing the incidence and severity of cardiomyopathy associated with doxorubicin administration in women with metastatic breast cancer who have received a cumulative doxorubicin dose of 300 mg/m2 and who will continue to receive doxorubicin therapy to maintain tumor control. It is not recommended for use with the initiation of doxorubicin therapy. docetaxel Taxotere Accel. Approv. (clinical benefit subsequently established) Treatment of patients with locally advanced or metastatic breast cancer who have progressed during anthracycline- based therapy or have relapsed during anthracycline-based adjuvant therapy. docetaxel Taxotere For the treatment of locally advanced or metastatic breast cancer which has progressed during anthracycline-based treatment or relapsed during anthracycline- based adjuvant therapy. docetaxel Taxotere For locally advanced or metastatic non-small cell lung cancer after failure of prior platinum-based chemotherapy. docetaxel Taxotere in combination with cisplatin for the treatment of patients with unresectable, locally advanced or metastatic non-small cell lung cancer who have not previously received chemotherapy for this condition. doxorubicin Adriamycin, Rubex doxorubicin Adriamycin PFS Antibiotic, antitumor agent. Injectionintravenous injection DROMOSTANOLONE DROMOSTANOLONE PROPIONATE DROMOSTANOLONE MASTERONE PROPIONATE INJECTION Elliott's B Solution Elliott's B Solution Diluent for the intrathecal administration of methotrexate sodium and cytarabine for the prevention or treatment of meningeal leukemia or lymphocytic lymphoma. epirubicin Ellence A component of adjuvant therapy in patients with evidence of axillary node tumor involvement following resection of primary breast cancer. Epoetin alfa epogen EPOGENB is indicated for the reatment of anemia related to therapy with zidovudine in HIV- infected patients. EPOGENB is indicated to elevate or maintain the red blood cell level (as manifested by the hematocrit or hemoglobin determinations) and to decrease the need for transfusions in these patients. EPOGEND is not indicated for the treatment of anemia in HIV-infected patients due to other factors such as iron or folate deficiencies, hemolysis or gastrointestinal bleeding, which should be managed appropriately. Epoetin alfa epogen EPOGENB is indicated for the treatment of anemic patients (hemoglobin >10 to _<13 g/dL) scheduled to undergo elective, noncardiac, nonvascular surgery to reduce the need for allogeneic blood transfusions. Epoetin alfa epogen EPOGENB is indicated for the treatment of anemia in patients with non-myeloid malignancies where anemia is due to the effect of concomitantly administered chemotherapy. EPOGEND is indicated to decrease the need for transfusions in patients who will be receiving concomitant chemotherapy for a minimum of 2 months. EPOGENB is not indicated for the treatment of anemia in cancer patients due to other factors such as iron or folate deficiencies, hemolysis or gastrointestinal bleeding, which should be managed appropriately. Epoetin alfa epogen EPOGEN is indicated for the treatment of anemia associated with CRF, including patients on dialysis (ESRD) and patients not on dialysis. estramustine Emcyt palliation of prostate cancer etoposide phosphate Etopophos Management of refractory testicular tumors, in combination with other approved chemotherapeutic agents. etoposide phosphate Etopophos Management of small cell lung cancer, first- line, in combination with other approved chemotherapeutic agents. etoposide phosphate Etopophos Management of refractory testicular tumors and small cell lung cancer. etoposide, VP-16 Vepesid Refractory testicular tumors-in combination therapy with other approved chemotherapeutic agents in patients with refractory testicular tumors who have already received appropriate surgical, chemotherapeutic and radiotherapeutic therapy. etoposide, VP-16 VePesid In combination with other approved chemotherapeutic agents as first line treatment in patients with small cell lung cancer. etoposide, VP-16 Vepesid In combination with other approved chemotherapeutic agents as first line treatment in patients with small cell lung cancer. exemestane Aromasin Treatment of advance breast cancer in postmenopausal women whose disease has progressed following tamoxifen therapy. Filgrastim Neupogen NEUPOGEN is indicated to reduce the duration of neutropenia and neutropenia- related clinical sequelae, eg, febrile neutropenia, in patients with nonmyeloid malignancies undergoing myeloablative chemotherapy followed by marrow transplantation. Filgrastim Neupogen NEUPOGEN is indicated to decrease the incidence of infection, as manifested by febrile neutropenia, in patients with nonmyeloid malignancies receiving myelosuppressive anticancer drugs associated with a significant incidence of severe neutropenia with fever. Filgrastim Neupogen NEUPOGEN is indicated for reducing the time to neutrophil recovery and the duration of fever, following induction or consolidation hemotherapy treatment of adults with AML. floxuridine FUDR (intraarterial) fludarabine Fludara Palliative treatment of patients with B-cell lymphocytic leukemia (CLL) who have not responded or have progressed during treatment with at least one standard alkylating agent containing regimen. fluorouracil, 5-FU Adrucil prolong survival in combination with leucovorin fulvestrant Faslodex the treatment of hormone receptor-positive metastatic breast cancer in postmenopausal women with disease progression following antiestrogen therapy gemcitabine Gemzar Treatment of patients with locally advanced (nonresectable stage II or III) or metastatic (stage IV) adenocarcinoma of the pancreas. Indicated for first-line treatment and for patients previously treated with a 5- fluorouracil-containing regimen. gemcitabine Gemzar For use in combination with cisplatin for the first-line treatment of patients with inoperable, locally advanced (Stage IIIA or IIIB) or metastatic (Stage IV) non-small cell lung cancer. goserelin acetate Zoladex Implant Palliative treatment of advanced breast cancer in pre- and perimenopausal women. goserelin acetate Zoladex hydroxyurea Hydrea Decrease need for transfusions in sickle cell anemia idarubicin Idamycin For use in combination with other approved antileukemic drugs for the treatment of acute myeloid leukemia (AML) in adults. idarubicin Idamycin In combination with other approved antileukemic drugs for the treatment of acute non-lymphocytic leukemia in adults. ifosfamide IFEX Third line chemotherapy of germ cell testicular cancer when used in combination with certain other approved antineoplastic agents. Interferon alfa-2a Roferon-A Interferon alfa-2b Intron A Interferon alfa-2b, recombinant for injection is indicated as adjuvant to surgical treatment in patients 18 years of age or older with malignant melanoma who are free of disease but at high risk for systemic recurrence within 56 days of surgery. Interferon alfa-2b Intron A Interferon alfa-2b, recombinant for Injection is indicated for the initial treatment of clinically aggressive follicular Non- Hodgkin's Lymphoma in conjunction with anthracycline-containing combination chemotherapy in patients 18 years of age or older. Interferon alfa-2b Intron A Interferon alfa-2b, recombinant for Injection is indicated for intralesional treatment of selected patients 18 years of age or older with condylomata acuminata involving external surfaces of the genital and perianal areas. Interferon alfa-2b Intron A Interferon alfa-2b, recombinant for Injection is indicated for the treatment of chronic hepatitis C in patients 18 years of age or older with compensated liver disease who have a history of blood or blood-product exposure and/or are HCV antibody positive. Interferon alfa-2b Intron A Interferon alfa-2b, recombinant for Injection is indicated for the treatment of chronic hepatitis B in patients 18 years of age or older with compensated liver disease and HBV replication. Interferon alfa-2b Intron A Interferon alfa-2b, recombinant for Injection is indicated for the treatment of patients 18 years of age or older with hairy cell leukemia. Interferon alfa-2b Intron A Interferon alfa-2b, recombinant for Injection is indicated for the treatment of selected patients 18 years of age or older with AIDS- Related Kaposi's Sarcoma. The likelihood of response to INTRON A therapy is greater in patients who are without systemic symptoms, who have limited lymphadenopathy and who have a relatively intact immune system as indicated by total CD4 count. irinotecan Camptosar Accel. Approv. (clinical benefit subsequently established) Treatment of patients with metastatic carcinoma of the colon or rectum whose disease has recurred or progressed following 5-FU-based therapy. irinotecan Camptosar Follow up of treatment of metastatic carcinoma of the colon or rectum whose disease has recurred or progressed following 5-FU-based therapy. irinotecan Camptosar For first line treatment in combination with 5- FU/leucovorin of metastatic carcinoma of the colon or rectum. letrozole Femara Treatment of advanced breast cancer in postmenopausal women. letrozole Femara First-line treatment of postmenopausal women with hormone receptor positive or hormone receptor unknown locally advanced or metastatic breast cancer. letrozole Femara leucovorin Wellcovorin, Leucovorin calcium is indicated for use in Leucovorin combination with 5-fluorouracil to prolong survival in the palliative treatment of patients with advanced colorectal cancer. leucovorin Leucovorin In combination with fluorouracil to prolong survival in the palliative treatment of patients with advanced colorectal cancer. levamisole Ergamisol Adjuvant treatment in combination with 5- fluorouracil after surgical resection in patients with Dukes' Stage C colon cancer. lomustine, CCNU CeeBU meclorethamine, Mustargen nitrogen mustard megestrol acetate Megace melphalan, L-PAM Alkeran Systemic administration for palliative treatment of patients with multiple myeloma for whom oral therapy is not appropriate. mercaptopurine, 6-MP Purinethol mesna Mesnex Prevention of ifosfamide-induced hemorrhagic cystitis methotrexate Methotrexate osteosarcoma methoxsalen Uvadex For the use of UVADEX with the UVAR Photopheresis System in the palliative treatment of the skin manifestations of cutaneous T-cell lymphoma (CTCL) that is unresponsive to other forms of treatment. mitomycin C Mutamycin mitomycin C Mitozytrex therapy of disseminated adenocarcinoma of the stomach or pancreas in proven combinations with other approved chemotherapeutic agents and as palliative treatment when other modalities have failed. mitotane Lysodren mitoxantrone Novantrone For use in combination with corticosteroids as initial chemotherapy for the treatment of patients with pain related to advanced hormone-refractory prostate cancer. mitoxantrone Novantrone For use with other approved drugs in the initial therapy for acute nonlymphocytic leukemia (ANLL) in adults. nandrolone Durabolin-50 phenpropionate Nofetumomab Verluma Oprelvekin Neumega Neumega is indicated for the prevention of severe thrombocytopenia and the reduction of the need for platelet transfusions following myelosuppressive chemotherapy in adult patients with nonmyeloid malignancies who are at high risk of severe thrombocytopenia. paclitaxel Paxene treatment of advanced AIDS-related Kaposi's sarcoma after failure of first line or subsequent systemic chemotherapy paclitaxel Taxol Treatment of patients with metastatic carcinoma of the ovary after failure of first- line or subsequent chemotherapy. paclitaxel Taxol Treatment of breast cancer after failure of combination chemotherapy for metastatic disease or relapse within 6 months of adjuvant chemotherapy. Prior therapy should have included an anthracycline unless clinically contraindicated. paclitaxel Taxol New dosing regimen for patients who have failed initial or subsequent chemotherapy for metastatic carcinoma of the ovary paclitaxel Taxol second line therapy for AIDS related Kaposi's sarcoma. paclitaxel Taxol For first-line therapy for the treatment of advanced carcinoma of the ovary in combination with cisplatin. paclitaxel Taxol for use in combination with cisplatin, for the first-line treatment of non-small cell lung cancer in patients who are not candidates for potentially curative surgery and/or radiation therapy. paclitaxel Taxol For the adjuvant treatment of node-positive breast cancer administered sequentially to standard doxorubicin-containing combination therapy. paclitaxel Taxol First line ovarian cancer with 3 hour infusion. pamidronate Aredia Treatment of osteolytic bone metastases of breast cancer in conjunction with standard antineoplastic therapy. pegademase Adagen (Pegademase Enzyme replacement therapy for patients Bovine) with severe combined immunodeficiency asa result of adenosine deaminase deficiency. Pegaspargase Oncaspar Pegfilgrastim Neulasta Neulasta is indicated to decrease the incidence of infection, as manifested by febrile neutropenia, in patients with non- myeloid malignancies receiving myelosuppressive anti-cancer drugs associated with a clinically significant incidence of febrile neutropenia. pentostatin Nipent Single agent treatment for adult patients with alpha interferon refractory hairy cell leukemia. pentostatin Nipent Single-agent treatment for untreated hairy cell leukemia patients with active disease as defined by clinically significant anemia, neutropenia, thrombocytopenia, or disease- related symptoms. (Supplement for front - line therapy.) pipobroman Vercyte plicamycin, Mithracin mithramycin porfimer sodium Photofrin For use in photodynamic therapy (PDT) for palliation of patients with completely obstructing esophageal cancer, or patients with partially obstructing esophageal cancer who cannot be satisfactorily treated with ND- YAG laser therapy. porfimer sodium Photofrin For use in photodynamic therapy for treatment of microinvasive endobronchial nonsmall cell lung cancer in patients for whom surgery and radiotherapy are not indicated. porfimer sodium Photofrin For use in photodynamic therapy (PDT) for reduction of obstruction and palliation of symptoms in patients with completely or partially obstructing endobroncial nonsmall cell lung cancer (NSCLC). procarbazine Matulane quinacrine Atabrine Rasburicase Elitek ELITEK is indicated for the initial management of plasma uric acid levels in pediatric patients with leukemia, lymphoma, and solid tumor malignancies who are receiving anti-cancer therapy expected to result in tumor lysis and subsequent elevation of plasma uric acid. Rituximab Rituxan Sargramostim Prokine streptozocin Zanosar Antineoplastic agent. talc Sclerosol For the prevention of the recurrence of malignant pleural effusion in symptomatic patients. tamoxifen Nolvadex As a single agent to delay breast cancer recurrence following total mastectomy and axillary dissection in postmenopausal women with breast cancer (T1-3, N1, M0) tamoxifen Nolvadex For use in premenopausal women with metastatic breast cancer as an alternative to oophorectomy or ovarian irradiation tamoxifen Nolvadex For use in women with axillary node- negative breast cancer adjuvant therapy. tamoxifen Nolvadex Metastatic breast cancer in men. tamoxifen Nolvadex Equal bioavailability of a 20 mg Nolvadex tablet taken once a day to a 10 mg Nolvadex tablet taken twice a day. tamoxifen Nolvadex to reduce the incidence of breast cancer in women at high risk for breast cancer tamoxifen Nolvadex In women with DCIS, following breast surgery and radiation, Nolvadex is indicated to reduce the risk of invasive breast cancer. teniposide, VM-26 Vumon In combination with . other approved anticancer agents for induction therapy in patients with refractory childhood acute lymphoblastic leukemia (all). testolactone Teslac thioguanine, 6-TG Thioguanine thiotepa Thioplex topotecan Hycamtin Treatment of patients with metastatic carcinoma of the ovary after failure of initial or subsequent chemotherapy. topotecan Hycamtin Treatment of small cell lung cancer sensitive disease after failure of first-line chemotherapy. In clinical studies submitted to support approval, sensitive disease was defined as disease responding to chemotherapy but subsequently progressing at least 60 days (in the phase 3 study) or at least 90 days (in the phase 2 studies) after chemotherapy toremifene Fareston Treatment of advanced breast cancer in postmenopausal women. Trastuzumab Herceptin HERCEPTIN as a single agent is indicated for the treatment of patients with metastatic breast cancer whose tumors overexpress the HER2 protein and who have received one or more chemotherapy regimens for their metastatic disease. Trastuzumab Herceptin Herceptin in combination with paclitaxel is indicated for treatment of patients with metastatic breast cancer whose tumors overexpress the HER-2 protein and had not received chemotherapy for their metastatic disease tretinoin, ATRA Vesanoid Induction of remission in patients with acute promyelocytic leukemia (APL) who are refractory to or unable to tolerate anthracycline based cytotoxic chemotherapeutic regimens. Uracil Mustard Uracil Mustard Capsules valrubicin Valstar For intravesical therapy of BCG-refractory carcinoma in situ (CIS) of the urinary bladder in patients for whom immediate cystectomy would be associated with unacceptable morbidity or mortality. vinblastine Velban vincristine Oncovin vinorelbine Navelbine Single agent or in combination with cisplatin for the first-line treatment of ambulatory patients with unresectable, advanced non- small cell lung cancer (NSCLC). vinorelbine Navelbine Navelbine is indicated as a single agent or in combination with cisplatin for the first-line treatment of ambulatory patients with unreseactable, advanced non-small cell lung cancer (NSCLC). In patients with Stage IV NSCLC, Navelbine is indicated as a single agent or in combination with cisplatin. In Stage III NSCLC, Navelbine is indicated in combination with cisplatin. zoledronate Zometa the treatment of patients with multiple myeloma and patients with documented bone metastases from solid tumors, in conjunction with standard antineoplastic therapy. Prostate cancer should have progressed after treatment with at least one hormonal therapy
Formulation and Administration:
[0240] The compounds of some embodiments of the invention can be administered to an organism per se, or in a pharmaceutical composition where it is mixed with suitable carriers or excipients.
[0241] As used herein a pharmaceutical composition refers to a preparation of one or more of the active ingredients described herein with other chemical components such as physiologically suitable carriers and excipients. The purpose of a pharmaceutical composition is to facilitate administration of a compound to an organism.
[0242] In some embodiments, provided herein a pharmaceutical composition comprises a compound of Formula IA, I, II, III, IV, a compound selected from compounds 4b, 4c, 4d, 4e, 4f, and 4g, or a pharmaceutically acceptable salt thereof.
[0243] In another embodiment, the pharmaceutical composition of this invention is for use in treating a condition in which modulating an activity of Pin1 is beneficial. In another embodiment, wherein said condition is a proliferative disease or disorder and/or an immune disease or disorder. In another embodiment, the proliferative disease or disorder is a cancer.
[0244] In another embodiment, said proliferative disease or disorder is a selected from the group consisting of a pancreatic cancer, a neuroblastoma, a prostate cancer, an ovarian carcinoma, and a breast adenocarcinoma.
[0245] In some embodiment, this invention is directed to a method for treating a condition in which modulating an activity of Pin1 is beneficial with a pharmaceutical composition of this invention. In another embodiment, said condition is a proliferative disease or disorder and/or an immune disease or disorder.
[0246] Herein the term active ingredient refers to one or more compounds (according to any of the respective embodiments described herein) accountable for the biological effect.
[0247] Hereinafter, the phrases physiologically acceptable carrier and pharmaceutically acceptable carrier, which may be interchangeably used, refer to a carrier or a diluent that does not cause significant irritation to an organism and does not abrogate the biological activity and properties of the administered compound. An adjuvant is included under these phrases.
[0248] Herein the term excipient refers to an inert substance added to a pharmaceutical composition to further facilitate administration of an active ingredient. Examples, without limitation, of excipients include calcium carbonate, calcium phosphate, various sugars and types of starch, cellulose derivatives, gelatin, vegetable oils and polyethylene glycols.
[0249] Techniques for formulation and administration of drugs, as well as exemplary pharmaceutically acceptable carriers, may be found Remington's Pharmaceutical Sciences, Mack Publishing Co., Easton, PA, latest edition, which is incorporated herein by reference.
[0250] Suitable routes of administration may, for example, include oral, rectal, transmucosal, especially transnasal, intestinal or parenteral delivery, including intramuscular, subcutaneous and intramedullary injections as well as intrathecal, direct intraventricular, intracardiac, e.g., into the right or left ventricular cavity, into the common coronary artery, intravenous, intraperitoneal, intranasal, or intraocular injections.
[0251] Conventional approaches for drug delivery to the central nervous system (CNS) include: neurosurgical strategies (e.g., intracerebral injection or intracerebroventricular infusion); molecular manipulation of the agent (e.g., production of a chimeric fusion protein that comprises a transport peptide that has an affinity for an endothelial cell surface molecule in combination with an agent that is itself incapable of crossing the blood-brain barrier, BBB) in an attempt to exploit one of the endogenous transport pathways of the BBB; pharmacological strategies designed to increase the lipid solubility of an agent (e.g., conjugation of water-soluble agents to lipid or cholesterol carriers); and the transitory disruption of the integrity of the BBB by hyperosmotic disruption (resulting from the infusion of a mannitol solution into the carotid artery or the use of a biologically active agent such as an angiotensin peptide). However, each of these strategies has limitations, such as the inherent risks associated with an invasive surgical procedure, a size limitation imposed by a limitation inherent in the endogenous transport systems, potentially undesirable biological side effects associated with the systemic administration of a chimeric molecule comprised of a carrier motif that could be active outside of the CNS, and the possible risk of brain damage within regions of the brain where the BBB is disrupted, which renders it a suboptimal delivery method.
[0252] Alternately, one may administer the pharmaceutical composition in a local rather than systemic manner, for example, via injection of the pharmaceutical composition directly into a tissue region of a patient.
[0253] The term tissue refers to part of an organism consisting of cells designed to perform a function or functions. Examples include, but are not limited to, brain tissue, retina, skin tissue, hepatic tissue, pancreatic tissue, bone, cartilage, connective tissue, blood tissue, muscle tissue, cardiac tissue brain tissue, vascular tissue, renal tissue, pulmonary tissue, gonadal tissue, hematopoietic tissue.
[0254] Pharmaceutical compositions of some embodiments of the invention may be manufactured by processes well known in the art, e.g., by means of conventional mixing, dissolving, granulating, dragee-making, levigating, emulsifying, encapsulating, entrapping or lyophilizing processes.
[0255] Pharmaceutical compositions for use in accordance with some embodiments of the invention thus may be formulated in conventional manner using one or more physiologically acceptable carriers comprising excipients and auxiliaries, which facilitate processing of the active ingredients into preparations which, can be used pharmaceutically. Proper formulation is dependent upon the route of administration chosen.
[0256] For injection, the active ingredients of the pharmaceutical composition may be formulated in aqueous solutions, optionally in physiologically compatible buffers such as Hank's solution, Ringer's solution, or physiological salt buffer. For transmucosal administration, penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art.
[0257] For oral administration, the pharmaceutical composition can be formulated readily by combining the active compounds with pharmaceutically acceptable carriers well known in the art. Such carriers enable the pharmaceutical composition to be formulated as tablets, pills, dragees, capsules, liquids, gels, syrups, slurries, suspensions, and the like, for oral ingestion by a patient. Pharmacological preparations for oral use can be made using a solid excipient, optionally grinding the resulting mixture, and processing the mixture of granules, after adding suitable auxiliaries if desired, to obtain tablets or dragee cores. Suitable excipients are, in particular, fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol; cellulose preparations such as, for example, maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methyl cellulose, hydroxypropylmethyl-cellulose, sodium carboxymethylcellulose; and/or physiologically acceptable polymers such as polyvinyl pyrrolidone (PVP). If desired, disintegrating agents may be added, such as cross-linked polyvinyl pyrrolidone, agar, or alginic acid or a salt thereof such as sodium alginate.
[0258] Dragee cores are provided with suitable coatings. For this purpose, concentrated sugar solutions may be used which may optionally contain gum arabic, talc, polyvinyl pyrrolidone, carbopol gel, polyethylene glycol, titanium dioxide, lacquer solutions and suitable organic solvents or solvent mixtures. Dyestuffs or pigments may be added to the tablets or dragee coatings for identification or to characterize different combinations of active compound doses.
[0259] Pharmaceutical compositions which can be used orally include push-fit capsules made of gelatin as well as soft, sealed capsules made of gelatin and a plasticizer, such as glycerol or sorbitol. The push-fit capsules may contain the active ingredients in admixture with filler such as lactose, binders such as starches, lubricants such as talc or magnesium stearate and, optionally, stabilizers. In soft capsules, the active ingredients may be dissolved or suspended in suitable liquids, such as fatty oils, liquid paraffin, or liquid polyethylene glycols. In addition, stabilizers may be added. All formulations for oral administration should be in dosages suitable for the chosen route of administration.
[0260] For buccal administration, the compositions may take the form of tablets or lozenges formulated in conventional manner.
[0261] For administration by nasal inhalation, the active ingredients for use according to some embodiments of the invention are conveniently delivered in the form of an aerosol spray presentation from a pressurized pack or a nebulizer with the use of a suitable propellant, e.g., dichlorodifluoromethane, trichlorofluoromethane, dichloro-tetrafluoroethane or carbon dioxide. In the case of a pressurized aerosol, the dosage unit may be determined by providing a valve to deliver a metered amount. Capsules and cartridges of, e.g., gelatin for use in a dispenser may be formulated containing a powder mix of the compound and a suitable powder base such as lactose or starch.
[0262] The pharmaceutical composition described herein may be formulated for parenteral administration, e.g., by bolus injection or continuous infusion. Formulations for injection may be presented in unit dosage form, e.g., in ampoules or in multi-dose containers with optionally, an added preservative. The compositions may be suspensions, solutions or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
[0263] Pharmaceutical compositions for parenteral administration include aqueous solutions of the active preparation in water-soluble form. Additionally, suspensions of the active ingredients may be prepared as appropriate oily or water-based injection suspensions. Suitable lipophilic solvents or vehicles include fatty oils such as sesame oil, or synthetic fatty acids esters such as ethyl oleate, triglycerides or liposomes. Aqueous injection suspensions may contain substances, which increase the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol or dextran. Optionally, the suspension may also contain suitable stabilizers or agents which increase the solubility of the active ingredients to allow for the preparation of highly concentrated solutions.
[0264] Alternatively, the active ingredient may be in powder form for constitution with a suitable vehicle, e.g., sterile, pyrogen-free water-based solution, before use.
[0265] The pharmaceutical composition of some embodiments of the invention may also be formulated in rectal compositions such as suppositories or retention enemas, using, e.g., conventional suppository bases such as cocoa butter or other glycerides.
[0266] Pharmaceutical compositions suitable for use in context of some embodiments of the invention include compositions wherein the active ingredients are contained in an amount effective to achieve the intended purpose. More specifically, a therapeutically effective amount means an amount of active ingredients (e.g., a compound according to any of the respective embodiments described herein, optionally in combination with an additional agent described herein) effective to prevent, alleviate or ameliorate symptoms of a disorder (e.g., a proliferative disease or disorder) or prolong the survival of the subject being treated.
[0267] Determination of a therapeutically effective amount is well within the capability of those skilled in the art, especially in light of the detailed disclosure provided herein. For any preparation used in the methods of the invention, the therapeutically effective amount or dose can be estimated initially from in vitro and cell culture assays. For example, a dose can be formulated in animal models to achieve a desired concentration or titer. Such information can be used to more accurately determine useful doses in humans.
[0268] Toxicity and therapeutic efficacy of the active ingredients described herein can be determined by standard pharmaceutical procedures in vitro, in cell cultures or experimental animals. The data obtained from these in vitro and cell culture assays and animal studies can be used in formulating a range of dosage for use in human. The dosage may vary depending upon the dosage form employed and the route of administration utilized. The exact formulation, route of administration and dosage can be chosen by the individual physician in view of the patient's condition. (See e.g., Fingl, et al., 1975, in The Pharmacological Basis of Therapeutics, Ch. 1 p. 1, which is incorporated herein by reference).
[0269] Dosage amount and interval may be adjusted individually to provide levels (e.g., blood levels) of the active ingredient are sufficient to induce or suppress the biological effect (minimal effective concentration, MEC). The MEC will vary for each preparation, but can be estimated from in vitro data. Dosages necessary to achieve the MEC will depend on individual characteristics and route of administration. Detection assays can be used to determine plasma concentrations.
[0270] Depending on the severity and responsiveness of the condition to be treated, dosing can be of a single or a plurality of administrations, with course of treatment lasting from several days to several weeks or until cure is effected or diminution of the disease state is achieved.
[0271] The amount of a composition to be administered will, of course, be dependent on the subject being treated, the severity of the affliction, the manner of administration, the judgment of the prescribing physician, etc.
[0272] Compositions of some embodiments of the invention may, if desired, be presented in a pack or dispenser device, such as an FDA approved kit, which may contain one or more unit dosage forms containing the active ingredient. The pack may, for example, comprise metal or plastic foil, such as a blister pack. The pack or dispenser device may be accompanied by instructions for administration. The pack or dispenser may also be accommodated by a notice associated with the container in a form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals, which notice is reflective of approval by the agency of the form of the compositions or human or veterinary administration. Such notice, for example, may be of labeling approved by the U.S. Food and Drug Administration for prescription drugs or of an approved product insert. Compositions comprising a preparation of the invention formulated in a compatible pharmaceutical carrier may also be prepared, placed in an appropriate container, and labeled for treatment of an indicated condition, as is further detailed herein.
Additional Definitions
Pharmaceutically Acceptable Salt
[0273] The invention includes pharmaceutically acceptable salts of the compounds of this invention, which may be produced, by reaction of a compound of this invention with an acid or base. Certain compounds, particularly those possessing acid or basic groups, can also be in the form of a salt, optionally a pharmaceutically acceptable salt. The term pharmaceutically acceptable salt refers to those salts that retain the biological effectiveness and properties of the free bases or free acids, which are not biologically or otherwise undesirable. The salts are formed with inorganic acids such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid and the like, and organic acids such as acetic acid, propionic acid, glycolic acid, pyruvic acid, oxylic acid, maleic acid, malonic acid, succinic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, cinnamic acid, mandelic acid, methanesulfonic acid, ethanesulfonic acid, p-toluenesulfonic acid, salicylic acid, N-acetylcysteine and the like. Other salts are known to those of skill in the art and can readily be adapted for use in accordance with the present invention.
[0274] Suitable pharmaceutically acceptable salts of amines of compounds the compounds of this invention may be prepared from an inorganic acid or from an organic acid. In various embodiments, examples of inorganic salts of amines are bisulfates, borates, bromides, chlorides, hemisulfates, hydrobromates, hydrochlorates, 2-hydroxyethylsulfonates (hydroxyethanesulfonates), iodates, iodides, isothionates, nitrates, persulfates, phosphate, sulfates, sulfamates, sulfanilates, sulfonic acids (alkylsulfonates, arylsulfonates, halogen substituted alkylsulfonates, halogen substituted arylsulfonates), sulfonates and thiocyanates.
[0275] In various embodiments, examples of organic salts of amines may be selected from aliphatic, cycloaliphatic, aromatic, araliphatic, heterocyclic, carboxylic and sulfonic classes of organic acids, examples of which are acetates, arginines, aspartates, ascorbates, adipates, anthranilates, algenates, alkane carboxylates, substituted alkane carboxylates, alginates, benzenesulfonates, benzoates, bisulfates, butyrates, bicarbonates, bitartrates, citrates, camphorates, camphorsulfonates, cyclohexylsulfamates, cyclopentanepropionates, calcium edetates, camsylates, carbonates, clavulanates, cinnamates, dicarboxylates, digluconates, dodecylsulfonates, dihydrochlorides, decanoates, enanthuates, ethanesulfonates, edetates, edisylates, estolates, esylates, fumarates, formates, fluorides, galacturonates gluconates, glutamates, glycolates, glucorate, glucoheptanoates, glycerophosphates, gluceptates, glycollylarsanilates, glutarates, glutamate, heptanoates, hexanoates, hydroxymaleates, hydroxycarboxlic acids, hexylresorcinates, hydroxybenzoates, hydroxynaphthoates, hydrofluorates, lactates, lactobionates, laurates, malates, maleates, methylenebis(beta-oxynaphthoate), malonates, mandelates, mesylates, methane sulfonates, methylbromides, methylnitrates, methylsulfonates, monopotassium maleates, mucates, monocarboxylates, naphthalenesulfonates, 2-naphthalenesulfonates, nicotinates, nitrates, napsylates, N-methylglucamines, oxalates, octanoates, oleates, pamoates, phenylacetates, picrates, phenylbenzoates, pivalates, propionates, phthalates, phenylacetate, pectinates, phenylpropionates, palmitates, pantothenates, polygalacturates, pyruvates, quinates, salicylates, succinates, stearates, sulfanilate, subacetates, tartrates, theophyllineacetates, p-toluenesulfonates (tosylates), trifluoroacetates, terephthalates, tannates, teoclates, trihaloacetates, triethiodide, tricarboxylates, undecanoates and valerates.
[0276] In various embodiments, examples of inorganic salts of carboxylic acids or hydroxyls may be selected from ammonium, alkali metals to include lithium, sodium, potassium, cesium; alkaline earth metals to include calcium, magnesium, aluminium; zinc, barium, cholines, quaternary ammoniums.
[0277] In some embodiments, examples of organic salts of carboxylic acids or hydroxyl may be selected from arginine, organic amines to include aliphatic organic amines, alicyclic organic amines, aromatic organic amines, benzathines, t-butylamines, benethamines (N-benzylphenethylamine), dicyclohexylamines, dimethylamines, diethanolamines, ethanolamines, ethylenediamines, hydrabamines, imidazoles, lysines, methylamines, meglamines, N-methyl-D-glucamines, N,N-dibenzylethylenediamines, nicotinamides, organic amines, ornithines, pyridines, picolies, piperazines, procain, tris(hydroxymethyl)methylamines, triethylamines, triethanolamines, trimethylamines, tromethamines and ureas.
[0278] In various embodiments, the salts may be formed by conventional means, such as by reacting the free base or free acid form of the product with one or more equivalents of the appropriate acid or base in a solvent or medium in which the salt is insoluble or in a solvent such as water, which is removed in vacuo or by freeze drying or by exchanging the ions of a existing salt for another ion or suitable ion-exchange resin.
[0279] Substituted alkyl, alkenyl, alkynyl, cycloalkyl, heterocyclyl, aryl, and heteroaryl may have one or more substituents, whereby each substituent group can independently be, for example, cycloalkyl, aryl, heteroaryl, heteroalicyclic, halo, hydroxy, alkoxy, aryloxy, thiohydroxy, thioalkoxy, thioaryloxy, sulfinyl, sulfonyl, sulfonate, sulfate, cyano, nitro, azide, phosphonyl, phosphinyl, oxo, carbonyl, thiocarbonyl, a urea group, a thiourea group, O-carbamyl, N-carbamyl, O-thiocarbamyl, N-thiocarbamyl, C-amido, N-amido, C-carboxy, O-carboxy, sulfonamido, guanyl, guanidinyl, hydrazine, hydrazide, thiohydrazide, amino halogen, alkylaryloxy, heteroaryloxy, oxo, cycloalkyl, phenyl, heteroaryls, heterocyclyl, naphthyl, amino, alkylamino, arylamino, heteroarylamino, dialkylamino, diarylamino, alkylarylamino, alkylheteroarylamino, arylheteroarylamino, acyl, acyloxy, nitro, carboxy, carbamoyl, carboxamide, cyano, sulfonyl, sulfonylamino, sulfoneamido, sulfinyl, sulfinylamino, thiol, alkylthio, arylthio, or alkylsulfonyl groups. Any substituents can be unsubstituted or further substituted with any one of these aforementioned substituents.
[0280] In some embodiments, unless otherwise specified, a substituted alkyl may be substituted with one or more (e.g., one, two, three, or more, as valency allows) groups independently selected from halo, hydroxy, alkoxy, cyano, and oxo. In some embodiments, a substituted alkyl may be substituted with one or more (e.g., one, two, three, or more, as valency allows) groups independently selected from halo and cyano.
[0281] Herein, the term alkenyl describes an unsaturated aliphatic hydrocarbon comprise at least one carbon-carbon double bond, including straight chain and branched chain groups. Optionally, the alkenyl group has 2 to 20 carbon atoms. More optionally, the alkenyl is a medium size alkenyl having 2 to 10 carbon atoms. Most optionally, unless otherwise indicated, the alkenyl is a lower alkenyl having 2 to 4 carbon atoms. The alkenyl group may be substituted or non-substituted.
[0282] Substituted alkenyl may have one or more substituents, whereby each substituent group can independently be, for example, alkynyl, cycloalkyl, alkynyl, aryl, heteroaryl, heteroalicyclic, halo, hydroxy, alkoxy, aryloxy, thiohydroxy, thioalkoxy, thioaryloxy, sulfinyl, sulfonyl, sulfonate, sulfoneamido, sulfate, cyano, nitro, azide, phosphonyl, phosphinyl, oxo, carbonyl, thiocarbonyl, a urea group, a thiourea group, O-carbamyl, N-carbamyl, O-thiocarbamyl, N-thiocarbamyl, C-amido, N-amido, C-carboxy, O-carboxy, sulfonamido, guanyl, guanidinyl, hydrazine, hydrazide, thiohydrazide, and amino.
[0283] In some embodiments, unless otherwise specified, a substituted alkenyl may be substituted with one or more (e.g., one, two, three, or more, as valency allows) groups independently selected from halo, hydroxy, alkoxy, cyano, and oxo. In some embodiments, a substituted alkenyl may be substituted with one or more (e.g., one, two, three, or more, as valency allows) groups independently selected from halo and cyano.
[0284] Herein, the term alkynyl describes an unsaturated aliphatic hydrocarbon comprise at least one carbon-carbon triple bond, including straight chain and branched chain groups. Optionally, the alkynyl group has 2 to 20 carbon atoms. More optionally, the alkynyl is a medium size alkynyl having 2 to 10 carbon atoms. Most optionally, unless otherwise indicated, the alkynyl is a lower alkynyl having 2 to 4 carbon atoms. The alkynyl group may be substituted or non-substituted.
[0285] Substituted alkynyl may have one or more substituents, whereby each substituent group can independently be, for example, cycloalkyl, alkenyl, aryl, heteroaryl, heteroalicyclic, halo, hydroxy, alkoxy, aryloxy, thiohydroxy, thioalkoxy, thioaryloxy, sulfinyl, sulfonyl, sulfonate, sulfate, cyano, nitro, azide, phosphonyl, phosphinyl, oxo, carbonyl, thiocarbonyl, a urea group, a thiourea group, O-carbamyl, N-carbamyl, O-thiocarbamyl, N-thiocarbamyl, C-amido, N-amido, C-carboxy, O-carboxy, sulfonamido, guanyl, guanidinyl, hydrazine, hydrazide, thiohydrazide, and amino.
[0286] In some embodiments, unless otherwise specified, a substituted alkynyl may be substituted with one or more (e.g., one, two, three, or more, as valency allows) groups independently selected from halo, hydroxy, alkoxy, cyano, and oxo. In some embodiments, a substituted alkynyl may be substituted with one or more (e.g., one, two, three, or more, as valency allows) groups independently selected from halo and cyano.
[0287] As used herein, alkylene refers to a linear, branched or cyclic, in certain embodiments linear or branched, divalent aliphatic hydrocarbon group, in one embodiment having from 1 to about 20 carbon atoms, in another embodiment having from 1 to 12 carbons. In a further embodiment alkylene includes lower alkylene. There may be optionally inserted along the alkylene group one or more oxygen, sulfur, including S(O) and S(O).sub.2 groups, or substituted or unsubstituted nitrogen atoms including NR and N.sup.+RR-groups, where the nitrogen substituent(s) is(are) alkyl, aryl, aralkyl, heteroaryl, heteroaralkyl or COR, wherein each R is independently selected from alkyl, aryl, aralkyl, heteroaryl, heteroaralkyl, OY or NYY, wherein each Y is independently selected from hydrogen, alkyl, aryl, heteroaryl, cycloalkyl or heterocyclyl. Alkylene groups include, but are not limited to, methylene (CH.sub.2), ethylene (CH.sub.2CH.sub.2), propylene ((CH.sub.2).sub.3), methylenedioxy (OCH.sub.2O) and ethylenedioxy (O(CH.sub.2).sub.2O). The term lower alkylene refers to alkylene groups having 1 to 6 carbons. In certain embodiments, alkylene groups are lower alkylene, including alkylene of 1 to 3 carbon atoms.
[0288] As used herein, alkenylene refers to a linear, branched or cyclic, in one embodiment straight or branched, divalent aliphatic hydrocarbon group, in certain embodiments having from 2 to about 20 carbon atoms and at least one double bond, in other embodiments 1 to 12 carbons. In further embodiments, alkenylene groups include lower alkenylene. There may be optionally inserted along the alkenylene group one or more oxygen, sulfur or substituted or unsubstituted nitrogen atoms, where the nitrogen substituent is alkyl. Alkenylene groups include, but are not limited to, CHCHCHCH and HCHCH.sub.2. The term lower alkenylene refers to alkenylene groups having 2 to 6 carbons. In certain embodiments, alkenylene groups are lower alkenylene, including alkenylene of 3 to 4 carbon atoms.
[0289] In some embodiments, unless otherwise specified, a substituted alkenylene may be substituted with one or more (e.g., one, two, three, or more, as valency allows) groups independently selected from halo, hydroxy, alkoxy, cyano, and oxo. In some embodiments, a substituted alkenylene may be substituted with one or more (e.g., one, two, three, or more, as valency allows) groups independently selected from halo and cyano.
[0290] As used herein, alkynylene refers to a straight, branched or cyclic, in certain embodiments straight or branched, a divalent aliphatic hydrocarbon group, in one embodiment having from 2 to about 20 carbon atoms and at least one triple bond, in another embodiment 1 to 12 carbons. In a further embodiment, alkynylene includes lower alkynylene. There may be optionally inserted along the alkynylene group one or more oxygen, sulfur or substituted or unsubstituted nitrogen atoms, where the nitrogen substituent is alkyl. Alkynylene groups include, but are not limited to, CCCC, CC and CCCH.sub.2. The term lower alkynylene refers to alkynylene groups having 2 to 6 carbons. In certain embodiments, alkynylene groups are lower alkynylene, including alkynylene of 3 to 4 carbon atoms.
[0291] In some embodiments, unless otherwise specified, a substituted alkynylene may be substituted with one or more (e.g., one, two, three, or more, as valency allows) groups independently selected from halo, hydroxy, alkoxy, cyano, and oxo. In some embodiments, a substituted alkynylene may be substituted with one or more (e.g., one, two, three, or more, as valency allows) groups independently selected from halo and cyano.
[0292] A cycloalkyl group refers to a saturated on unsaturated all-carbon monocyclic or fused ring (i.e., rings which share an adjacent pair of carbon atoms) group wherein one of more of the rings does not have a completely conjugated pi-electron system. Examples, without limitation, of cycloalkyl groups are cyclopropane, cyclobutane, cyclopentane, cyclopentene, cyclohexane, cyclohexadiene, cycloheptane, cycloheptatriene, and adamantane. A cycloalkyl group may be substituted or non-substituted. When substituted, the substituent group can be, for example, alkyl, alkenyl, alkynyl, cycloalkyl, aryl, heteroaryl, heteroalicyclic, halo, hydroxy, alkoxy, aryloxy, thiohydroxy, thioalkoxy, thioaryloxy, sulfinyl, sulfonyl, sulfonate, sulfate, cyano, nitro, azide, phosphonyl, phosphinyl, oxo, carbonyl, thiocarbonyl, a urea group, a thiourea group, O-carbamyl, N-carbamyl, O-thiocarbamyl, N-thiocarbamyl, C-amido, N-amido, C-carboxy, O-carboxy, sulfonamido, guanyl, guanidinyl, hydrazine, hydrazide, thiohydrazide, and amino, as these terms are defined herein. When a cycloalkyl group is unsaturated, it may comprise at least one carbon-carbon double bond and/or at least one carbon-carbon triple bond. The cycloalkyl group can be an end group, as this phrase is defined herein, wherein it is attached to a single adjacent atom, or a linking group, as this phrase is defined herein, connecting two or more moieties.
[0293] In some embodiments, unless otherwise specified, a substituted cycloalkyl may be substituted with one or more (e.g., one, two, three, or more, as valency allows) groups independently selected from halo, hydroxy, alkoxy, cyano, and oxo. In some embodiments, a substituted cycloalkyl may be substituted with one or more (e.g., one, two, three, or more, as valency allows) groups independently selected from halo and cyano.
[0294] An aryl group refers to an all-carbon monocyclic or fused-ring polycyclic (i.e., rings which share adjacent pairs of carbon atoms) end groups having a completely conjugated pi-electron system. Examples, without limitation, of aryl groups are phenyl, naphthalenyl and anthracenyl. The aryl group may be substituted or non-substituted. When substituted, the substituent group can be, for example, alkyl, alkenyl, alkynyl, cycloalkyl, aryl, heteroaryl, heteroalicyclic, halo, hydroxy, alkoxy, aryloxy, thiohydroxy, thioalkoxy, thioaryloxy, sulfinyl, sulfonyl, sulfonate, sulfate, cyano, nitro, azide, phosphonyl, phosphinyl, oxo, carbonyl, thiocarbonyl, a urea group, a thiourea group, O-carbamyl, N-carbamyl, O-thiocarbamyl, N-thiocarbamyl, C-amido, N-amido, C-carboxy, O-carboxy, sulfonamido, guanyl, guanidinyl, hydrazine, hydrazide, thiohydrazide, and amino, as these terms are defined herein. The aryl group can be an end group, as this phrase is defined herein, wherein it is attached to a single adjacent atom, or a linking group, as this phrase is defined herein, connecting two or more moieties.
[0295] In some embodiments, unless otherwise specified, a substituted aryl may be substituted with one or more (e.g., one, two, three, or more, as valency allows) groups independently selected from halo, hydroxy, alkoxy, cyano, and oxo. In some embodiments, a substituted aryl may be substituted with one or more (e.g., one, two, three, or more, as valency allows) groups independently selected from halo and cyano.
[0296] A heteroaryl group refers to a monocyclic or fused ring (i.e., rings which share an adjacent pair of atoms) end group having in the ring(s) one or more atoms, such as, for example, nitrogen, oxygen and sulfur and, in addition, having a completely conjugated pi-electron system. Examples, without limitation, of heteroaryl groups include pyrrole, furan, thiophene, imidazole, oxazole, thiazole, pyrazole, pyridine, pyrimidine, quinoline, isoquinoline and purine. The heteroaryl group may be substituted or non-substituted. When substituted, the substituent group can be, for example, alkyl, alkenyl, alkynyl, cycloalkyl, aryl, heteroaryl, heteroalicyclic, halo, hydroxy, alkoxy, aryloxy, thiohydroxy, thioalkoxy, thioaryloxy, sulfinyl, sulfonyl, sulfonate, sulfate, cyano, nitro, azide, phosphonyl, phosphinyl, oxo, carbonyl, thiocarbonyl, a urea group, a thiourea group, O-carbamyl, N-carbamyl, O-thiocarbamyl, N-thiocarbamyl, C-amido, N-amido, C-carboxy, O-carboxy, sulfonamido, guanyl, guanidinyl, hydrazine, hydrazide, thiohydrazide, and amino, as these terms are defined herein.
[0297] In some embodiments, unless otherwise specified, a substituted heteroaryl may be substituted with one or more (e.g., one, two, three, or more, as valency allows) groups independently selected from halo, hydroxy, alkoxy, cyano, and oxo. In some embodiments, a substituted heteroaryl may be substituted with one or more (e.g., one, two, three, or more, as valency allows) groups independently selected from halo and cyano.
[0298] The term arylene describes a monocyclic or fused-ring polycyclic linking group, as this term is defined herein, and encompasses linking groups which differ from an aryl or heteroaryl group, as these groups are defined herein, only in that arylene is a linking group rather than an end group.
[0299] A heterocyclic group refers to a monocyclic or fused ring group having in the ring(s) one or more atoms such as nitrogen, oxygen and sulfur. The rings may also have one or more double bonds. However, the rings do not have a completely conjugated pi-electron system. The heteroalicyclic may be substituted or non-substituted. When substituted, the substituted group can be, for example, alkyl, alkenyl, alkynyl, cycloalkyl, aryl, heteroaryl, heteroalicyclic, halo, hydroxy, alkoxy, aryloxy, thiohydroxy, thioalkoxy, thioaryloxy, sulfinyl, sulfonyl, sulfonate, sulfate, cyano, nitro, azide, phosphonyl, phosphinyl, oxo, carbonyl, thiocarbonyl, a urea group, a thiourea group, O-carbamyl, N-carbamyl, O-thiocarbamyl, N-thiocarbamyl, C-amido, N-amido, C-carboxy, O-carboxy, sulfonamido, guanyl, guanidinyl, hydrazine, hydrazide, thiohydrazide, and amino, as these terms are defined herein. Representative examples are piperidine, piperazine, tetrahydrofuran, tetrahydropyran, morpholine and the like. The heteroalicyclic group can be an end group, as this phrase is defined herein, wherein it is attached to a single adjacent atom, or a linking group, as this phrase is defined herein, connecting two or more moieties.
[0300] In some embodiments, unless otherwise specified, a substituted heterocyclic may be substituted with one or more (e.g., one, two, three, or more, as valency allows) groups independently selected from halo, hydroxy, alkoxy, cyano, and oxo. In some embodiments, a substituted heterocyclic may be substituted with one or more (e.g., one, two, three, or more, as valency allows) groups independently selected from halo and cyano.
[0301] Herein, the terms amine and amino each refer to either a NRR end group, a N.sup.+RRR end group, a NR-linking group, or a N.sup.+RR-linking group, wherein R, R and R are each hydrogen or a substituted or non-substituted alkyl, alkenyl, alkynyl, cycloalkyl, heteroalicyclic (linked to amine nitrogen via a ring carbon thereof), aryl, or heteroaryl (linked to amine nitrogen via a ring carbon thereof), as defined herein. Optionally, R, R and R are hydrogen or alkyl comprising 1 to 4 carbon atoms. Optionally, R and R (and R, if present) are hydrogen. When substituted, the carbon atom of an R, R or R hydrocarbon moiety which is bound to the nitrogen atom of the amine is optionally not substituted by oxo, such that R, R and R are not (for example) carbonyl, C-carboxy or amide, as these groups are defined herein, unless indicated otherwise.
[0302] An azide group refers to a NN.sup.+N.sup. group.
[0303] An alkoxy group refers to both an O-alkyl and an O-cycloalkyl end group, as defined herein, or to an O-alkylene- or O-cycloalkyl-linking group, as defined herein.
[0304] An aryloxy group refers to both an O-aryl and an O-heteroaryl end group, as defined herein, or to an O-arylene-linking group, as defined herein.
[0305] A hydroxy group refers to a OH group.
[0306] A thiohydroxy or thiol group refers to a SH group.
[0307] A thioalkoxy group refers to both an S-alkyl end group and an S-cycloalkyl end group, as defined herein, or to an S-alkylene- or S-cycloalkyl-linking group, as defined herein.
[0308] A thioaryloxy group refers to both an S-aryl and an S-heteroaryl end group, as defined herein, or to an S-arylene-linking group, as defined herein.
[0309] A carbonyl group refers to a C(O)R end group, where R is defined as hereinabove, or to a C(O)-linking group.
[0310] A thiocarbonyl group refers to a C(S)R end group, where R is as defined herein, or to a C(S)-linking group.
[0311] A carboxyl, carboxylic or carboxylate refers to both C-carboxy and O-carboxy end groups, as well as to a C(O)O-linking group.
[0312] A C-carboxy group refers to a C(O)OR group, where R is as defined herein.
[0313] An O-carboxy group refers to an RC(O)O-group, where R is as defined herein.
[0314] A carboxylic acid refers to a C(O)OH group, including the deprotonated ionic form and salts thereof.
[0315] An ester refers to a C(O)OR or O(CO)R group, wherein R is not hydrogen.
[0316] An oxo group refers to a O group.
[0317] A thiocarboxy or thiocarboxylate group refers to both C(S)OR and OC(S)R end groups, or to a C(S)O-linking group, wherein R is not hydrogen.
[0318] A halo group refers to fluorine, chlorine, bromine or iodine.
[0319] A haloalkyl group refers to an alkyl group substituted by one or more halo groups, as defined herein.
[0320] A sulfinyl group refers to an S(O)R end group, where R is as defined herein, or to a S(O)-linking group.
[0321] A sulfonyl group refers to an S(O).sub.2R end group, where R is as defined herein, or to a S(O).sub.2-linking group.
[0322] A sulfonate group refers to an S(O).sub.2OR end group, where R is as defined herein, or to a S(O).sub.2O-linking group.
[0323] A sulfate group refers to an OS(O).sub.2OR end group, where R is as defined as herein, or to a OS(O).sub.2O-linking group.
[0324] A sulfonamide or sulfonamido group encompasses both S-sulfonamido and N-sulfonamido end groups, as defined herein, and a S(O).sub.2NR-linking group.
[0325] An S-sulfonamido group refers to a S(O).sub.2NRR group, with each of R and R as defined herein.
[0326] An N-sulfonamido group refers to an R'S(O).sub.2NR group, where each of R and R is as defined herein.
[0327] A carbamyl or carbamate group encompasses O-carbamyl and N-carbamyl end groups, and to a OC(O)NR-linking group.
[0328] An O-carbamyl group refers to an OC(O)NRR group, where each of R and R is as defined herein.
[0329] An N-carbamyl group refers to an ROC(O)NR-group, where each of R and R is as defined herein.
[0330] A thiocarbamyl or thiocarbamate group encompasses O-thiocarbamyl and N-thiocarbamyl end groups, and to a OC(S)NR-linking group.
[0331] An O-thiocarbamyl group refers to an OC(S)NRR group, where each of R and R is as defined herein.
[0332] An N-thiocarbamyl group refers to an ROC(S)NR-group, where each of R and R is as defined herein.
[0333] An amide or amido group encompasses C-amido and N-amido end groups, as defined herein, and to a C(O)NR-linking group.
[0334] A C-amido group refers to a C(O)NRR group, where each of R and R is as defined herein.
[0335] An N-amido group refers to an RC(O)NR-group, where each of R and R is as defined herein.
[0336] A urea group refers to an N(R)C(O)NRR end group, or to a N(R)C(O)NR-linking group, where each of R, R and R is as defined herein.
[0337] A thiourea group refers to a N(R)C(S)NRR end group, or to a N(R)C(S)NR-linking group where each of R, R and R is as defined herein.
[0338] A nitro group refers to an NO.sub.2 group.
[0339] A cyano group refers to a CN group.
[0340] The term phosphonyl or phosphonate describes a P(O)(OR)(OR) end group, or a P(O)(OR)O-linking group, with R and R as defined hereinabove.
[0341] The term phosphate describes an OP(O)(OR)(OR) end group, or a OP(O)(OR)O-linking group with each of R and R as defined hereinabove.
[0342] The term phosphinyl describes a PRR end group, or PRR-linking group, with each of R and R as defined hereinabove.
[0343] The term hydrazine describes a NRNRR end group, or NRNR-linking group, with R, R, and R as defined herein.
[0344] As used herein, the term hydrazide describes a C(O)NRNRR end group, or C(O)NRNR-linking group, where R, R and R are as defined herein.
[0345] As used herein, the term thiohydrazide describes a C(S)NRNRR end group, or C(S)NRNR-linking group, where R, R and R are as defined herein.
[0346] A guanidinyl group refers to an R.sub.aNC(NR.sub.d)NR.sub.bR.sub.c end group, or R.sub.aNC(NR.sub.d)NRb-linking group where each of R.sub.a, R.sub.b, R.sub.c and R.sub.d can be as defined herein for R and R.
[0347] A guanyl or guanine group refers to an R.sub.aR.sub.bNC(NR.sub.d) end group, or a R.sub.aNC(NR.sub.d)-linking group, where R.sub.a, R.sub.b and R.sub.d are as defined herein.
[0348] As used herein the term about refers to 10%.
[0349] The terms comprises, comprising, includes, including, having and their conjugates mean including but not limited to.
[0350] The term consisting of means including and limited to.
[0351] The term consisting essentially of means that the composition, method or structure may include additional ingredients, steps and/or parts, but only if the additional ingredients, steps and/or parts do not materially alter the basic and characteristics of the claimed composition, method or structure.
[0352] As used herein, the singular form a, an and the include plural references unless the context clearly dictates otherwise. For example, the term a compound or at least one compound may include a plurality of compounds, including mixtures thereof.
[0353] In some embodiments provided herein a method of this invention for treating immune disease or disorders with the compounds disclosed herein, specifically Sulfamate compounds. An immune disease or disorder refers herein to an autoimmune disease. In other embodiments to autoimmune disease selected from: Addison disease, Celiac diseasesprue (gluten-sensitive enteropathy), Dermatomyositis, Graves disease, Hashimoto thyroiditis, Multiple sclerosis, Myasthenia gravis, Pernicious anemia, Reactive arthritis, Rheumatoid arthritis, Sjgren syndrome, Systemic lupus erythematosus and Type I diabetes.
[0354] Throughout this application, various embodiments of this invention may be presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the invention. Accordingly, the description of a range should be considered to have specifically disclosed all the possible subranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed subranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual numbers within that range, for example, 1, 2, 3, 4, 5, and 6. This applies regardless of the breadth of the range.
[0355] Whenever a numerical range is indicated herein, it is meant to include any cited numeral (fractional or integral) within the indicated range. The phrases ranging/ranges between a first indicate number and a second indicate number and ranging/ranges from a first indicate number to a second indicate number are used herein interchangeably and are meant to include the first and second indicated numbers and all the fractional and integral numerals therebetween.
[0356] As used herein the term method refers to manners, means, techniques and procedures for accomplishing a given task including, but not limited to, those manners, means, techniques and procedures either known to, or readily developed from known manners, means, techniques and procedures by practitioners of the chemical, pharmacological, biological, biochemical and medical arts.
[0357] When reference is made to particular sequence listings, such reference is to be understood to also encompass sequences that substantially correspond to its complementary sequence as including minor sequence variations, resulting from, e.g., sequencing errors, cloning errors, or other alterations resulting in base substitution, base deletion or base addition, provided that the frequency of such variations is less than 1 in 50 nucleotides, alternatively, less than 1 in 100 nucleotides, alternatively, less than 1 in 200 nucleotides, alternatively, less than 1 in 500 nucleotides, alternatively, less than 1 in 1000 nucleotides, alternatively, less than 1 in 5,000 nucleotides, alternatively, less than 1 in 10,000 nucleotides.
[0358] It is appreciated that certain features of the invention, which are, for clarity, described in the context of separate embodiments, may also be provided in combination in a single embodiment. Conversely, various features of the invention, which are, for brevity, described in the context of a single embodiment, may also be provided separately or in any suitable sub-combination or as suitable in any other described embodiment of the invention. Certain features described in the context of various embodiments are not to be considered essential features of those embodiments, unless the embodiment is inoperative without those elements.
[0359] Various embodiments and aspects of the present invention as delineated hereinabove and as claimed in the claims section below find experimental support in the following examples.
EXAMPLES
Methods
LC/MS Measurements
[0360] LC/MS runs were performed on a Waters ACQUITY UPLC class H instrument, in positive ion mode using electrospray ionization. UPLC separation for small molecules used C18-CSH column of (1.7 m, 2.1 mm100 mm) for all the LC/MS based assays. The column was held at 40 C. and the autosampler at 10 C. Mobile phase A was 0.1% formic acid in the water, and mobile phase B was 0.1% formic acid in acetonitrile. The run flow was 0.3 mL/min. The gradient used was 100% A for 2 min, increasing linearly to 90% B for 5 min, holding at 90% B for 1 min, changing to 0% B in 0.1 min, and holding at 0% for 1.9 min. UPLC separation for proteins used a C4 column (300 , 1.7 m, 2.1 mm100 mm). The column was held at 40 C. and the autosampler at 10 C. Mobile solution A was 0.1% formic acid in the water, and mobile phase B was 0.1% formic acid in acetonitrile. The run flow was 0.4 mL/min with gradient 20% B for 2 min, increasing linearly to 60% B for 3 min, holding at 60% B for 1.5 min, changing to 0% B in 0.1 min, and holding at 0% for 1.4 min. The mass data were collected on a Waters SQD2 detector with an m/z range of 2-3071.98 at a range of m/z of 800-1500 Da for BTK, and 750-1550 for Pin1.
GSH Reactivity Assay for Compounds 1a-1h (Model Compounds)
[0361] A 200 M (for 1a-1h) (0.5 or 1 L of 20 mM stock) sample of the electrophile was incubated with 5 mM GSH (5 L of 100 mM stock, freshly dissolved), 5 mM NaOH (to counter the acidity imparted by GSH) and 100 M 4-nitrocyano benzene (0.5 l of 20 mM stock solution) as an internal standard in 100 mM potassium phosphate buffer pH 8.0 and DMF at a ratio of 9:1, respectively. All solvents were bubbled with argon. Reaction mixtures were kept at 10 C. Every 1 h, 5 L from the reaction mixture were injected into the LC/MS. The reaction was followed by the peak area of the electrophile normalized by the area of the 4-nitrocyano benzene (i.e. by the disappearance of the starting material). The natural logarithm of the results was fitted to linear regression, and t.sub.1/2 was calculated as t.sub.1/2=ln 2/slope.
DTNB Thiol Reactivity Assay
[0362] The compound 5,5-dithio-bis(2-nitrobenzoic acid) (DTNB; 50 M) was incubated with 200 M tris(2-carboxyethyl)phosphine (TCEP) in 20 mM sodium phosphate buffer pH 7.4 and 150 mM NaCl for 5 min at room temperature, to obtain TNB.sup.2. Next, 200 M compounds were subsequently added to TNB.sup.2 followed by immediate ultraviolet (UV) absorbance measurement at 412 nm and 37 C. UV absorbance was acquired every 15 min for 7 h. The assay was performed in a 384-well plate using a Tecan Spark 10M plate reader. Background absorbance of compounds was subtracted by measuring the absorbance at 412 nm of each compound under the same conditions without DTNB. Compounds were measured in triplicate. The data were fitted to a second-order reaction equation such that the rate constant (K) is the slope of ln([A][B0]/[B][A0]), where [A0] and [B0] are the initial concentrations of the compound (200 M) and TNB.sup.2 (100 M), respectively, and [A] and [B] are the remaining concentrations as a function of time as deduced from spectrometric measurements. Linear regression using Prism was performed to fit the rate against the first 7 h of measurements.
Buffer Stability Assay for Model Compound, Ibrutinib Sulfamates and Sulfamate Compounds
[0363] A sample of the electrophile (200 M for 1a-1i, and 4a-4g) was incubated with 100 M of 4-nitrocyano benzene as an internal standard in a 100 mM potassium phosphate buffer of pH 8.0. Reaction mixtures were kept at 37 C. with shaking. After 4 days (unless otherwise mentioned), 5 L from the reaction mixture were injected into the LC/MS to check the stability of the compounds.
In-Vitro Labeling Experiments
[0364] Pin1 was expressed and purified as previously reported.sup.38. The catalytic domain of Pin1 (2 M) in 20 mM Tris, 75 mM NaCl, pH 7.5 was incubated with 2 M Sulfamate (4a-4g) for 1 h at 25 C.
[0365] The reaction mixtures, at room temperature for various times, were injected into the LC/MS. For data analysis, the raw spectra were deconvoluted using a 20000:40000 Da (For Pin1, 10000:30000) window and 1 Da resolution. The labeling percentage for a compound was determined as the labeling of a specific compound (alone or together with other compounds) divided by the overall detected protein species.
Pin1 Pull-Down Using Sulfopin-DTB Probe
[0366] OCI-AML2 cells were treated for 4 h with either DMSO (0.1%) or Sulfopin, 4c, 4d, 4e and 4g (0.5, 2.5 mM). The cells were lysed using RIPA buffer (Sigma, R0278). Lysates were clarified at 21,000 g for 15 minutes at 4 C. and protein concentration was determined using BCA protein assay (Thermo Scientific, 23225). Lysates were incubated with 1 mM Sulfopin-DTB probe for 1 h at room-temperature, using 650 mg per sample. Streptavidin-agarose beads (Thermo Scientific, 20349) were added, 50 ul per sample, and placed on a shaker for 2 h in room temperature. The beads were washed four times with 500 ml buffer containing 20 mM Hepes pH 7.5, 10 mM NaCl, 1 mM EDTA, 10% glycerol. Beads were then pelleted and boiled in 50 ml 2LDS sample buffer (Invitrogen, NuPAGE, NP0007) and Pin1 immunoblotting was performed. The samples were loaded on a 4-20% Bis-Tris gel (SurePAGE) and transferred to a nitrocellulose membrane (Bio-Rad, 1704158) using Trans-Blot Turbo system (Bio-Rad). The membrane was blocked using 5% BSA in PBS-T (w/v) for 1 hour at room temperature, washed 3 times for 5 minutes with PBS-T and incubated overnight at 4 C. with Pin1 antibody diluted 1:1,000 (Cell Signaling, 3722). Membrane was washed 3 times for 5 minutes with PBS-T and incubated with anti-rabbit HRP-linked secondary antibody (cell-signaling, #7074) for 1 hour at room-temperature. EZ-ECL Kit (Biological Industries, 20-500-1000) was used to detect HRP-activity.
IsoTOP ABPP Sample Preparation
[0367] The preparation of IsoTOP-ABPP samples was performed essentially as described in Zanon et al. (Zanon, P. R. A., Lewald, L. & Hacker, S. M. Angew. Chem. Int. Ed Engl. 59 which is incorporated herein by reference).
[0368] Experiments were conducted in quadruplicates. PATU cells were incubated for 2 h with 5 M compounds Sulfopin (or with DMSO), and collected by centrifuge at 300 g for 5 min followed by ice cold PBS wash. For lysis, samples containing 10 million cells were dispersed in 0.5 mL of RIPA buffer (Sigma, R0278), incubated with occasional vortexing for 30 min on ice, followed by centrifugation at 21,000 g for 15 min. The protein concentration in the samples was determined using BCA assay (Pierce 23227), and each sample was diluted to 1.7 mg/mL using PBS. To each sample, 5 L of 10 mM IA-alkyne was added, followed by 1 h incubation at room temperature in the dark. 10 L of 5 mM DesThioTag was added (Light for the compound treated samples, heavy for the DMSO-treated samples), followed by 18 L of CuSO4:THPTA (100 mM), and the click reaction was initiated by addition of 15 L of 150 mM sodium ascorbate (freshly dissolved in water). The samples were incubated on a rotary shaker for 1 h at room temperature. The compound-treated and DMSO-treated samples were mixed with 4 mL methanol, 1 mL chloroform and 2 mL water on ice, vortexed and centrifuged at 3200 g for 10 min at 4 C. The top layer was aspirated, and 3 mL methanol was added, followed by centrifugation and aspiration of the supernatant. The pellets were air dried and stored at 80 C. until the following treatment. The pellets were resuspended in 0.3 mL of 8 M urea freshly dissolved in PBS using probe sonication (8 sec total at 40% amplitude, 1 sec on/2 sec off, at room temperature). Following the resuspension, the samples were diluted with 1 mL of PBS. Then each sample was mixed with 1.3 mL of slurry containing 110 L of streptavidin agarose beads (Thermo Streptavidin Agarose cat #20349), prewashed, and dispersed in 0.2% IGEPAL. The samples were incubated with rotation for 3 h at room temperature. The beads were pelleted by centrifugation at 2000 g for 2 min, transferred to spin columns, and washed 3 times with 0.1% IGEPAL/PBS, 3 times PBS, and 3 times water. The beads were then suspended in 8 M Urea/50 mM ammonium bicarbonate, and 15 L of 31 mg/mL DTT were added, followed by incubation at 37 C. for 45 min. The samples were cooled to room temperature, and 15 L of 74 mg/mL iodoacetamide were added, followed by 30 min incubation at room temperature in the dark, and the addition of a further 15 L of 31 mg/mL DTT and incubation at room temperature for 30 min. 900 L of 50 mM ammonium bicarbonate were added, and after 30 min incubation, the beads were pelleted by centrifugation at 2000 g for 2 min, and resuspended in 200 L of 1 M Urea/50 mM ammonium bicarbonate. At this point, modified trypsin (Promega V511A) was dissolved in trypsin buffer at 0.5 g/L, and 4 L were added to each sample, followed by overnight incubation at 37 C. with shaking. 400 L of 0.1% IGEPAL/PBS were added, and the beads were washed 3 times with 0.1% IGEPAL/PBS, 3 times PBS and 3 times water. The peptides were eluted by incubation with 200 L of 50% acetonitrile+0.1% TFA for 5 min, followed by two more portions of 100 L of 50% acetonitrile+0.1% TFA. The samples were dried by speedvac, and further purified using Oasis desalting columns (Waters), after which they were dried and run on the instrument.
Running Proteomics Samples
[0369] Samples were analyzed using EASY-nLC 1200 nano-flow UPLC system, using PepMap RSLC C18 column (2 m particle size, 100 pore size, 75 m diameter50 cm length), mounted using an EASY-Spray source onto an Exploris 240 mass spectrometer. uLC/MS-grade solvents were used for all chromatographic steps at 300 nL/min. The mobile phase was: (A) H2O+0.1% formic acid and (B) 80% acetonitrile+0.1% formic acid. Each sample (2 L) was injected. Peptides were eluted from the column into the mass spectrometer using the following gradient: 1-40% B in 160 min, 40-100% B in 5 min, maintained at 100% for 20 min, 100 to 1% in 10 min, and finally 1% for 5 min. Ionization was achieved using a 1900 V spray voltage with an ion transfer tube temperature of 275 C. Data were acquired in data-dependent acquisition (DDA) mode. MS1 resolution was set to 120,000 (at 200 m/z), a mass range of 375-1650 m/z, normalized AGC of 300%, and the maximum injection time was set to 20 ms. MS2 resolution was set to 15,000, quadrupole isolation 1.4 m/z, normalized AGC of 50%, dynamic exclusion of 45 s, and automatic maximum injection time.
Proteomics Data Analysis
[0370] Data analysis for pull down samples was performed using MaxQuant 1.6.3.4. Human proteome (updated November 2020) was downloaded from Uniprot. Carbamidomethyl was used as a fixed modification and methionine oxidation and N terminal acetylation as variable modification. The digestion enzyme was set to Trypsin/P with a maximum number of missed cleavages of 2. The Re-quantify option was enabled. Contaminants were included. Peptides were searched with a minimum peptide length of 7 and a maximum peptide mass of 4,600 Da. Second peptides was enabled and Dependent peptides were disabled. The option Match between run was enabled with a Match time window of 0.7 min and an alignment window of 20 min. An FDR of 0.01 was used for Protein FDR, PSM FDR and XPSM FDR. Label free quantification was used to quantify the proteins, with each data set (DMSO-treated samples, compound-treated samples, etc.) analyzed with a separate parameter group. The results were analyzed with Perseus. Contaminant proteins, proteins only identified by modified peptides, and proteins identified from reverse peptides were removed. LFQ intensities were transformed into Log 2 values and only proteins in which at least one data set contained 3 non zero intensities (out of 4) were retained. Non-valid values were replaced by values from a normal distribution with a width of 0.3 sigma and a down shift of 1.8 sigma. The data was finally analyzed using students T-test.
[0371] Data analysis for IsoTOPP data Analysis of IsoTOP-ABPP data was performed similarly to (Zanon, P. R. A., Lewald, L. & Hacker, S. M. Angew. Chem. Int. Ed Engl. 59, 2829-2836 (2020), which is hereby incorporated by reference in its entirety) using MaxQuant 1.6.3.4. Human proteome (updated November 2020) was downloaded from Uniprot. For each protein not containing selenocysteine, a copy of the protein sequence containing a single mutation of cysteine to selenocysteine (C.fwdarw.U) was created for each cysteine in the sequence to an unmutated copy. The IsoTOPP labels were then defined as Heavy/Light labels with the following formulae: C(24)H(49)N(8)Cx(5)Nx(1)S(1)Se(1) for the heavy label, and C(29)H(49)N(9)S(1)Se(1) for the light label. In addition diagnostic peaks were added corresponding to the free amine generated by cleavage of the iodoacetamide alkyne (C(22)H(49)N(8)O(4)Cx(5)Nx(1)/C(27)H(49)N(9)O(4)), internal cleavage caused by attack of the triazole on the alpha carbon of the iodoacetamide moiety.sup.2 (C(22)H(46)N(7)O(4)Cx(5)Nx(1)/C(27)H(46)N(8)O(4)), cleavage of the peptide bond between azidolysine and valine (C(10)H(25)N(2)O(3)Cx(5)Nx(1)/C(15)H(25)N(3)O(3)), and cleavage of the peptide bond between valine and desthiobiotin (C(10)H(16)N(2)O(2)). A multiplicity of 2 was set, and maximum number of labeled amino acids of 1. The digestion enzyme was set to Trypsin/P with a maximum number of missed cleavages of 2. No variable modifications were included. The Re-quantify option was enabled. Carbamidomethyl (C2H3NO) was used as a fixed modification on cysteine. Contaminants were included. Peptides were searched with a minimum peptide length of 7 and a maximum peptide mass of 4,600 Da. Second peptides and Dependent peptides were disabled and the option Match between run was enabled with a Match time window of 0.7 min and an alignment window of 20 min. An FDR of 0.01 was used for Protein FDR, PSM FDR and XPSM FDR. After MaxQuant analysis, the data for each compound was analyzed separately. Following data analysis, reverse and contaminant peptides were removed. Only peptides for which non-zero total intensities were measured for at least two of the replicates were analyzed. Average H/L ratios were calculated as the ratio of the sum of high intensities in the replicates to the sum of the low intensities. Ratios that were above 20 or infinite (due to the sum being zero for the low intensities) were defined as 20.
Example 1
Synthesis of Model Compounds
Synthesis of N-benzyl-2-chloroacetamide (1a)
[0372] ##STR00020##
[0373] To a stirred solution of Bn-NH.sub.2 (108 L, 1 mmol) in anhydrous DCM (2 mL), DIPEA (178 L, 1 mmol) and chloroacetic anhydride (170 mg, 1 mmol) were added at 25 C. The reaction mixture was stirred at room temperature for 1 h. After completion of the reaction (as monitored by LC-MS), CH.sub.2Cl.sub.2 was concentrated in vacuo and the crude product was purified using combi flash column chromatography using EtOAc:Hexane as eluent to give 1a in 154 mg (yield=84%).
[0374] .sup.1H NMR (500 MHz, CDCl.sub.3): 4.12 (s, 2H), 4.51 (d, J 5.8 Hz, 2H), 6.88 (br. s., 1H), 7.28-7.34 (m, 3H), 7.34-7.42 (m, 2H).
[0375] .sup.13C NMR (126 MHz, CDCl.sub.3): 42.6, 43.9, 127.8, 127.8, 128.8, 137.2, 165.8.
[0376] ESI-MS (m/z): calculated for C.sub.9H.sub.11ClNO [M+H]+: 184.05; found: [M+H]+:184.82.
Synthesis of N-benzyl-2-hydroxyacetamide (Pre-1)
[0377] ##STR00021##
[0378] To a stirred solution of Bn-NH.sub.2 (324 L, 3 mmol) in anhydrous DCM (6 mL), 1-Ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (690 mg, 3.6 mmol) and DIPEA (600 L, 3.6 mmol) were added at 25 C. The reaction mixture was stirred at room temperature for 12 h. After completion of the reaction (as monitored by LC-MS), the reaction mixture was evaporated under vacuo and the crude product was purified using combi flash column chromatography with MeOH:EtOAc (2:8) as eluent to give Pre-1 was colorless solid in 267 mg (yield=54%).
[0379] ESI-MS (m/z): calculated for C.sub.9H.sub.12NO.sub.2 [M+H]+: 166.08; found: [M+H]+:166.30.
Synthesis of 2-(benzylamino)-2-oxoethyl Methanesulfonate (1b)
[0380] ##STR00022##
[0381] To a stirred solution of Pre-1 (16.5 mg, 0.1 mmol) in CH.sub.2Cl.sub.2 (1 mL), methane sulfonyl chloride (9.2 L, 0.12 mmol, d=1.48), and DIPEA (20.4 L, 0.12 mmol) were added at 25 C. The reaction mixture was stirred at room temperature for 1 h. After completion of the reaction (as monitored by LC-MS), water (1 mL) was added. The aqueous layer was extracted with CH.sub.2Cl.sub.2 (31 mL). The combined organic layer was concentrated in vacuo and the crude product was purified by preparative HPLC using water:ACN (0.1% formic acid) solvent gradient to afford white solid 1b in 13.8 mg (57% yield).
[0382] .sup.1H NMR (400 MHz, CDCl.sub.3) : 2.50 (br. s., 1H), 3.07 (s, 3H), 4.47 (d, J 5.7 Hz, 2H), 4.66 (s, 2H), 6.67 (br. s., 1H), 7.19-7.40 (m, 4H).
[0383] .sup.13C NMR (101 MHz, CDCl.sub.3) 37.8, 43.4, 66.6, 127.8, 127.8, 128.8, 137.0, 165.2.
[0384] ESI-MS (m/z): calculated for C.sub.10H.sub.14NO.sub.4S [M+H]+: 244.06; found: [M+H]+:244.64.
Synthesis of 2-(benzylamino)-2-oxoethyl 4-methylbenzenesulfonate (1c)
[0385] ##STR00023##
[0386] To a stirred solution of Pre-1 (16.5 mg, 0.1 mmol) in CH.sub.2Cl.sub.2 (1 mL), 4-toluenesulfonyl chloride (22.8 mg, 0.12 mmol), and DIPEA (20.4 L, 0.12 mmol) were added at 25 C. The reaction mixture was stirred at room temperature for 1 h. After completion of the reaction (as monitored by LC-MS), water (1 mL) was added. The aqueous layer was extracted with CH.sub.2Cl.sub.2 (31 mL). The combined organic layer was concentrated in vacuo and the crude product was purified by preparative HPLC using water:ACN (0.1% formic acid) solvent gradient to afford white solid 1c in 14.6 mg (46% yield).
[0387] .sup.1H NMR (500 MHz, CDCl.sub.3) : 2.47 (s, 3H), 4.46 (d, J 5.9 Hz, 2H), 4.49 (s, 2H), 6.66 (br. s., 1H), 7.25 (d, J 7.0 Hz, 2H), 7.28-7.33 (m, 1H), 7.37 (d, J 8.1 Hz, 2H), 7.34 (d, J 7.6 Hz, 2H), 7.79 (d, J 8.3 Hz, 2H).
[0388] .sup.13C NMR (126 MHz, CDCl.sub.3) : 21.7, 43.3, 66.9, 127.8, 128.1, 128.8, 130.2, 131.6, 137.0, 145.9, 165.2.
[0389] ESI-MS (m/z): calculated for C.sub.16H.sub.18NO.sub.4S [M+H]+: 320.10; found: [M+H]+:320.55.
Synthesis of 2-(benzylamino)-2-oxoethyl Methylsulfamate (1d)
[0390] ##STR00024##
[0391] To a stirred solution of Pre-1 (16.5 mg, 0.1 mmol) in CH.sub.2Cl.sub.2 (1 mL), N-methylsulfamoyl chloride (15.4 mg, 0.12 mmol), and DIPEA (20.4 L, 0.12 mmol) were added at 25 C. The reaction mixture was stirred at room temperature for 1 h. After completion of the reaction (as monitored by LC-MS), water (1 mL) was added. The aqueous layer was extracted with CH.sub.2Cl.sub.2 (31 mL). The combined organic layer was concentrated in vacuo and the crude product was purified by preparative HPLC using water:ACN (0.1% formic acid) solvent gradient to afford white solid 1d in 13.4 mg (52% yield).
[0392] .sup.1H NMR (400 MHz, CDCl.sub.3) : 2.79 (d, J=5.1 Hz, 3H), 4.50 (d, J=5.7 Hz, 2H), 4.59 (s, 2H), 5.24 (d, J=4.6 Hz, 1H), 6.79 (br. s., 1H), 7.18-7.45 (m, 4H)
[0393] .sup.13C NMR (100 MHz, CDCl.sub.3) : 29.8, 43.3, 67.2, 127.8, 128.8, 137.0, 166.0.
[0394] ESI-MS (m/z): calculated for C.sub.10H.sub.15N.sub.2O.sub.4S [M+H]+: 259.08; found: [M+H]+:259.64.
Synthesis of 2-(benzylamino)-2-oxoethyl Benzylsulfamate (1e)
[0395] ##STR00025##
[0396] To a stirred solution of Pre-1 (16.5 mg, 0.1 mmol) in CH.sub.2Cl.sub.2 (1 mL), benzylsulfamoyl chloride (24 mg, 0.12 mmol), and DIPEA (20.4 L, 0.12 mmol) were added at 25 C. The reaction mixture was stirred at room temperature for 1 h. After completion of the reaction (as monitored by LC-MS), water (1 mL) was added. The aqueous layer was extracted with CH.sub.2Cl.sub.2 (31 mL). The combined organic layer was concentrated in vacuo and the crude product was purified by preparative HPLC using water:ACN (0.1% formic acid) solvent gradient to afford white solid 1e in 19 mg (57% yield).
[0397] .sup.1H NMR (500 MHz, CDCl.sub.3) : 4.31 (d, J 5.6 Hz, 2H), 4.45 (s, 2H), 4.49 (s, 2H), 5.40 (t, J 5.4 Hz, 1H), 6.48 (br. s., 1H), 7.24-7.29 (m, 3H), 7.29-7.35 (m, 6H), 7.35-7.40 (m, 2H).
[0398] .sup.13C NMR (126 MHz, CDCl.sub.3) : 43.3, 48.0, 67.1, 127.8, 127.8, 128.1, 128.5, 128.8, 129.0, 135.7, 137.0, 165.6.
[0399] ESI-MS (m/z): calculated for C.sub.16H.sub.19N.sub.2O.sub.4S [M+H]+: 335.11; found: [M+H]+:335.18.
Synthesis of 2-(benzylamino)-2-oxoethyl Phenylsulfamate (1f)
[0400] ##STR00026##
[0401] To a stirred solution of Pre-1 (16.5 mg, 0.1 mmol) in CH.sub.2Cl.sub.2 (1 mL), phenylsulfamoyl chloride (22.5 mg, 0.12 mmol), and DIPEA (20.4 L, 0.12 mmol) were added at 25 C. The reaction mixture was stirred at room temperature for 1 h. After completion of the reaction (as monitored by LC-MS), water (1 mL) was added. The aqueous layer was extracted with CH.sub.2Cl.sub.2 (31 mL). The combined organic layer was concentrated in vacuo and the crude product was purified by preparative HPLC using water:ACN (0.1% formic acid) solvent gradient to afford white solid if in 17.2 mg (54% yield).
[0402] .sup.1H NMR (400 MHz, CDCl.sub.3) : 4.42 (d, J 5.7 Hz, 2H), 4.66 (s, 2H), 6.55 (br. s., 1H), 7.21 (d, J 7.5 Hz, 4H), 7.33 (d, J 7.7 Hz, 4H), 7.49 (s, 1H).
[0403] .sup.13C NMR (126 MHz, CDCl.sub.3) : 29.3, 42.7, 66.6, 119.7, 121.0, 124.7, 126.8, 127.3, 128.3, 129.1, 135.9, 162.4 (s).
[0404] ESI-MS (m/z): calculated for C.sub.15H.sub.17N.sub.2O.sub.4S [M+H]+: 321.09; found: [M+H]+:321.57.
Synthesis of 2-(benzylamino)-2-oxoethyl (4-bromophenyl)sulfamate (1g)
[0405] ##STR00027##
[0406] To a stirred solution of 4-bromo aniline (172 mg, 1 mmol) in CH.sub.2Cl.sub.2 (1 mL), chloro methane sulfonyl chloride (22 L, 0.33 mmol) was added at 0 C. The reaction mixture was stirred at room temperature for 1 h. After completion of the reaction organic layer was concentrated in vacuo. The crude product was dissolved CH.sub.2Cl.sub.2 (1 mL) and PCl.sub.5 (68 mg, 0.33 mmol) was added at 0 C. The reaction mixture was stirred at room temperature for 12 h. After completion of the reaction (as monitored by LC-MS), the reaction mixture is filtered and washed with dichloromethane. The filtrate was concentrated and used as such for the next reaction.
[0407] To a stirred solution of Pre-1 (16.5 mg, 0.1 mmol) in CH.sub.2Cl.sub.2 (1 mL), 4-bromo phenylsulfamoyl chloride (0.2 mmol), and DIPEA (35 L, 0.2 mmol) were added at 25 C. The reaction mixture was stirred at room temperature for 1 h. After completion of the reaction (as monitored by LC-MS), water (1 mL) was added. The aqueous layer was extracted with CH.sub.2Cl.sub.2 (32 mL). The combined organic layer was concentrated in vacuo and the crude product was purified by preparative HPLC using water:ACN (0.1% formic acid) solvent gradient to afford white solid 1g in 6 mg (15% yield).
[0408] .sup.1H NMR (500 MHz, CDCl.sub.3) : 4.45 (d, J 5.8 Hz, 2H), 4.66 (s, 2H), 6.36-6.49 (m, 1H), 7.04-7.11 (m, 2H), 7.17 (s, 1H), 7.23 (d, J 6.9 Hz, 2H), 7.32-7.39 (m, 3H), 7.43-7.50 (m, 2H).
[0409] .sup.13C NMR (126 MHz, CDCl.sub.3) : 43.7, 68.3, 114.6, 122.8, 128.1, 128.2, 129.2, 133.1, 137.6, 165.8, 173.3.
[0410] ESI-MS (m/z): calculated for C.sub.15H.sub.16Br.sup.81N.sub.2O.sub.4S [M+H]+:401.00; found: [M+H]+:401.22. C.sub.15H.sub.16Br.sup.79N.sub.2O.sub.4S [M+H]+: 399.00; found: [M+H]+:399.15.
Synthesis of 2-(benzylamino)-2-oxoethyl Dimethylsulfamate (1h)
[0411] ##STR00028##
[0412] To a stirred solution of Pre-1 (16.5 mg, 0.1 mmol) in CH.sub.2Cl.sub.2 (1 mL), N,N-dimethylsulfamoyl chloride (16.9 mg, 0.12 mmol), and DIPEA (20.4 L, 0.12 mmol) were added at 40 C. The reaction mixture was stirred at room temperature for 6 h. After completion of the reaction (as monitored by LC-MS), water (1 mL) was added. The aqueous layer was extracted with CH.sub.2Cl.sub.2 (31 mL). The combined organic layer was concentrated in vacuo and the crude product was purified by preparative HPLC using water:ACN (0.1% formic acid) solvent gradient to afford white solid 1h in 9.5 mg (35% yield).
[0413] .sup.1H NMR (500 MHz, CD.sub.3OD) : 2.92 (s, 6H), 4.46 (s, 2H), 4.63 (s, 2H), 7.23-7.31 (m, 1H), 7.33 (s, 4H).
[0414] .sup.13C NMR (125 MHz, CD.sub.3OD) : 38.8, 44.0, 48.6, 68.3, 128.5, 128.8, 129.7, 139.7, and 168.6.
[0415] ESI-MS (m/z): calculated for C.sub.11H.sub.17N.sub.2O.sub.4S [M+H]+: 273.09; found: [M+H]+:273.86.
Synthesis of N-benzyl-2-(methylsulfonyl)acetamide (1i)
[0416] ##STR00029##
[0417] To a stirred solution of 1a (18.3 mg, 0.1 mmol) in ethanol (1 mL), sodium methanesulfinate (20.4 mg, 0.2 mmol) was added at 25 C. The reaction mixture was stirred at room temperature for 12 h at 70 C. After completion of the reaction (as monitored by LC-MS), ethanol was concentrated in vacuo and the crude product was purified by preparative HPLC using water:ACN (0.1% formic acid) solvent gradient to afford white solid 1i in 17.7 mg (78% yield).
[0418] ESI-MS (m/z): calculated for C.sub.10H.sub.14NO.sub.3S [M+H]+: 228.07; found: [M+H]+:228.22.
Synthesis of N-benzyl-2-(phenylsulfonyl)acetamide (1j)
[0419] ##STR00030##
[0420] To a stirred solution of 1a (23 mg, 0.1 mmol) in ethanol (1 mL), sodium phenylsulfinate (20.2 mg, 0.2 mmol) was added at 25 C. The reaction mixture was stirred at room temperature for 12 h at 70 C. After completion of the reaction (as monitored by LC-MS), ethanol was concentrated in vacuo and the crude product was purified by preparative HPLC using water:ACN (0.1% formic acid) solvent gradient to afford white solid 1j in 23.4 mg (81% yield).
[0421] ESI-MS (m/z): calculated for C.sub.15H.sub.16NO.sub.3S [M+H]+: 290.09; found: [M+H]+:290.65.
Synthesis of N-benzyl-2-hydroxyacetamide (Pre-2)
[0422] ##STR00031##
[0423] To a stirred solution of 4-ethynylaniline (117 mg, 1 mmol) in anhydrous DCM (6 mL), HATU (456 mg, 1.2 mmol) and DIPEA (200 L, 1.2 mmol) were added at 25 C. The reaction mixture was stirred at room temperature for 12 h. After completion of the reaction (as monitored by LC-MS), the reaction mixture was evaporated under vacuo and the crude product was purified using combi flash column chromatography with MeOH:EtOAc (2:8) as eluent to give Pre-2 was colorless solid in 59 mg (yield=34%).
[0424] .sup.1H NMR (500 MHz, CDCl.sub.3): : 3.00 (s, 1H), 3.24 (br. s., 1H), 4.02 (s, 3H), 7.35 (d, J 8.0 Hz, 2H), 7.46 (d, J 8.1 Hz, 2H).
[0425] .sup.13C NMR (126 MHz, CDCl.sub.3) : 65.8, 80.8, 87.2, 121.9, 123.4, 136.8, 141.5, 175.3 (s).
[0426] ESI-MS (m/z): calculated for C.sub.10H.sub.9NO.sub.2S [M+H]+: 176.07; found: [M+H]+:176.09.
Synthesis of 2-((4-ethynylphenyl)amino)-2-oxoethyl Benzylsulfamate (2a)
[0427] ##STR00032##
[0428] To a stirred solution of Pre-2 (17.5 mg, 0.1 mmol) in CH.sub.2Cl.sub.2 (1 mL), benzylsulfamoyl chloride (24 mg, 0.12 mmol), and DIPEA (20.4 L, 0.12 mmol) were added at 25 C. The reaction mixture was stirred at room temperature for 1 h. After completion of the reaction (as monitored by LC-MS), water (1 mL) was added. The aqueous layer was extracted with CH.sub.2Cl.sub.2 (31 mL). The combined organic layer was concentrated in vacuo and the crude product was purified by preparative HPLC using water:ACN (0.1% formic acid) solvent gradient to afford white solid 2a in 16.5 mg (48% yield).
[0429] .sup.1H NMR (400 MHz, CDCl.sub.3) : 3.08 (s, 1H), 4.38 (d, J 5.7 Hz, 2H), 4.54-4.57 (m, 2H), 5.17 (t, J=5.5 Hz, 1H), 7.33-7.41 (m, 4H), 7.42-7.53 (m, 4H), 7.80 (br. s., 1H).
[0430] .sup.13C NMR (100 MHz, CDCl.sub.3) : 48.4, 67.6, 83.4, 120.2, 128.4, 129.0, 129.4, 133.3, 135.7, 137.1, 163.7.
[0431] ESI-MS (m/z): calculated for C.sub.17H.sub.17N.sub.2O.sub.4S [M+H]+: 345.09; found: [M+H]+:345.67.
Synthesis of 2-((4-ethynylphenyl)amino)-2-oxoethyl Phenylsulfamate (2b)
[0432] ##STR00033##
[0433] To a stirred solution of Pre-2 (17.5 mg, 0.1 mmol) in CH.sub.2Cl.sub.2 (1 mL), phenylsulfamoyl chloride (22.5 mg, 0.12 mmol), and DIPEA (20.4 L, 0.12 mmol) were added at 25 C. The reaction mixture was stirred at room temperature for 1 h. After completion of the reaction (as monitored by LC-MS), water (1 mL) was added. The aqueous layer was extracted with CH.sub.2Cl.sub.2 (31 mL). The combined organic layer was concentrated in vacuo and the crude product was purified by preparative HPLC using water:ACN (0.1% formic acid) solvent gradient to afford white solid 2b in 13.8 mg (42% yield).
[0434] .sup.1H NMR (500 MHz, CDCl.sub.3) : 3.07 (s, 1H), 4.74 (s, 2H), 7.26 (br. s., 2H), 7.28 (br. s., 2H), 7.37-7.42 (m, 3H), 7.44-7.47 (m, 2H).
[0435] .sup.13C NMR (126 MHz, CDCl.sub.3) : 67.9, 68.6, 83.0, 119.8, 121.2, 126.5, 129.9, 133.0, 137.3, 141.0, 163.2.
[0436] ESI-MS (m/z): calculated for C.sub.16H.sub.15N.sub.2O.sub.4S [M+H]+: 331.08; found: [M+H]+:331.97.
Synthesis of 2-chloro-N-(4-ethynylphenyl)acetamide (2c)
[0437] ##STR00034##
[0438] To a stirred solution of 4-ethynylaniline (11.7 mg, 1 mmol) in anhydrous DCM (0.5 mL), DIPEA (17.8 L, 1 mmol) and chloroacetic anhydride (17 mg, 1 mmol) were added at 25 C. The reaction mixture was stirred at room temperature for 1 h. After completion of the reaction (as monitored by LC-MS), CH.sub.2Cl.sub.2 was concentrated in vacuo and the crude compound was purified by preparative HPLC using water:ACN (0.100 formic acid) solvent gradient to afford white solid 2c in 15.8 mg (yield=820%).
[0439] .sup.1H NMR (400 MHz, CDCl.sub.3) : 3.08 (s, 1H), 4.20 (s, 2H), 7.41-7.60 (m, 4H), 8.28 (br. s., 1H).
[0440] .sup.13C NMR (100 MHz, CDCl.sub.3) : 42.8, 83.0, 118.8, 119.6, 133.0, 137.0, 163.8.
[0441] ESI-MS (m/z): calculated for C.sub.10H.sub.9ClNO [M+H]+: 194.04; found: [M+H]+: 194.82.
Example 2
Reactivity of Sulfamate Acetamide Compounds
[0442] To investigate the reactivity of sulfamate acetamide compounds, nine sulfo-based model electrophile compounds were synthesized (See Example 3) including two sulfonates (1b and 1c) five sulfamates (1d-1h), and two sulfones (1i and 1j;
[0443] The model compounds are as shown in the Table 3.
TABLE-US-00004 TABLE 3 Model compounds. Compound number Structure 1a
[0444] GSH consumption assays were conducted (5 mM GSH, 200 M electrophile at pH 8, 14 C.; 4-nitro cyano-benzene was used as an internal standard) for all the sulfo compounds as well as benzyl acrylamide (BnA) and chloroacetamide (1a) (
[0445] Surprisingly, phenyl sulfamate (1f; t1/2=25 h) and 4-bromo phenyl sulfamate (1g; t1/2>100 h) exhibit much lower reactivity, possibly because the release of electrons from the amine to the sulfur increases conjugation and stabilization (
[0446] Sulfamate model compounds (1d-1j) are an order of magnitude less reactive to GSH than the corresponding chloroacetamide (1a) and sulfonate compounds (1b-1c). Whereas the aryl-substituted and secondary amine substituted sulfamates show even drastically lower reactivity (
[0447] The fact that additional bands were detected with the phenyl sulfamate acetamide compared to the chloroacetamide may suggest that the extra recognition of the phenyl sulfamate mediates additional interactions with some protein targets. Similar to substituted methacrylamides, these compounds also leave identical adducts on proteomically labeled cysteines. Hence, mixtures of sulfamates can serve as probes for quantitative chemoproteomics with potentially increased coverage.
Example 3
Synthesis of Sulfamate Compounds (FIG. 9)
Synthesis of N-(1,1-dioxidotetrahydrothiophen-3-VO-2-hydroxy-N-neopentylacetamide (Pre-4)
[0448] ##STR00048##
[0449] To a stirred solution of sulfopin (281 mg, 1 mmol) in DMSO (2 mL), NaOH (5 M, 2 mL) was added at 25 C. The reaction mixture was stirred at room temperature for 12 h. After completion of the reaction (as monitored by LC-MS), water (1 mL) was added. The aqueous layer was extracted with Ethyl acetate (33 mL). The combined organic layer was concentrated in vacuo and the crude product was purified by preparative HPLC using water:ACN (0.1% formic acid) solvent gradient to afford white solid Pre-4 in 121 mg (46% yield).
[0450] .sup.1H NMR (500 MHz, CDCl3) : 1.01 (s, 10H), 2.49-2.64 (m, 2H), 2.92-2.99 (m, 1H), 3.02 (s, 1H), 3.05-3.10 (m, 1H), 3.16 (dd, J=12.6, 8.3 Hz, 2H), 3.71 (dt, J 12.9, 9.2 Hz, 1H), 3.79 (dd, J 12.6, 9.8 Hz, 1H), 3.90-3.99 (m, 1H), 4.11-4.22 (m, 2H).
[0451] .sup.13C NMR (126 MHz, CDCl3) : 26.6, 28.1, 33.6, 49.5, 50.5, 57.2, 60.1, 60.6, 173.2.
[0452] ESI-MS (m/z): calculated for C.sub.11H.sub.22NO.sub.4S [M+H]+: 264.12; found: [M+H]+:264.16.
Synthesis of 2-((1,1-dioxidotetrahydrothiophen-3-yl)(neopentyl)amino)-2-oxoethyl Methanesulfonate (4a)
[0453] ##STR00049##
[0454] To a stirred solution of Pre-4 (13 mg, 0.05 mmol) in CH.sub.2Cl.sub.2 (1 mL), methane sulfonyl chloride (4.6 L, 0.06 mmol, d=1.48), and DIPEA (10.2 L, 0.06 mmol) were added at 25 C. The reaction mixture was stirred at room temperature for 1 h. After completion of the reaction (as monitored by LC-MS), water (1 mL) was added. The aqueous layer was extracted with CH.sub.2Cl.sub.2 (31 mL). The combined organic layer was concentrated in vacuo and the crude product was purified by preparative HPLC using water:ACN (0.1% formic acid) solvent gradient to afford white solid 4a in 9.8 mg (74% yield).
[0455] .sup.1H NMR (500 MHz, CDCl3): : 1.03 (s, 9H), 2.50-2.59 (m, 2H), 3.01 (s, 1H), 3.04-3.19 (m, 3H), 3.27 (s, 3H), 3.64-3.83 (m, 2H), 3.93 (d, J 8.0 Hz, 1H), 4.86 (s, 2H).
[0456] HR-MS (m/z): calculated for C.sub.12H.sub.24NO.sub.6S.sub.2 [M+Na]+: 342.1045; found: [M+Na]+:342.1045.
Synthesis of 2-((1,1-dioxidotetrahydrothiophen-3-yl)(neopentyl)amino)-2-oxoethyl Methylsulfamate (4b)
[0457] ##STR00050##
[0458] To a stirred solution of pre-4 (13 mg, 0.05 mmol) in CH.sub.2C.sub.12 (1 mL), N-methylsulfamoyl chloride (7.74 mg, 0.06 mmol), and DIPEA (10.2 L, 0.06 mmol) were added at 25 C. The reaction mixture was stirred at room temperature for 1 h. After completion of the reaction (as monitored by LC-MS), water (1 mL) was added. The aqueous layer was extracted with CH.sub.2Cl.sub.2 (31 mL). The combined organic layer was concentrated in vacuo and the crude product was purified by preparative HPLC using water:ACN (0.1% formic acid) solvent gradient to afford white solid 4b in 6.74 mg (38% yield).
[0459] .sup.1H NMR (500 MHz, CDCl.sub.3) : 1.03 (s, 9H), 2.55 (d, J 8.5 Hz, 2H), 2.91 (s, 3H), 2.97-3.09 (m, 2H), 3.09-3.20 (m, 2H), 3.63-3.71 (m, 1H), 3.73-3.82 (m, 1H), 3.85-3.98 (m, 1H), 4.80 (s, 2H), 5.21 (br. s., 1H).
[0460] .sup.13C NMR (125 MHz, CDCl.sub.3) : 26.6, 28.0, 30.4, 33.7, 49.3, 50.5, 57.7, 61.3, 67.5, 168.0.
[0461] HR-MS (m/z): calculated for C.sub.12H.sub.24N.sub.2NaO.sub.6S.sub.2 [M+Na]+: 379.0973; found: [M+Na]+:379.0964.
Synthesis of 2-((1,1-dioxidotetrahydrothiophen-3-yl)(neopentyl)amino)-2-oxoethyl Benzylsulfamate (4c)
[0462] ##STR00051##
[0463] To a stirred solution of Pre-4 (13 mg, 0.05 mmol) in CH.sub.2Cl.sub.2 (1 mL), benzylsulfamoyl chloride (12.3 mg, 0.06 mmol), and DIPEA (10.2 L, 0.06 mmol) were added at 25 C. The reaction mixture was stirred at room temperature for 1 h. After completion of the reaction (as monitored by LC-MS), water (1 mL) was added. The aqueous layer was extracted with CH.sub.2Cl.sub.2 (31 mL). The combined organic layer was concentrated in vacuo and the crude product was purified by preparative HPLC using water:ACN (0.1% formic acid) solvent gradient to afford white solid 4c in 11.4 mg (53% yield).
[0464] .sup.1H NMR (500 MHz, CDCl.sub.3) : 1.00 (s, 9H), 2.50 (m, 2H), 3.00 (m, 2H), 3.11 (m, 2H), 3.60 (m, 1H), 3.71 (m, 1H), 3.89 (quin, J 7.9 Hz, 1H), 4.39 (d, J 5.4 Hz, 2H), 4.76 (s, 2H), 5.64 (br. s., 1H), 7.35 (m, 5H).
[0465] .sup.13C NMR (125 MHz, CDCl.sub.3) : 26.6, 28.0, 33.7, 48.2, 49.3, 50.4, 57.6, 61.2, 67.4, 128.1, 128.2, 128.8, 136.1, 167.7.
[0466] HR-MS (m/z): calculated for C.sub.18H.sub.28N.sub.2NaO.sub.6S.sub.2[M+Na]+: 455.1286; found: [M+Na]+:455.1279.
Synthesis of 2-((1,1-dioxidotetrahydrothiophen-3-yl)(neopentyl)amino)-2-oxoethyl Phenylsulfamate (4d)
[0467] ##STR00052##
[0468] To a stirred solution of pre-4 (13 mg, 0.05 mmol) in CH.sub.2Cl.sub.2 (1 mL), phenylsulfamoyl chloride (11.5 mg, 0.06 mmol), and DIPEA (10.2 L, 0.06 mmol) were added at 25 C. The reaction mixture was stirred at room temperature for 1 h. After completion of the reaction (as monitored by LC-MS), water (1 mL) was added. The aqueous layer was extracted with CH.sub.2Cl.sub.2 (32 mL). The combined organic layer was concentrated in vacuo and the crude product was purified by preparative HPLC using water:ACN (0.1% formic acid) solvent gradient to afford white solid 4d in 10.2 mg (49% yield).
[0469] .sup.1H NMR (500 MHz, CD3OD) : 0.98 (s, 10H), 2.45-2.52 (m, 2H), 2.57 (s, 1H), 3.05 (dt, J 13.0, 6.4 Hz, 1H), 3.11-3.26 (m, 3H), 3.51-3.63 (m, 2H), 4.02 (quin, J 8.0 Hz, 1H), 4.80 (s, 2H), 7.16 (s, 1H), 7.25 (d, J 8.0 Hz, 2H), 7.35 (t, J 7.8 Hz, 2H).
[0470] .sup.13C NMR (126 MHz, CD3OD) : 27.8, 28.4, 34.5, 50.7, 51.9, 59.2, 61.7, 68.4, 121.1, 125.7, 130.5, 138.7, 145.7, 168.9.
[0471] HR-MS (m/z): calculated for C.sub.17H.sub.26N.sub.2NaO.sub.6S.sub.2[M+Na]+: 441.1130; found: [M+Na]+:441.1120.
Synthesis of 2-((1,1-dioxidotetrahydrothiophen-3-yl)(neopentyl)amino)-2-oxoethyl (4-bromophenyl)sulfamate (4e)
[0472] ##STR00053##
[0473] To a stirred solution of Pre-4 (13 mg, 0.05 mmol) in CH.sub.2Cl.sub.2 (1 mL), 4-bromo phenylsulfamoyl chloride (see synthesis of 1g for preparation) (27 mg, 0.1 mmol), and DIPEA (17.6 L, 0.1 mmol) were added at 25 C. The reaction mixture was stirred at room temperature for 1 h. After completion of the reaction (as monitored by LC-MS), water (1 mL) was added. The aqueous layer was extracted with CH.sub.2Cl.sub.2 (32 mL). The combined organic layer was concentrated in vacuo and the crude product was purified by preparative HPLC using water:ACN (0.1% formic acid) solvent gradient to afford white solid 4d in 4.4 mg (18% yield).
[0474] .sup.1H NMR (500 MHz, CDCl3) : 1.02 (s, 9H), 2.50-2.63 (m, 2H), 2.98-3.05 (m, 1H), 3.05-3.13 (m, 2H), 3.13-3.21 (m, 1H), 3.62-3.71 (m, 1H), 3.73-3.81 (m, 1H), 3.87-3.98 (m, 1H), 4.89 (s, 2H), 7.22 (d, J 8.8 Hz, 2H), 7.46-7.54 (m, 3H).
[0475] .sup.13C NMR (125 MHz, CDCl3) : 26.6, 28.1, 33.8, 49.5, 50.6, 57.9, 61.4, 68.8, 124.3, 132.5. quaternary carbons were not detected.
[0476] HR-MS (m/z): calculated for C.sub.17H.sub.25Br.sup.79N.sub.2NaO.sub.6S.sub.2[M+Na]+: 519.0235; found: [M+Na]+:519.0233, calculated for C.sub.17H.sub.25Br.sup.81N.sub.2NaO.sub.6S.sub.2[M+Na]+: 521.0215; found: [M+Na]+:521.0214.
Synthesis of 2-((1,1-dioxidotetrahydrothiophen-3-yl)(neopentyl)amino)-2-oxoethyl p-tolylsulfamate (4f)
[0477] ##STR00054##
[0478] To a stirred solution of pre-4 (13 mg, 0.05 mmol) in CH.sub.2Cl.sub.2 (1 mL), 4-methyl phenylsulfamoyl chloride (see synthesis of 1g for preparation) (11.5 mg, 0.06 mmol), and DIPEA (10.2 L, 0.06 mmol) were added at 25 C. The reaction mixture was stirred at room temperature for 1 h. After completion of the reaction (as monitored by LC-MS), water (1 mL) was added. The aqueous layer was extracted with CH.sub.2Cl.sub.2 (32 mL). The combined organic layer was concentrated in vacuo and the crude product was purified by preparative HPLC using water:ACN (0.1% formic acid) solvent gradient to afford white solid 4d in 2.5 mg (12% yield).
[0479] .sup.1H NMR (500 MHz, CD.sub.3OD) : 0.95 (s, 10H), 1.26-1.38 (m, 2H), 2.29 (s, 3H), 2.42-2.51 (m, 2H), 3.03 (dt, J 12.9, 6.5 Hz, 1H), 3.15-3.21 (m, 2H), 3.56 (dd, J 13.4, 8.9 Hz, 2H), 3.95-4.05 (m, 1H), 4.71-4.80 (m, 2H), 7.08-7.21 (m, 5H).
[0480] .sup.13C NMR (126 MHz, CD.sub.3OD) : 21.4, 28.2, 28.9, 32.3, 51.2, 52.4, 59.7, 62.2, 68.9, 122.3, 131.5, 168.5.
[0481] HR-MS (m/z): calculated for C.sub.18H.sub.29N.sub.2O.sub.6S.sub.2[M+H]+: 433.1467; found: [M+H]+:433.1467.
Synthesis of 2-((cyclohexylmethyl)(1,1-dioxidotetrahydrothiophen-3-yl)amino)-2-oxoethyl Phenylsulfamate (4g)
[0482] ##STR00055##
[0483] To a stirred solution of alcohol (14.5 mg, 0.05 mmol) in CH.sub.2C.sub.12 (1 mL), phenylsulfamoyl chloride (11.5 mg, 0.06 mmol), and DIPEA (10.2 L, 0.06 mmol) were added at 25 C. The reaction mixture was stirred at room temperature for 1 h. After completion of the reaction (as monitored by LC-MS), water (1 mL) was added. The aqueous layer was extracted with CH.sub.2Cl.sub.2 (32 mL). The combined organic layer was concentrated in vacuo and the crude product was purified by preparative HPLC using water:ACN (0.1% formic acid) solvent gradient to afford white solid 4g in 7.5 mg (34% yield).
[0484] .sup.1H NMR (500 MHz, CDCl.sub.3) : 0.87 (d, J 14.3 Hz, 3H), 0.91-0.98 (m, 2H), 1.13-1.33 (m, 6H), 1.54 (br. s., 2H), 2.41-2.65 (m, 2H), 2.99-3.10 (m, 3H), 3.12 (s, 1H), 3.16 (br. s., 1H), 3.58 (d, J=8.1 Hz, 1H), 3.64-3.76 (m, 1H), 4.00-4.11 (m, 1H), 4.86 (s, 2H), 7.26-7.46 (m, 5H).
[0485] .sup.13C NMR (126 MHz, CDCl.sub.3) : 25.7, 26.0, 26.2, 30.7, 30.8, 37.8, 49.9, 50.7, 55.5, 55.9, 68.6, 122.4, 126.1, 129.4, 144.7.
[0486] HR-MS (m/z): calculated for C.sub.19H.sub.28N.sub.2NaO.sub.6S.sub.2[M+Na]+: 467.1286; found: [M+Na]+:467.1286.
Example 4
Selectivity of Sulfamate Acetamide Compounds Towards Cysteine
[0487] To understand the selectivity of these electrophiles towards cysteine over other nucleophilic amino acids, the glutamic acid and lysine with five model compounds (BnA, 1a, 1b, 1d & 1e) were reacted under stringent reaction conditions (pH 8, 37 C.; 4 days;
Example 5
Proteomic Reactivity of Sulfamate Acetamide Compounds
[0488] Sulfamate acetamides show attenuated and tunable proteomic reactivity. To assess proteomic selectivity in cells, two sulfamate acetamides (2a and 2b) and a chloroacetamide (2c) with an alkyne functionality have been synthesized (
Example 6
Sulfamate Compounds as Potent Inhibitors of Pin1
[0489] Sulfopin (
[0490] Initially, these compounds (4a-4g; 2 M) were incubated with Pin1 (2 M; 50 mM Tris buffer; pH 7.5, 1 h; 25 C.) to check covalent labeling by intact protein MS (
[0491] Under these conditions Sulfopin labeled 59% as previously reported [Dubiella, C. et al. Nat. Chem. Biol. 17, 954-963 (2021) which is hereby incorporated by reference in its entirety], the sulfonate (4a) labeled 18% whereas alkyl sulfamates (4b, 4c) labeled 16% and 56% respectively. Phenyl sulfamate (4d) and 4-bromo phenyl sulfamate (4e) showed >90% labeling. 4g contains both a cyclohexyl group instead of the tertbutyl as well as a phenyl sulfamate electrophile, and was able to label >95% of Pin1 under these conditions.
[0492] To characterized the kinetics of Pin1 binding, by incubating Pin1 (0.5 M) with various concentrations of sulfopin or 4d (100 mM Tris buffer; pH 7.4; 14 C.) and monitoring the reaction by LC-MS at different time points, and determined K.sub.I and K.sub.inact for both compounds. Although the K.sub.inact values for both sulfopin (2.31 s.sup.1) and 4d (2.48 s.sup.1) are similar, the K.sub.1 value of 4d (43.6 M) is better than for sulfopin (216.9 M;
[0493] To assess the reactivity of these Sulfopin-based derivativessulfamate compounds, a DTNB thiol reactivity assay (
[0494] To understand the binding mode of these compounds, the pre-reacted compounds were modeled in complex with Pin1 (
[0495] Similar to the model compounds, the chloroacetamide (Sulfopin) and sulfonate (4a) warheads show 30% and 15% hydrolysis after 2 days respectively (
[0496] Using the previous reported results of the Applicants on Sulfopin-DTB probe [Dubiella, C. et al. Nat. Chem. Biol. 17, 954-963 (2021), which is hereby incorporated by reference in its entirety]. (
[0497] While certain features and uses thereof have been illustrated and described herein, many modifications, substitutions, changes, and equivalents will now occur to those of ordinary skill in the art. It is, therefore, to be understood that the appended claims are intended to cover all such modifications and changes as fall within the true spirit of the disclosure herein.