FIBRONECTIN TYPE III DOMAIN PROTEINS WITH ENHANCED SOLUBILITY
20210070840 ยท 2021-03-11
Inventors
Cpc classification
C07K14/78
CHEMISTRY; METALLURGY
International classification
Abstract
Provided herein are polypeptides comprising a modified fibronectin type III (Fn3) domain, wherein the amino acid corresponding to residue 58 of SEQ ID NO: 1 is mutated, and wherein the solubility is enhanced relative to the solubility of a Fn3 domain in which the amino acid corresponding to residue 58 of SEQ ID NO: 1 is not mutated. Also provided are libraries comprising a plurality of the polypeptides and a method for identifying a polypeptide that binds to a target.
Claims
1-40. (canceled)
41. A nucleic acid encoding a polypeptide comprising a 10.sup.th human fibronectin type III (.sup.10Fn3) domain, wherein the amino acid in the .sup.10Fn3 domain corresponding to residue 58 of SEQ ID NO: 1 is Glu (E), and wherein the solubility of the .sup.10Fn3 domain is enhanced relative to the solubility of the same .sup.10Fn3 domain wherein the amino acid corresponding to residue 58 of SEQ ID NO: 1 is Thr (T).
42. The nucleic acid of claim 41, further comprising at least one pharmacokinetic (PK) moiety selected from the group consisting of: a polyoxyalkylene moiety, a human serum albumin binding protein, sialic acid, human serum albumin, IgG, an IgG binding protein, transferrin, an Fc, and an Fc fragment.
43. The nucleic acid of claim 42, wherein the PK moiety is a polyoxyalkylene moiety, and wherein the polyoxyalkylene moiety is polyethylene glycol.
44. The nucleic acid of claim 42, wherein the PK moiety is an Fc or Fc fragment.
45. The nucleic acid of claim 41, wherein the .sup.10Fn3 domain comprises a BC loop which has the amino acid sequence of the corresponding BC loop of the wildtype human .sup.10Fn3 domain (SEQ ID NO: 1).
46. The nucleic acid of claim 41, wherein the solubility of the polypeptide is determined using an ammonium sulfate solubility assay.
47. The nucleic acid of claim 41, wherein the DE loop of the .sup.10Fn3 domain is hydrophobic.
48. An expression vector comprising the nucleic acid of claim 41.
49. A host cell comprising the nucleic acid of claim 41.
50. A host cell comprising the expression vector of claim 48.
51. A method of producing a polypeptide comprising a 10.sup.th human fibronectin type in (.sup.10Fn3) domain comprising: (a) culturing the host cell of claim 49 under conditions that produce the polypeptide, and (b) isolating the polypeptide.
52. A method of producing a polypeptide comprising a 10.sup.th human fibronectin type III (.sup.10Fn3) domain comprising: (a) culturing the host cell of claim 50 under conditions that produce the polypeptide, and (b) isolating the polypeptide.
53. A method of treating a disease or disorder comprising administering to a subject in need thereof a polypeptide comprising a 10.sup.th human fibronectin type III (.sup.10Fn3) domain, wherein the amino acid in the .sup.10Fn3 domain corresponding to residue 58 of SEQ ID NO: 1 is Glu (E), and wherein the solubility of the .sup.10Fn3 domain is enhanced relative to the solubility of the same .sup.10Fn3 domain wherein the amino acid corresponding to residue 58 of SEQ ID NO: 1 is Thr (T).
54. A composition comprising a polypeptide comprising a 10.sup.th human fibronectin type HI (.sup.10Fn3) domain, wherein the amino acid in the .sup.10Fn3 domain corresponding to residue 58 of SEQ ID NO: 1 is Glu (E), and wherein the solubility of the .sup.10Fn3 domain is enhanced relative to the solubility of the same .sup.10Fn3 domain wherein the amino acid corresponding to residue 58 of SEQ ID NO: 1 is Thr (T).
Description
BRIEF DESCRIPTION OF THE FIGURES
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
DETAILED DESCRIPTION
Definitions
[0038] The term polypeptide refers to any sequence of two or more amino acids, regardless of length, post-translation modification, or function. Polypeptides can include natural amino acids and non-natural amino acids such as those described in U.S. Pat. No. 6,559,126, incorporated herein by reference. Polypeptides can also be modified in any of a variety of standard chemical ways (e.g., an amino acid can be modified with a protecting group; the carboxy-terminal amino acid can be made into a terminal amide group; the amino-terminal residue can be modified with groups to, e.g., enhance lipophilicity; or the polypeptide can be chemically glycosylated or otherwise modified to increase stability or in vivo half-life). Polypeptide modifications can include the attachment of another structure such as a cyclic compound or other molecule to the polypeptide and can also include polypeptides that contain one or more amino acids in an altered configuration (i.e., R or S; or, L or D).
[0039] As used herein, a fibronectin based scaffold or FBS protein or moiety refers to proteins or moieties that are based on a domain in fibronectin, e.g., fibronectin type III (Fn3) repeat. A protein or a domain (of a protein) that is based on an Fn3 repeat is referred to herein as Fn3 protein, Fn3 domain protein or Fn3 domain. Fn3 is a small (about 10 kDa) domain that has the structure of an immunoglobulin (Ig) fold (i.e., an Ig-like -sandwich structure, consisting of seven -strands and six loops). Fibronectin has 18 Fn3 repeats, and while the sequence homology between the repeats is low, they all share a high similarity in tertiary structure. Fn3 domains are also present in many proteins other than fibronectin, such as adhesion molecules, cell surface molecules, e.g., cytokine receptors, and carbohydrate binding domains. The term fibronectin based scaffold protein or moiety or Fn3 protein or Fn3 domain or Fn3 domain protein is intended to include proteins or domains based on Fn3 domains from these other (i.e., non fibronectin) proteins. Exemplary Fn3 domains include the 7.sup.th, 10.sup.th and 14.sup.th fibronectin type III domain, which are referred to herein as .sup.7Fn3, .sup.10Fn3 and .sup.14Fn3, respectively. As used herein, a Fn3 domain or Fn3 moiety or Fn3 domain protein refers to wildtype Fn3 (e.g., SEQ ID NOs: 1-8, 10, 12, 14 or 16, 65 or 66) and biologically active variants thereof, e.g., biologically active variants that may specifically bind to a target, such as EGFR, IL23 and IGF1R. For example, .sup.10Fn3 molecules binding to specific targets may be selected from .sup.10Fn3 libraries using the PROfusion technique, which is described, e.g., in WO02/32925. A wild type .sup.10Fn3 domain may comprise one of the amino acid sequences set forth in SEQ ID NOs: 1-8, 10, 12, 14, 16. The amino acid sequence of wildtype human .sup.10Fn3 is set forth in SEQ ID NO: 1. A wild type .sup.7Fn3 domain may comprise the amino acid sequence set forth in SEQ ID NO: 65. A wild type .sup.14Fn3 domain may comprise the amino acid sequence set forth in SEQ ID NO: 66. Biologically active variants of a Fn3 domain include Fn3 domains that comprise at least, at most or about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, or 40 amino acid variations, i.e., substitutions, additions or deletions, relative to a Fn3 domain comprising an amino acid sequence selected from SEQ ID NOs: 1-16, and 65-71. A biologically active variant of a Fn3 domain may also comprise, or comprise at most, 1-3, 1-5, 1-10, 1-15, 1-20, 1-25, 1-30, or 1-40 amino acid changes relative to a Fn3 domain comprising an amino acid sequence selected from SEQ ID NOs: 1-16, and 65-71. In certain embodiments, a biologically active variant of a Fn3 domain does not comprise more than 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 1, 2, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, or 40 amino acid variations, i.e., substitutions, additions or deletions, relative to an Fn3 domain comprising an amino acid sequence selected from SEQ ID NOs: 1-16, and 65-71. An amino acid change(s) may be in a loop region and/or in a non-loop region, e.g., a -strand. Exemplary degenerate .sup.10Fn3 amino acid sequences are provided herein as SEQ ID NOs: 17-29.
[0040] The phrase comprising an amino acid sequence based on a specific or first sequence is intended to include amino acid sequences that are derived from the specific or first amino acid sequence, e.g., by amino acid substitutions, additions or deletions. For example, a protein comprising an amino acid sequence based on an amino acid sequence selected from SEQ ID NOs: 1-29 and 65-66 refers to a protein comprising an amino acid sequence that is derived from any of SEQ ID NOs: 1-29 and 65-66, including, e.g., a protein comprising an amino acid sequence that differs from one or more of SEQ ID NOs: 1-29 and 65-66 in one or more loop or non-loop sequences, such as to obtain binding to a desired target.
[0041] A region of a Fn3 domain (or moiety) as used herein refers to either a loop (AB, BC, CD, DE, EF and FG), a -strand (A, B, C, D, E, F and G), the N-terminus (e.g. amino acid residues 1-7 of SEQ ID NO: 1 or 6), or the C-terminus (e.g. amino acid residues 93-101 of SEQ ID NO: 1 or amino acid residues 93-95 of SEQ ID NO: 6) of a Fn3 domain.
[0042] An Fn3 domain may comprise, in order from N-terminus to C-terminus, a beta or beta-like strand, A; a loop, AB; a beta or beta-like strand, B; a loop, BC; a beta or beta-like strand, C; a loop, CD; a beta or beta-like strand, D; a loop, DE; a beta or beta-like strand, E; a loop, EF; a beta or beta-like strand, F; a loop, FG; and a beta or beta-like strand, G. The seven antiparallel -strands are arranged as two beta sheets that form a stable core, while creating two faces composed of the loops that connect the beta or beta-like strands. Loops AB, CD, and EF are located at one face (the south pole) and loops BC, DE, and FG are located on the opposing face (the north pole). Any or all of loops AB, BC, CD, DE, EF and FG may participate in or contribute to ligand binding.
[0043] The term non-loop region of a Fn3 domain refers to a -strand, the N-terminus, or the C-terminus of a Fn3 domain. A non-loop region of a Fn3 domain may also be referred to as a scaffold region.
[0044] A north pole loop refers to any one of the BC, DE and FG loops of a Fn3 domain.
[0045] A south pole loop refers to any one of the AB, CD and EF loops of a Fn3 domain.
[0046] Percent (%) amino acid sequence identity herein is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in a selected sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, ALIGN-2 or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full-length of the sequences being compared.
[0047] For purposes herein, the % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B (which can alternatively be phrased as a given amino acid sequence A that has or comprises a certain % amino acid sequence identity to, with, or against a given amino acid sequence B) is calculated as follows: 100 times the fraction X/Y where X is the number of amino acid residues scored as identical matches by a sequence alignment program, such as BLAST, BLAST-2, ALIGN, ALIGN-2 or Megalign (DNASTAR), in that program's alignment of A and B, and where Y is the total number of amino acid residues in B. It will be appreciated that where the length of amino acid sequence A is not equal to the length of amino acid sequence B, the % amino acid sequence identity of A to B will not equal the % amino acid sequence identity of B to A.
[0048] As used herein, an amino acid residue in a polypeptide is considered to contribute to binding a target if (1) any of the non-hydrogen atoms of the residue's side chain or main chain is found to be within five angstroms of any atom of the binding target based on an experimentally determined three-dimensional structure of the complex, and/or (2) mutation of the residue to its equivalent in wildtype Fn3 (e.g., SEQ ID NO: 1), to alanine, or to a residue having a similarly sized or smaller side chain than the residue in question, leads to a measured increase of the equilibrium dissociation constant to the target (e.g., an increase in the k.sub.on).
[0049] As used herein, Fc encompasses domains derived from the constant region of an immunoglobulin, preferably a human immunoglobulin, including a fragment, analog, variant, mutant or derivative of the constant region. Suitable immunoglobulins include IgG1, IgG2, IgG3, IgG4, and other classes such as IgA, IgD, IgE and IgM. The constant region of an immunoglobulin is defined as a naturally-occurring or synthetically-produced polypeptide homologous to the immunoglobulin C-terminal region, and can include a CH1 domain, a hinge, a CH2 domain, a CH3 domain, or a CH4 domain, separately or in combination. The term Fc moiety or Fc domain as used herein refers to any of the combination of CH1, hinge, CH2, CH3 and CH4 domains. Thus, an Fc domain or moiety may or may not comprise a hinge.
[0050] Moiety refers to a portion of a protein. For example, a fusion protein may comprise several moieties. In one embodiment, a fusion protein comprises a fibronectin (Fn) based scaffold moiety and an Fc moiety.
[0051] The term enhanced solubility may mean higher proportion (e.g. concentration, molality, mole fraction, or mole ratio) of a protein solute in a designated solvent, under saturated solution conditions, as compared to another protein. This may also be expressed as higher solubility limit of a protein. Enhanced solubility may also mean decreased protein aggregation, or lower proportion (e.g. percentage, fraction, or ratio) of aggregated protein species at a given protein concentration in a designated solvent, as compared to another protein. This may be alternatively expressed as decreased aggregation propensity of a protein. The term aggregation may refer to interaction or association between two or more protein molecules, for example, proteins in their native conformation or misfolded protein molecules. The interacting or associating molecules may be referred to as, for example, an aggregate, oligomer (such as, dimer, trimer, tetramer, or higher order oligomers), high molecular weight species, higher order species, or other related terms which are commonly understood by one of ordinary skill in the art. The solubility of a protein may be analyzed by any suitable techniques. In some embodiments, the solubility of a protein may be analyzed by ammonium sulfate solubility assay. In some embodiments, the solubility of a protein may be analyzed by ultrafiltration. In some embodiments, the solubility of a protein may be analyzed under accelerated stress conditions.
[0052] In some embodiments, the solubility of a protein may be regarded as enhanced if the solubility of a protein in a solvent is enhanced by at least 1%, 2%, 5%, 10%, 15%, 20%, 30%, or 50% or more as compared to the solubility of another protein in the solvent. In some embodiments, the solubility of a protein may be regarded as enhanced if the solubility limit of a protein in a solvent is at least 0.01 mg/ml, 0.1 mg/ml, 0.5 mg/ml, 1 mg/ml, 2 mg/ml, 5 mg/ml, 10 mg/ml, 20 mg/ml, 50 mg/ml, 100 mg/ml, 200 mg/ml, or 500 mg/ml higher than the solubility limit of another protein in the solvent. In some embodiments, the solubility of a protein may be regarded as enhanced if the percentage of aggregated protein species at a given concentration is lower by at least 0.5%, 1%, 2%, 5%, 10%, 20%, 50% or more as compared to the percentage of aggregated protein species of another protein at the concentration.
Overview of Protein Solubility and Assays
[0053] Protein aggregation is a complex process that may originate by several different mechanisms (Morris, A. M. et al., 2009, Biochim Biophys Acta. 1794, 375-97; Joubert, M. K. et al., 2011, J Biol Chem 286, 25118-33; Weiss, W. F. et al., 2009, J Pharm Sci. 98, 1246-77; Roberts, C. J. 2007, Biotechnol Bioeng. 98, 927-38; Hawe, A. et al., 2009, Eur J Pharm Sci. 38, 79-87; Mahler, H. C. et al., 2009, J Pharm Sci. 98, 2909-34; Philo, J. S. and Arakawa, T., 2009, Curr Pharm Biotechnol. 10, 348-51). Aggregates may form, for example, due to self-association of the native conformation, or structurally altered states such as a molten globule, denatured, degraded, or chemically modified structures. Protein aggregation or solubility may also be influenced by solution conditions, the presence of contaminants, as well as a variety of external factors such as temperature, mechanical stress, or freeze/thaw stress. Moreover, the types of aggregate may be covalent or non-covalent, and may differ in morphology ranging from soluble dimers or higher order oligomers, to insoluble amorphous precipitates, or more regular amyloid structures.
[0054] A number of techniques may be used to analyze protein solubility and to detect aggregates of different sizes and morphologies, as well as to characterize the mechanisms of aggregation (Wang, W. 2005, Int J Pharm 289, 1-30; Singh, S. K. et al., 2010, J Pharm Sci. 99, 3302-21; Kamerzell, T. J. et al., 2011, Adv Drug Deliv Rev. 63, 1118-59; Zlls, S. et al., 2012, J Pharm Sci. 101, 914-35). Techniques based on the principles of light scattering, spectroscopy, electrophoresis, chromatography and many others may be used to characterize protein aggregation, stability and solubility, or to compare the aggregation propensity or solubility of different protein molecules to each other, or one molecule under different solution conditions. The proteins may be concentrated prior to analysis using methods such as ultrafiltration or lyophilization. Or smaller scale methods may be used to concentrate proteins for solubility and aggregation analysis, including the use of osmotic-pressure, freeze/thaw, and solvent evaporation (Shire, S. J. et al., 2004, J Pharm Sci. 93, 1390-402). Aggregation may also be studied at lower protein concentrations under accelerated stress conditions such as elevated temperature, shear or mixing stress (Hawe, A. et al., 2012, J Pharm Sci. 101, 895-913), using high throughput fluorescent dye binding assays (Kayser, V. et al., 2012, Biotechnol J. 7, 127-32; He, F. et al., 2010, J Pharm Sci. 99, 1707-20), or even predicted using in silico methods (Caflisch, A., 2006, Curr Opin Chem Biol. 10, 437-44; Fernandez-Escamilla, A. M. et al., 2004, Nat Biotechnol. 22, 1302-6; Cellmer, T. et al., 2007, Trends Biotechnol. 25, 254-61).
[0055] Protein aggregation propensity may also be analyzed based on their relative solubility in the presence of one or more kosmotropic agents, for example, ammonium sulfate (AS) or other kosmotropes such as phosphate (PO.sub.4.sup.3), or fluoride (F.sup.), or in the presence of volume excluding polymers such as polyethylene glycol (PEG). The mechanism of AS-induced protein precipitation or salting out, may involve the strong binding of water molecules by the polar kosmotropic sulfate anion, which dehydrates the protein surfaces, increases the chemical potential of the protein and causes the protein molecules to aggregate into an amorphous precipitate (Baldwin, R L., 1996, Biophys J. 71, 2056-63). Because the hydrophobic surfaces on the protein are preferentially dehydrated over the polar surfaces, AS-induced protein self-association may be driven by the interaction of exposed hydrophobic surfaces, similar to the forces that drive aggregation in the absence of AS (Young, L. et al., 1994, Protein Sci. 3, 717-29; Arunachalam, J. and Gautham, N., 2008, Proteins. 71, 2012-25; Fink, A. L., 1998, Fold Des. 3, R9-23). The theory of relative protein solubility determination using AS is reviewed by Trevino et al (2008, J Pharm Sci. 97, 4155-66), who also described its application in the relative solubility determination of a series of RNAsc variants (Trevino, S. R. et al., 2007, J Mol Biol. 366, 449-60). A manual bench scale method as well as a titration-based automated method around this concept are described herein and may be used to determine relative protein solubility.
Modified Fibronectin Type III (Fn3) Domains with Enhanced Solubility
[0056] Provided herein are polypeptides comprising a modified Fn3 domain, wherein the modified Fn3 domain comprises an amino acid modification that enhances the solubility of the polypeptide relative to a polypeptide (or Fn3 domain) that does not comprise the amino acid modification. The amino acid modification may be in a loop, or a -strand, e.g., -strand E, of the Fn3 domain. Provided herein are, e.g., polypeptides comprising a modified Fn3 domain, wherein the modified Fn3 domain comprises an amino acid sequence wherein the amino acid corresponding to residue selected 58 of SEQ ID NO: 1 is mutated, and wherein the solubility of the modified Fn3 domain is enhanced relative to the solubility of a Fn3 domain wherein the amino acid corresponding to residue 58 of SEQ ID NO: 1 is not mutated.
[0057] SEQ ID NO: 1 is the sequence of the wildtype human .sup.10Fn3 domain set forth in:
TABLE-US-00001 (SEQIDNO:1) VSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTV PGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEIDKPS Q
(the AB, CD and EF loops are underlined; the BC, DE, and FG loops are emphasized in bold; the -strands are located between each of the loop regions; and the N-terminal and C-terminal regions are shown in italics). In SEQ ID NO: 1, the AB loop refers to residues 14-17, the BC loop refers to residues 23-31, the CD loop refers to residues 37-47, the DE loop refers to residues 51-56, the EF loop refers to residues 63-67, and the FG loop refers to residues 75-87. The BC, DE and FG loops align along one face of the molecule, i.e. the north pole, and the AB, CD and EF loops align along the opposite face of the molecule, i.e. the south pole. In SEQ ID NO: 1, -strand A refers to residues 8-13, -strand B refers to residues 18-22, -strand C refers to residues 32-36, beta strand D refers to residues 48-50, -strand E refers to residues 57-62, -strand F refers to residues 68-74, and -strand G refers to residues 88-92. The -strands are connected to each other through the corresponding loop, e.g., strands A and B are connected via loop AB in the formation -strand A, loop AB, -strand B, etc. The N-terminal and/or C-terminal regions of SEQ ID NO: 1 (italicized above), may be removed or altered to generate a molecule retaining biological activity or to introduce target-binding activity.
[0058] Binders Having a North Pole and South Pole LOOP Modified
[0059] In some embodiments, the polypeptides comprising a solubility enhancing mutation, e.g., a T58 mutation, comprise a Fn3, e.g., .sup.10Fn3, domain having (i) a modification in the amino acid sequence of at least one north pole loop selected from the BC, DE and FG loops relative to the corresponding loop of the wildtype human Fn3 domain, e.g., .sup.10Fn3 domain (SEQ ID NO: 1 or 5), and (ii) a modification in the amino acid sequence of at least one south pole loop selected from the AB, CD and EF loops relative to the corresponding loop of the wildtype human Fn3 domain, e.g., .sup.10Fn3 domain (SEQ ID NO: 1 or 5). The modified north pole and south pole loops may contribute to binding to the same target. Various combinations of modified north pole and south pole loops are contemplated. For example, a Fn3, e.g., .sup.10Fn3, may comprise one modified north pole loop and one modified south pole, one modified north pole loop and two modified south pole loops, two modified north pole loops and one modified south pole loop, two modified north pole loops and two modified south pole loops, three modified north pole loops and one modified south pool loop, etc., wherein each of the modified loops contributes to binding to the same target. Exemplary combinations of north pole and south pole loops that may be modified include, for example, the CD loop (south pole) and the FG loop (north pole), the CD loop (south pole) and the DE loop (north pole), the EF loop (south pole) and FG loop (north pole), the AB loop (south pole) and the FG loop (north pole), or the DE loop (north pole) and the EF loop (south pole). Another exemplary loop combination is the CD loop (south pole), the DE loop (north pole) and the EF loop (south pole). Yet another exemplary loop combination is the DE loop (north pole) and one of more of the AB, CD and EF loops (south pole). The modified loops may have sequence modifications across an entire loop or only in a portion of the loop. Additionally, one or more of the modified loops may have insertions or deletions such that the length of the loop is varied relative to the length of the corresponding loop of the wildtype sequence. In certain embodiments, additional regions in the Fn3 domain (i.e., in addition to the north and south pole loops), such as -strand, N-terminal and/or C-terminal regions, may also be modified in sequence relative to the wildtype Fn3 domain, and such additional modifications may also contribute to binding to the target.
[0060] In certain embodiments, the fibronectin based scaffold moiety comprises a .sup.10Fn3 domain that is defined generally by following the sequence:
TABLE-US-00002 (SEQIDNO:17) VSDVPRDLEVVAA(X).sub.uLLISW(X).sub.vYRITY(X).sub.wFTV(X).sub.xATISGL (X).sub.yYTITVYA(X).sub.zISINYRT,
or by the sequence having SEQ ID NO: 18-29. In SEQ ID NOs: 17-29, the AB loop is represented by (X).sub.u, the BC loop is represented by (X).sub.v, the CD loop is represented by (X).sub.w, the DE loop is represented by (X).sub.x, the EF loop is represented by (X).sub.y and the FG loop is represented by X.sub.z. X represents, independently, any amino acid and the subscript following the X represents an integer of the number of amino acids. For example, u, v, w, x, y and z may each be an integer selected, independently, from 2-20, 2-15, 2-10, 2-8, 5-20, 5-15, 5-10, 5-8, 6-20, 6-15, 6-10, 6-8, 2-7, 5-7, and 6-7. The sequences of the beta strands (underlined) may have anywhere from 0 to 10, from 0 to 8, from 0 to 6, from 0 to 5, from 0 to 4, from 0 to 3, from 0 to 2, or from 0 to 1 substitutions, deletions or additions across all 7 scaffold regions relative to the corresponding amino acids shown in SEQ ID NOs: 17-29. In some embodiments, the sequences of the beta strands may have anywhere from 0 to 10, from 0 to 8, from 0 to 6, from 0 to 5, from 0 to 4, from 0 to 3, from 0 to 2, or from 0 to 1 substitutions, e.g., conservative substitutions, across all 7 scaffold regions relative to the corresponding amino acids shown in SEQ ID NO: 17-29. In certain embodiments, the hydrophobic core amino acid residues (bolded residues in SEQ ID NO: 17 above) are fixed, and any substitutions, conservative substitutions, deletions or additions occur at residues other than the hydrophobic core amino acid residues. In some embodiments, the hydrophobic core residues of the polypeptides provided herein have not been modified relative to the wildtype human .sup.10Fn3 domain (e.g., SEQ ID NO: 1).
[0061] In some embodiments, the amino acid sequence of the modified Fn3 domain may be at least 40%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identical to that of a wildtype Fn3 domain, for example, a human Fn3 domain of SEQ ID NO: 1-16, 65, or 66. In some embodiments, the amino acid sequence of the modified Fn3 domain may be at least 50% identical to that of a wildtype Fn3 domain. In some embodiments, the amino acid sequence of the modified Fn3 domain may be at least 65% identical to that of a wildtype Fn3 domain. In some embodiments, the amino acid sequence of the modified Fn3 domain may be at least 80% identical to that of a wildtype Fn3 domain. In some embodiments, the amino acid sequence of the modified Fn3 domain may be at least 90% identical to that of a wildtype Fn3 domain. In certain embodiments, one or more of the loops will not be modified relative to the sequence of the corresponding loop of the wildtype sequence and/or one or more of the -strands will not be modified relative to the sequence of the corresponding (1-strand of the wildtype sequence. In certain embodiments, each of the beta or beta-like strands of a .sup.10Fn3 domain in a Fn3 moiety may comprise, consist essentially of, or consist of an amino acid sequence that is at least 80%, 85%, 90%, 95% or 100% identical to the sequence of a corresponding beta or beta-like strand of SEQ ID NO: 1. In some embodiments, variations in the -strand regions may not disrupt the stability of the polypeptide in physiological conditions.
[0062] In some embodiments, the non-loop region of the Fn3, e.g., .sup.10Fn3, domain may be modified by one or more conservative substitutions. As many as 3%, 5%, 10%, 20% or even 30% or more of the amino acids in the Fn3, e.g., .sup.10Fn3, domain may be altered by a conservative substitution without substantially altering the affinity of the .sup.10Fn3 for a ligand. In certain embodiments, the non-loop regions, e.g., the -strands may comprise anywhere from 0-15, 0-10, 0-8, 0-6, 0-5, 0-4, 0-3, 1-15, 1-10, 1-8, 1-6, 1-5, 1-4, 1-3, 2-15, 2-10, 2-8, 2-6, 2-5, 2-4, 5-15, or 5-10 conservative amino acid substitutions. In exemplary embodiments, the scaffold modification may reduce the binding affinity of the Fn3, e.g., .sup.10Fn3, binder for a ligand by less than 100-fold, 50-fold, 25-fold, 10-fold, 5-fold, or 2-fold. It may be that such changes may alter the immunogenicity of the Fn3 in vivo, and where the immunogenicity is decreased, such changes may be desirable. As used herein, conservative substitutions are residues that are physically or functionally similar to the corresponding reference residues. That is, a conservative substitution and its reference residue have similar size, shape, electric charge, chemical properties including the ability to form covalent or hydrogen bonds, or the like. Exemplary conservative substitutions include those fulfilling the criteria defined for an accepted point mutation in Dayhoff et al., Atlas of Protein Sequence and Structure 5:345-352 (1978 & Supp.). Examples of conservative substitutions include substitutions within the following groups: (a) valine, glycine; (b) glycine, alanine; (c) valine, isoleucine, leucine; (d) aspartic acid, glutamic acid; (e) asparagine, glutamine; (f) serine, threonine; (g) lysine, arginine, methionine; and (h) phenylalanine, tyrosine.
[0063] In some embodiments, the amino acid sequence of the modified Fn3 domain may differ from a wildtypc Fn3, e.g., .sup.10Fn3, domain in at most 50, 45, 40, 35, 30, 25, 20, 15, 10 or 5 amino acids. In some embodiments, the amino acid sequence of the modified Fn3 domain may differ from a wildtype Fn3 domain in at most 30 amino acids. In some embodiments, the amino acid sequence of the modified Fn3 domain may differ from a wildtype Fn3 domain in at most 20 amino acids. In some embodiments, the amino acid sequence of the modified Fn3 domain may differ from a wildtype Fn3 domain in at most 10 amino acids.
[0064] In some embodiments, the modified Fn3 domain may comprise at least one amino acid variation selected from a substitution, deletion and addition in at least one loop as compared to a wildtype Fn3 domain, for example, a human .sup.10Fn3 domain of SEQ ID NO: 1-16, 65, or 66. In some embodiments, the modified Fn3 domain may comprise at least one amino acid variation in each of at least two loops as compared to a wildtype Fn3 domain. In some embodiments, the modified Fn3 domain may comprise at least one amino acid variation in each of at least three loops as compared to a wildtype Fn3 domain. In some embodiments, the modified Fn3 domain may comprise at least one amino acid variation in at least one loop selected from north pole loops (BC, DE and FG loops), as compared to a wildtype Fn3 domain. In some embodiments, the modified Fn3 domain may comprise at least one amino acid variation in at least one loop selected from south pole loops (AB, CD and EF loops), as compared to a wildtype Fn3 domain. In some embodiments, the modified Fn3 domain may comprise at least one amino acid variation selected from substitution, deletion and addition, in at least one non-loop region and at least one loop, as compared to a wildtype Fn3 domain. In some embodiments, the modified Fn3 domain may comprise at least one amino acid variation in a -strand as compared to a wildtype Fn3 domain. In some embodiments, the modified Fn3 domain may comprise at least one amino acid variation in each of at least two -strands as compared to a wildtype Fn3 domain. In some embodiments, the modified Fn3 domain may comprise at least one amino acid variation in each of at least three -strands as compared to a wildtype Fn3 domain.
[0065] In some embodiments, Fn3 domain comprises a loop, AB; a loop, BC; a loop, CD; a loop, DE; a loop, EF; and a loop, FG; and has at least one loop selected from loop AB, BC, CD, DE, EF and FG with an altered amino acid sequence relative to the sequence of the corresponding loop of the human .sup.10Fn3 domain of SEQ ID NO: 1-16. In some embodiments, the BC, DE and FG loops are altered. In certain embodiments, the AB, CD and EF loops are altered. In certain embodiments, the FG loop is the only loop that is altered. In other embodiments, the CD and FG loops are both altered, and optionally, no other loops are altered. In certain embodiments, the CD and EF loops are both altered, and optionally, no other loops are altered. In some embodiments, one or more specific scaffold alterations are combined with one or more loop alterations. By altered is meant one or more amino acid sequence alterations relative to a template sequence (i.e., the corresponding wildtype human fibronectin domain) and includes amino acid additions, deletions, and substitutions.
[0066] In some embodiments, the polypeptides may comprise a modified Fn3 domain wherein the non-loop regions comprise an amino acid sequence that is at least 80, 85, 90, 95, 98, or 100% identical to the non-loop regions of a wildtype Fn3 domain (e.g. a human Fn3 domain of SEQ ID NO: 1-16, 65, or 66), wherein at least one loop selected from AB, BC, CD, DE, EF and FG may be altered. For example, in certain embodiments, the AB loop may have up to 4 amino acid substitutions, up to 10 amino acid insertions, up to 3 amino acid deletions, or a combination thereof; the BC loop may have up to 10 amino acid substitutions, up to 4 amino acid deletions, up to 10 amino acid insertions, or a combination thereof; the CD loop may have up to 6 amino acid substitutions, up to 10 amino acid insertions, up to 4 amino acid deletions, or a combination thereof; the DE loop may have up to 6 amino acid substitutions, up to 4 amino acid deletions, up to 13 amino acid insertions, or a combination thereof; the EF loop may have up to 5 amino acid substitutions, up to 10 amino acid insertions, up to 3 amino acid deletions, or a combination thereof; and/or the FG loop may have up to 12 amino acid substitutions, up to 11 amino acid deletions, up to 25 amino acid insertions, or a combination thereof.
[0067] It should be understood that not every residue within a loop or non-loop region needs to be modified in order to achieve a Fn3 binding domain having strong affinity for a desired target. Additionally, insertions and deletions in the loop regions may also be made while still producing high affinity Fn3 binding domains. Accordingly, in some embodiments, one or more loops selected from AB, BC, CD, DE, EF and FG may be extended or shortened in length relative to the corresponding loop a wildtype Fn3. In any given polypeptide, one or more loops may be extended in length, one or more loops may be reduced in length, or combinations thereof. In some embodiments, the length of a given loop may be extended by 2-25, 2-20, 2-15, 2-10, 2-5, 5-25, 5-20, 5-15, 5-10, 10-25, 10-20, or 10-15 amino acids. In some embodiments, the length of a given loop may be reduced by 1-15, 1-12, 1-10, 1-5, 1-3, 1-2, 2-10, or 2-5 amino acids. In particular, the FG loop of .sup.10Fn3 is 13 residues long, whereas the corresponding loop in antibody heavy chains ranges from 4-28 residues. To optimize antigen binding in polypeptides relying on the FG for target binding, therefore, the length of the FG loop of Fn3 may be altered in length as well as in sequence to obtain the greatest possible flexibility and affinity in target binding.
[0068] In some embodiments, the amino acid sequences of the N-terminal and/or C-terminal regions of the modified Fn3 domain may be modified by deletion, substitution or insertion relative to the amino acid sequences of the corresponding regions of a wildtype Fn3 domain (e.g. a human Fn3 domain of SEQ ID NO: 1-16, 65, or 66). Additional sequences may also be added to the N- or C-terminus of the modified Fn3 domain. For example, in some embodiments, the N-terminal extension may comprise an amino acid sequence selected from the group consisting of: M, MG, and G. In some embodiments, the amino acid sequence of the C-terminal tail of the modified Fn3 domain may be modified or truncated relative to the amino acid sequence of the C-terminal tail of a wildtype Fn3 domain (e.g., a human Fn3 domain of SEQ ID NO:1-16, 65, or 66). In some embodiments, the amino acid sequence of the N-terminus of the modified Fn3 domain may be modified or truncated relative to the amino acid sequence of the N-terminus of a wildtype Fn3 domain.
[0069] In certain embodiments, the amino acid sequence of the first 1, 2, 3, 4, 5, 6, 7, 8 or 9 residues of the modified Fn3 domain may be modified or deleted in the polypeptides provided herein relative to the sequence of the corresponding amino acids in a wildtype Fn3 domain. In some embodiments, the amino acids corresponding to amino acids 1-8 of SEQ ID NO: 1 may be replaced with an alternative N-terminal region having from 1-20, 1-15, 1-10, 1-8, 1-5, 1-4, 1-3, 1-2, or 1 amino acids in length. Exemplary alternative N-terminal regions include M, MG, G, MGVSDVPRDL (SEQ ID NO: 30) and GVSDVPRDL (SEQ ID NO: 31), or N-terminal truncations of any one of SEQ ID NOs: 30 and 31. Other suitable alternative N-terminal regions include, for example, X.sub.nSDVPRDL (SEQ ID NO: 32), X.sub.nDVPRDL (SEQ ID NO: 33), X.sub.nVPRDL (SEQ ID NO: 34), X.sub.nPRDL (SEQ ID NO: 35), X.sub.nRDL (SEQ ID NO: 36), X.sub.nDL (SEQ ID NO: 37), or X.sub.nL, wherein n=0, 1 amino acids, wherein when n=1, X is Met or Gly, and when n=2, X is Met-Gly. When a Met-Gly sequence is added to the N-terminus of a .sup.10Fn3 domain, the M may be cleaved off, leaving a G at the N-terminus. In other embodiments, the alternative N-terminal region comprises the amino acid sequence MASTSG (SEQ ID NO: 38).
[0070] In certain embodiments, the amino acid sequence corresponding to amino acids 93-101, 94-101, 95-101, 96-101, 97-101, 98-101, 99-101, 100-101, or 101 of SEQ ID NO: 1 may be deleted or modified in the polypeptides provided herein relative to the sequence of the corresponding amino acids in the wildtypc human .sup.10Fn3 domain (SEQ ID NO: 1). In exemplary embodiments, the amino acids corresponding to amino acids 95-101 of SEQ ID NO: 1 may be replaced with an alternative C-terminal region having from 1-20, 1-15, 1-10, 1-8, 1-5, 1-4, 1-3, 1-2, or 1 amino acids in length. Specific examples of alternative C-terminal region sequences include, for example, polypeptides comprising, consisting essentially of, or consisting of, EIEK (SEQ ID NO: 39), EGSGC (SEQ ID NO: 40), EIEKPCQ (SEQ ID NO: 41), EIEKPSQ (SEQ ID NO: 42), EIEKP (SEQ ID NO: 43), EIEKPS (SEQ ID NO: 44), EIEKPC (SEQ ID NO: 45), or HHHHHH (SEQ ID NO: 46). In some embodiments, the alternative C-terminal region comprises EIDK (SEQ ID NO: 47), and in particular embodiments, the alternative C-terminal region is either EIDKPCQ (SEQ ID NO: 48) or EIDKPSQ (SEQ ID NO: 49).
[0071] In certain embodiments, the modified Fn3 domain may have both an alternative N-terminal region sequence and an alternative C-terminal region sequence.
[0072] In some embodiments, at least one residue of the integrin-binding motif arginine-glycine-aspartic acid (RGD) (e.g. amino acids 78-80 of SEQ ID NO:1) may be mutated or deleted so as to disrupt integrin binding. In some embodiments, the FG loop of the polypeptides provided herein does not contain an RGD integrin binding site. In one embodiment, the RGD sequence may be replaced by a polar amino acid-neutral amino acid-acidic amino acid sequence (in the N-terminal to C-terminal direction). In another embodiment, the RGD sequence may be replaced with SGE. In yet another embodiment, the RGD sequence is replaced with RGE (see, e.g., SEQ ID NO: 16). In some embodiments, the polypeptide binds specifically to a target that is not bound by a wildtypc Fn3 domain, particularly the wildtypc human Fn3 domain having, e.g., SEQ ID NO: 1-16, 65, or 66.
[0073] In some embodiments, the polypeptide may bind to a desired target with a K.sub.d of less than 500 nM, 400 nM, 300 nM, 200 nM, 100 nM, 50 nM, 20 nM, 10 nM, 5 nM, 1 nM, 500 pM, 100 pM or less. In some embodiments, the polypeptide binds to a desired target with a K.sub.d between 1 pM and 1 pM, between 100 pM and 500 nM, between 1 nM and 500 nM, or between 1 nM and 100 nM. In some embodiments, the polypeptide binds to a desired target with a K.sub.d of less than 500 nM. In some embodiments, the polypeptide binds to a desired target with a K.sub.d of less than 100 nM.
[0074] In some embodiments, a polypeptide may comprise an amino acid sequence that is at least 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identical to an amino acid sequence selected from the group of sequences consisting of SEQ ID NOs: 1-16, and the polypeptide binds specifically to a target, e.g., with a K.sub.d of less than 1000 nM, 500 nM, 100 nM, 50 nM, 10 nM, 5 nM, 1 nM, 500 pM, 100 pM or less. The polypeptide may comprise amino acid changes (or alterations) in one or more loops and one or more strands.
[0075] Binders Having Loop and Scaffold Region Modifications
[0076] Also provided herein are Fn3, e.g., .sup.10Fn3, domains having a solubility enhancing mutation, e.g., a T58 mutation, and having combinations of loop and scaffold modifications. In particular, the application provides polypeptides comprising a solubility enhancing mutation and a Fn3, e.g., .sup.10Fn3, domain comprising (i) a modification in the amino acid sequence of at least one of loops AB, BC, CD, DE, EF, or FG, and (ii) a modification in the amino acid sequence of at least one scaffold region (i.e., a modification in at least one -strand, the N-terminal region, and/or the C-terminal region), wherein the modified loop(s) and modified scaffold region(s) both contribute to binding the same target. In exemplary embodiments, the scaffold region modifications are located adjacent to modifications in a loop region, e.g., if the AB loop is modified, scaffold mutations may tend to be located in -strand A and/or -strand B, which are adjacent to the AB loop in the linear sequence of the .sup.10Fn3 domain. In other embodiments, a cluster of modifications may be found together in loop and scaffold regions that are adjacent to one another in the linear sequence of the Fn3 domain. For example, Fn3 binders having both loop and scaffold modifications, may have clusters of amino acid modifications in the following combinations of loop and scaffold regions that are adjacent to each other in the linear sequence of the Fn3 domain: -strand/loop/-strand, loop/-strand/loop, loop/-strand/loop/-strand, terminal region/-strand/loop, or loop/-strand/terminal region, etc. For example, Fn3 domains having novel combinations of loop and scaffold modifications may have clusters of modifications such that over a stretch of 20 contiguous amino acids at least 15 of the amino acids are modified relative to wildtype. In other embodiments, at least 17 out of 20, 18 out of 20, 17 out of 25, 20 out of 25, or 25 out of 30 residues in a contiguous stretch are modified relative to the wildtype Fn3 domain sequence over the corresponding stretch of amino acids. In certain embodiments, a given Fn3 domain may have two or three clusters of modifications separated by stretches of unmodified (i.e., wildtype) sequence. For any given region (i.e., a loop, -strand or terminal region) that is modified, all or only a portion of the region may be modified relative to the wildtype sequence. When a -strand region is modified, preferably the hydrophobic core residues remain unmodified (i.e., wildtype) and one or more of the non-core residues in the -strand are modified.
[0077] West-Side Binders
[0078] In some embodiments, the application provides Fn3, e.g., .sup.10Fn3, domains comprising a solubility enhancing mutation, e.g., a mutation at T58, and having a binding face along the west-side of the molecule (West-side binders or WS binders). WS binders as described herein comprise a Fn3, e.g., .sup.10Fn3, domain that has a modified CD loop and a modified FG loop, as compared to the corresponding CD and FG loop sequences set forth in SEQ ID NO: 1 or 5. The CD loop and the FG loop both contribute to binding to the same target. In certain embodiments, the WS binders may comprise additional modifications at one or more regions within the Fn3 domain. For example, WS binders may comprise scaffold modifications in one or more of the -strand regions adjacent to the CD and/or FG loops. In particular, WS binders may comprise sequence modifications in one or more of -strand C, -strand D, -strand F, and/or -strand G. Exemplary scaffold modifications include modifications at one or more scaffold region positions corresponding to the amino acid positions: 33, 35, 49, 69, 71, 73, 89 and/or 91 of SEQ ID NO: 1 or 5. The WS binders may also comprise modifications in the BC loop, particularly in the C-terminal portion of the BC loop. In one embodiment, the last two residues of the BC loop (i.e., corresponding to amino acids 30 and 31 in the wildtype .sup.10Fn3 domain) are modified relative to the wildtype sequence. All or a portion of the additional loop and scaffold modifications may contribute to binding to the target in conjunction with the modified CD and FG loops. Preferably, the hydrophobic core residues are not modified relative to the wildtype sequence.
[0079] In certain embodiments, a WS binder has a CD loop that is about 3-11, 4-9 or 5 residues long; an FG loop that is about 1-10, e.g., 6 or 5, residues long; a C strand that is about 6-14, 8-11, or 9 residues long; and/or an F strand that is about 9-11 or 10 residues long. Positions 31, 33, 35 and 37-39 of the beta strand C may be altered relative to the wildtype sequence. Positions 32, 34 and 36 of the beta strand C may be hydrophobic residues. Positions 67, 69, 71 and 73 of the beta strand F may be altered relative to the wildtype sequence. Positions 68, 70, and 72 of the beta strand F may be hydrophobic residues. A WS binder may comprise amino acid substitutions at positions 30, 31, 32, 33, 34, 35, 36, 37, 38 and/or 39, such as positions 31, 33, 35, 37, 38 and/or 39, e.g., positions 31 and/or 33, of SEQ ID NO: 1 or 5. A WS binder may comprise amino acid substitutions at positions 44, 45, 46, 47, 48, 49, 50 and/or 51, such as positions 44, 45, 47 and/or 49, of SEQ ID NO: 1 or 5. A WS binder may comprise amino acid substitutions at positions 40, 41, 42, 43, 44 and/or 45 of SEQ ID NO: 1 or 5. A WS binder may comprise amino acid substitutions at positions 67, 68, 69, 70, 71, 72, 73, 74, 75 and/or 76, such as positions 67, 69, 71, 73 and/or 76 or positions 71, 73, 75 and/or 76, of SEQ ID NO: 1 or 5. A WS binder may comprise amino acid substitutions at positions 76, 77, 78, 79, 81, 82, 83, 84, 85 and/or 86, such as positions 84 and/or 85 of SEQ ID NO: 1 or 5. A WS binder may comprise amino acid substitutions at positions 85, 86, 87, 88, 89, 90, 91, 92, 93 and/or 94 of SEQ ID NO: 1 or 5. A WS binder may comprise amino acid substitutions at positions 31, 33, 47, 49, 73 and/or 75 of SEQ ID NO: 1 or 5. A WS binder may comprise a loop C comprising from 4-9 varied, e.g., non wildtype amino acids; an FG loop comprising from 5-6 varied, e.g., non wildtype amino acids; and wherein amino acids 31, 33, 35, 37-39, 67, 69, 71, 73 and 76 are not wildtype. Not wildtype amino acids are amino acids that are not those found at the same position in the wildtype human .sup.10Fn3 molecule (having, e.g., SEQ ID NO: 1 or 5).
[0080] Exemplary WS binders include those having a wildtype or mutated amino acid at positions 30, 31, 33, 35, 37, 38, 46, 47, 49, 50, 67, 69, 71, 73, 75, 76, 84, 85, 86, 87, 89 or 91. For example, a WS binder design may comprise one or more amino acid modifications in amino acids 39-45 of the CD loop and one or more amino acid modification in amino acids 77-83 in loop FG (WS-LI1 design), and wherein a .sup.10Fn3 molecule having that design binds specifically to a target molecule (and optionally does not comprise an RGD sequence). A WS binder design may comprise the design of WS-LI1 and at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 17, 20 or 25 additional amino acid modifications in the loops or strands. For example, a WS binder design may comprise the design of WS-LI1 and at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 17, 20 or 25 additional amino acid modifications at amino acid positions such as at amino acid positions 37, 38, 46, 47, 75, 76, and 85-88. Other amino acid modifications that may be included are those at positions 30, 31, 33, 35, 49, 50, 67, 69, 71, 73, 89 and 91.
[0081] In certain embodiments, at least or at most 10, 20, 30, 40, 50, or 50 amino acids of a design sequence is not varied, e.g., is not varied by substitution. For example, one or more of the following amino acids are retained as the amino acid from the wildtype human .sup.10Fn3 molecule: amino acids at positions 1-29, 32, 34, 36, 48, 51-66, 68, 70, 72, 88, 90 and 92-101.
[0082] Front Binders
[0083] In some embodiments, the polypeptides provided herein comprise a Fn3, e.g., .sup.10Fn3, domain comprising a solubility enhancing mutation, e.g., a T58 mutation, and having modifications in the CD, DE and, in some cases, EF loops, wherein the loop modifications all contribute to target binding. These polypeptides are referred to as front binders. The front binders may additionally comprise modifications in one or more scaffold regions, particularly in scaffold regions that flank or are adjacent to a modified loop region. For example, the front binders may comprise a scaffold modification in one or more of -strand C, -strand D, and/or -strand E relative to the sequences of the corresponding -strands of the wildtype Fn3 domain, e.g., human .sup.10Fn3 domain (SEQ ID NO: 1 or 5). Preferably the hydrophobic core residues are not modified relative to the wildtype sequence. Exemplary scaffold modifications that may be present in front binders, include modifications at one or more positions corresponding to amino acid positions 36, 49, 58 and/or 50 of SEQ ID NO: 1 or 5. Such scaffold modifications may contribute to binding to the target together with the modified loops. In certain embodiments, the front binders may comprise clusters of modifications spanning several loop and strand regions of the Fn3, e.g., .sup.10Fn3, domain. In particular, the front binders may comprise modifications in at least 15, 20, 24, 25, or 27 of the 31 residues between the amino acids corresponding to residues 36 through 66 of the wildtype Fn3, e.g., human .sup.10Fn3, domain (SEQ ID NO: 1 or 5). The loop and/or strand modifications may include amino acid substitutions, deletions and/or insertions, or combinations thereof. In exemplary embodiments, the CD loop is extended in length or reduced in length relative to the CD loop of the Fn3, e.g., wildtype human .sup.10Fn3, domain (SEQ ID NO: 1 or 5).
[0084] Back Binders
[0085] In some embodiments, the polypeptides provided herein comprise a Fn3, e.g., .sup.10Fn3, domain comprising a solubility enhancing mutation, e.g., a T58 mutation, and having modifications in the EF and FG loops, wherein the loop modifications contribute to binding the same target. These polypeptides are referred to as back binders herein. The back binders may comprise additional modifications in other loop and/or scaffold regions. For example, a back binder may contain modifications in at least a portion of the AB loop, preferably the N-terminal portion of the AB loop. In an exemplary embodiment, the first two amino acids of the AB loop (i.e., corresponding to amino acid residues 14 and 15 of the wildtype .sup.10Fn3 domain) are modified relative to the wildtype sequence. In certain embodiments, a back binder may also contain one or more scaffold modifications, particularly modifications in one or more scaffold regions that are adjacent to a modified loop region. For example, back binders may contain one or more modifications in one or more of -strand A, -strand G, the N-terminal region, and/or the C-terminal region. Preferably the hydrophobic core residues are not modified relative to the wildtype sequence. Exemplary scaffold modifications include modifications at one or more positions corresponding to amino acid positions 1-7, 9-13, 89, 91, 93 and/or 94 of SEQ ID NO: 1 or 5. One or more of the additional loop and/or scaffold modifications may contribute to binding to the target along with the modified EF and FG loops.
[0086] Suitable loop and/or scaffold region modifications include amino acid substitutions, deletions and/or insertions, or combinations thereof. In certain embodiments, the amino acid sequence of the FG loop is extended in length or reduced in length relative to the FG loop of the wildtype human .sup.10Fn3 domain (SEQ ID NO: 1 or 5).
[0087] In certain embodiments, a back binder may comprise a cluster of modified amino acid residues over a contiguous span of several regions in the .sup.10Fn3 domain. For example, at least 14 of the first 15 amino acid residues of the Fn3, e.g., .sup.10Fn3, domain may be modified relative to the corresponding residues in the wildtype Fn3, e.g., human .sup.10Fn3, domain (SEQ ID NO: 1 or 5), and/or at least 15 of the 18 residues between the amino acids corresponding to residues 80 through 97 (or 94) of the wildtype Fn3, e.g., human .sup.10Fn3, domain (SEQ ID NO: 1 or 5) may be modified relative to the corresponding residues in the wildtype sequence.
[0088] South Pole Binders
[0089] In certain embodiments, the application provides polypeptides comprising a Fn3, e.g., .sup.10Fn3, domain, wherein the .sup.10Fn3 domain comprises a solubility enhancing mutation, e.g., a T58 mutation, and modifications in the amino acid sequences of -strand A, loop AB, -strand B, loop CD, -strand E, loop EF, and -strand F, relative to the sequences of the corresponding regions of the wildtype sequence. These polypeptides are referred to as south pole binders or SP binders herein. The modified loops and strands contribute to binding to the same target. The amino acid sequence of the CD loop may be extended in length or reduced in length relative to the CD loop of the wildtype Fn3, e.g., human .sup.10Fn3, domain (SEQ ID NO: 1 or 5). The south pole binders may comprise additional modifications in -strand G and/or the C-terminal region relative to the sequence of the corresponding region of the wildtype sequence. In exemplary embodiments, the south pole binders may comprise one or more modifications at amino acids corresponding to positions 11, 12, 19, 60, 61, 69, 91, 93 and 95-97 of the wildtype sequence.
[0090] Northwest Binders
[0091] In some embodiments, the application provides polypeptides comprising a Fn3, e.g., .sup.10Fn3, domain comprising a solubility enhancing mutation, e.g., a T58 mutation, and comprising modified BC, DE and FG loops, as compared to the corresponding BC, DE and FG loop sequences set forth in SEQ ID NO: 1 or 5, as well as additional modifications in one or more of -strand C, -strand D, -strand F and -strand G strand residues. The -strand and loop region modifications together contribute to binding to the target. These proteins are referred to as Northwest binders, or NW binders, herein. In exemplary embodiments, the NW binders comprise one or more scaffold modifications at any one of, or combination of, amino acid positions corresponding to scaffold region positions R33, T49, Y73 and S89 of SEQ ID NO: 1 or 5. Suitable modifications in loop and scaffold regions include amino acid substitutions, deletions and/or insertions, or combinations thereof. In certain embodiments, one or more of the BC, DE and FG loops are extended in length or reduced in length, or combinations thereof, relative to the wildtype sequence. In one embodiment, each of the BC, DE and FG loops are extended in length or reduced in length, or combinations thereof, relative to the wildtype sequence (e.g., SEQ ID NO: 1 or 5). In certain embodiments, only a portion of the BC loop is modified, particularly the C-terminal portion, relative to the wildtype sequence. For example, the BC loop may be modified only at amino acid residues corresponding to amino acids 27-31 of the wildtype BC loop, whereas the rest of the BC loop (i.e., corresponding to residues 23-26 of the wildtype loop) are left unmodified.
[0092] Northeast Binders
[0093] In some embodiments, the application provides polypeptides comprising a Fn3, e.g., .sup.10Fn3, domain comprising a solubility enhancing mutation, e.g., a T58 mutation, and comprising a modified BC, DE and FG loop as well as one or more additional modifications in any one of, or combination of, the N-terminal region, -strand A, -strand B and/or -strand E. These proteins are referred to as Northeast binders, or NE binders, herein. In exemplary embodiments, the NE binders are modified at any one of, or combination of, amino acids corresponding to scaffold region positions 1-7, E9, LI 9, S21 and/or T58 of the wildtype sequence (SEQ ID NO: 1 or 5). The combination of modified loop and scaffold regions contributes to binding to the target.
[0094] South Front Binders
[0095] In some embodiments, the application provides polypeptides comprising a Fn3, e.g., .sup.10Fn3, domain comprising a solubility enhancing mutation, e.g., a T58 mutation, and comprising modifications in one or more of the AB, CD, DE and EF loops, as well as additional modifications in one or more of -strand B, -strand D and/or -strand E. These proteins are referred to as South Front binders herein. The combination of modified loop and strand residues contributes to binding to the target. In exemplary embodiments, a South Front binder may be modified at one or more amino acid positions corresponding to scaffold region positions L19, T49, T58, S60, and/or G61 of SEQ ID NO: 1 or 5 and/or at one or more amino acid positions corresponding to loop region positions T14-S17, P51, T56, G40-E47, and/or K63-G65 of SEQ ID NO: 1 or 5. In exemplary embodiments, a South Front binder may be extended in length or reduced in length in the AB loop, between amino acids corresponding to residues 18 and 20 of the wildtype sequence, and/or in the CD loop.
[0096] AG Binders
[0097] In some embodiments, the application provides polypeptides comprising a Fn3, e.g., .sup.10Fn3, domain comprising a solubility enhancing mutation, e.g., a T58 mutation, and comprising a modified -strand A and -strand G, as compared to the corresponding strand of SEQ ID NO: 1 or 5. These proteins are referred to as AG Binders or AG Strand binders herein. In certain embodiments, the AG strand binders comprise clusters of modifications at the N-terminal and C-terminal portions of the Fn3, e.g., .sup.10Fn3, domain, whereas the middle portion of the Fn3 remains unmodified. For example, an AG strand binder may comprise modifications at 16 out of 19 of the first 19 amino acids in the .sup.10Fn3 domain (i.e., corresponding to amino acid positions 1-19 of SEQ ID NO: 1 or 5) and modifications at 13-17 out of 18 of the last 18 amino acids in the .sup.10Fn3 domain (i.e., corresponding to amino acid positions 84-101 of SEQ ID NO: 1) or at 14-18 out of 22 of the last 22 amino acids in the .sup.10Fn3 domain (i.e., corresponding to amino acid positions 80-101 of SEQ ID NO: 1). In exemplary embodiments, an AG binder may comprise modifications at one or more positions corresponding to positions 1-7, 9, 11-17, 19, 84-89 and 91-97 of SEQ ID NO: 1. Preferably the modified regions in an AG binder contribute to binding to the same target.
[0098] Southwest Binders
[0099] In some embodiments, the application provides polypeptides comprising a Fn3, e.g., .sup.10Fn3, domain comprising a solubility enhancing mutation, e.g., a T58 mutation, and comprising a modified CD and EF loop, as well as additional modifications in any one of, or combination of residues corresponding to positions 69 or 91-97 of SEQ ID NO: 1. These proteins are referred to as Southwest binders, or SW binders, herein. The modified loop and scaffold regions contribute to binding to the target.
[0100] Proteins Having Reduced Immunogenicity
[0101] In certain embodiments, the application provides polypeptides having reduced immunogenicity comprising a .sup.10Fn3 domains wherein a portion of the BC loop is left as wildtype. Preferably such polypeptides have lower immunogenicity relative to an equivalent polypeptide with modifications in a greater portion of the BC loop. In exemplary embodiments, the N-terminal portion of the BC loop is left as wildtype. For example, the first 1, 2, 3, 4, 5, or 5 residues of the BC loop may be left as wildtype, while the remaining C-terminal residues of the BC loop can be modified. In Fn3 designs having at least a portion of the N-terminal region of the BC loop as wildtype, it may be desirable to leave all or a portion of -strand B and/or -strand C unmodified relative to the wildtype sequence as well, particularly the portions of -strand B and/or -strand C that are adjacent to the BC loop (i.e., the C-terminal portion of -strand B and/or the N-terminal portion of -strand C). In exemplary embodiments, Fn3 domains having the wildtype sequence in an N-terminal portion of the BC loop and reduced immunogenicity may not have any modifications in the N-terminal region, -strand A, AB loop, and -strand B. In Fn3 designs with a portion of the BC loop as wildtype, the modified portion of the BC loop may contribute to target binding along with modifications in other regions of the .sup.10Fn3 domain.
[0102] In certain embodiments, the application provides polypeptides having reduced immunogenicity comprising Fn3 domains, wherein the strong HLA anchor in the region of -strand B/BC loop/-strand C (the BC anchor) has been removed or destroyed (e.g., modified relative to the wildtype sequence in a manner that reduces binding affinity to one or more HLA receptors). For example, the BC anchor may be removed or destroyed by modifying the Fn3, e.g., .sup.10Fn3, domain at one or more positions corresponding to positions L19, S21, R33 and/or T35 of SEQ ID NO:1 or 5. When the BC anchor has been removed or destroyed, it is possible to modify the sequence of the BC loop without significantly increasing the immunogenic potential of the BC region. Accordingly, many such Fn3 designs have modifications in the BC loop in addition to the modifications in P strand B and/or -strand C. The BC loop may contribute to target binding, optionally in combination with modifications in other regions of the Fn3 domain. The modifications in -strand B and/or -strand C may or may not contribute to target binding.
[0103] Fn3 Solubility Enhancing Mutations
[0104] In some embodiments, a modified Fn3 domain comprises an amino acid sequence that is based on a sequence selected from SEQ ID NOs: 1-29 and 65-66, wherein the Fn3 domain comprises a solubility enhancing mutation. A solubility enhancing mutation may be in a loop or a non-loop region. For example, a solubility enhancing mutation may be at a location corresponding to at least one of residues 24, 27, 54, 58, 78, 80 and 83 of SEQ ID NO: 1. In some embodiments, a solubility enhancing mutation is located in a non-loop region, such as a -strand. For example, a solubility enhancing mutation may be located in -strand E, such as at Threonine (T) 58.
[0105] In some embodiments, a solubility enhancing mutation, e.g., a mutation at residue 58, in a Fn3 domain that binds specifically to a target, does not contribute to the binding of the Fn3 domain to the target. In some embodiments, the amino acid that is mutated to enhance the solubility, e.g., T58, does not contribute to the binding of the Fn3 domain to its target. In some embodiments, the amino acid that is mutated to enhance the solubility, e.g., T58, is not in contact with the target.
[0106] In some embodiments, a solubility enhancing mutation, e.g., a mutation at residue 58, in a Fn3 domain that binds specifically to a target, contributes to the binding of the Fn3 domain to the target. In some embodiments, the amino acid that is mutated to enhance the solubility, e.g., T58, contributes to the binding of the Fn3 domain to its target. In some embodiments, the amino acid that is mutated to enhance the solubility, e.g., T58, is in contact with the target.
[0107] In some embodiments, the solubility of the modified Fn3 domain may be enhanced relative to the solubility of a Fn3 domain comprising an amino acid sequence wherein the amino acid corresponding to residue 58 of SEQ ID NO: 1 is not mutated. In some embodiments, the solubility of the modified Fn3 domain may be enhanced relative to the solubility of a Fn3 domain comprising the same amino acid sequence except that the amino acid corresponding to residue 58 of SEQ ID NO: 1 is not mutated.
[0108] In some embodiments, the modified Fn3 domain may comprise an amino acid sequence that is based on a sequence selected from SEQ ID NOs: 1-29 and 65-66, wherein the amino acid corresponding to residue 58 of SEQ ID NO: 1 is mutated and wherein the solubility of the modified Fn3 domain is enhanced relative to the solubility of a Fn3 domain wherein the amino acid corresponding to residue 58 of SEQ ID NO: 1 is not mutated.
[0109] In some embodiments, the modified Fn3 domain may comprise an amino acid sequence that is 75%, 80%, 85%, 90%, 95%, or 98% identical to an amino acid sequence selected from SEQ ID NOs: 1-29 and 65-71.
[0110] In some embodiments, the modified Fn3 domain may comprise an amino acid sequence selected from SEQ ID NOs: 17-29, wherein the amino acid corresponding to residue 58 of SEQ ID NO: 1 is mutated and wherein the solubility of the modified Fn3 domain is enhanced relative to the solubility of a Fn3 domain wherein the amino acid corresponding to residue 58 of SEQ ID NO: 1 is not mutated. In some embodiments, the modified Fn3 domain may comprise an amino acid sequence selected from SEQ ID NOs: 17-29, wherein the amino acid corresponding to residue 58 of SEQ ID NO: 1 is mutated to Glu (E) or Asp (D). and wherein the solubility of the modified Fn3 domain is enhanced relative to the solubility of a Fn3 domain wherein the amino acid corresponding to residue 58 of SEQ ID NO: 1 is not mutated.
[0111] In some embodiments, the modified Fn3 domain may comprise an amino acid sequence selected from SEQ ID NOs:67-68, wherein the amino acid corresponding to residue 58 of SEQ ID NO: 1 is mutated and wherein the solubility of the modified Fn3 domain is enhanced relative to the solubility of a Fn3 domain wherein the amino acid corresponding to residue 58 of SEQ ID NO: 1 Ls not mutated. In some embodiments, the modified Fn3 domain may comprise an amino acid sequence selected from SEQ ID NOs:69-71.
[0112] In some embodiments, the modified Fn3 domain described herein may be based on a .sup.10Fn3 domain (e.g. any one of human .sup.10Fn3 domains of SEQ ID NO: 1-16, or any one of human .sup.10Fn3 domains of SEQ ID NO: 17-29), a .sup.7Fn3 domain (e.g. human .sup.7Fn3 domain of SEQ ID NO:65), or a .sup.14Fn3 domain (e.g. human .sup.14Fn3 domain SEQ ID NO:66), wherein the amino acid corresponding to residue 58 of SEQ ID NO: 1 may be mutated. In some embodiments, the modified Fn3 domain may be a modified .sup.10Fn3 domain wherein the amino acid corresponding to residue 58 of SEQ ID NO: 1 may be mutated.
[0113] In some embodiments, the amino acid corresponding to residue 58 of SEQ ID NO: 1 may be mutated to any amino acid except Thr (T). In some embodiments, the amino acid corresponding to residue 58 of SEQ ID NO: 1 may be mutated to a hydrophilic amino acid. In some embodiments, the amino acid corresponding to residue 58 of SEQ ID NO: 1 may be mutated to an amino acid selected from Gin (Q), Glu (E), and Asp (D). In some embodiments, the amino acid corresponding to residue 58 of SEQ ID NO: 1 may be mutated to an amino acid selected from Glu (E) and Asp (D). In some embodiments, the amino acid corresponding to residue 58 of SEQ ID NO: 1 may be mutated to Glu (E) in a .sup.10Fn3 domain. In some embodiments, the amino acid corresponding to residue 58 of SEQ ID NO: 1 may be mutated to Asp (D) in a .sup.10Fn3 domain.
[0114] In some embodiments, in the modified Fn3 domain, the amino acid corresponding to residue 58 of SEQ ID NO: 1 is not mutated to Ala (A). In some embodiments, the amino acid corresponding to residue 58 of SEQ ID NO: 1 is not mutated to Ile (I). In some embodiments, the amino acid corresponding to residue 58 of SEQ ID NO: 1 is not mutated to Arg (R), His (H), or Lys (K). In some embodiments, the amino acid corresponding to residue 58 of SEQ ID NO: 1 is not mutated to Ser (S) or Asn (N). In some embodiments, the amino acid corresponding to residue 58 of SEQ ID NO: 1 is not mutated to Cys (C), Gly (G), or Pro (P). In some embodiments, the amino acid corresponding to residue 58 of SEQ ID NO: 1 is not mutated to Val (V), Leu (L), Met (M), Phe (F), Tyr (Y), or Trp (W).
[0115] In some embodiments, if the amino acid corresponding to residue 58 of SEQ ID NO: 1 is mutated to Ile (I), at least one of the amino acids corresponding to residues 23-29, 52-54 and 56 of SEQ ID NO:1 is the same as the corresponding residue of SEQ ID NO: 1.
[0116] In some embodiments, if the amino acid corresponding to residue 58 of SEQ ID NO: 1 is mutated to Ala (A), at least one of the amino acids corresponding to residues 23, 24, 26, 29, 52-54, and 56 of SEQ ID NO:1 is the same as the corresponding residue of SEQ ID NO: 1.
[0117] In some embodiments, if the amino acid corresponding to residue 58 of SEQ ID NO: 1 is mutated to Ala (A), three or more residues of the BC loop are the same as the corresponding residues in the BC loop of SEQ ID NO: 1, or two or more residues of the DE loop are the same as the corresponding residues in the DE loop of SEQ ID NO: 1.
[0118] In some embodiments, if the amino acid corresponding to residue 58 of SEQ ID NO: 1 is mutated to Ala (A) or Ile (I), the first two residues of the BC loop are the same as the corresponding residues in the BC loop of SEQ ID NO: 1.
[0119] In some embodiments, if the amino acid corresponding to residue 58 of SEQ ID NO: 1 is mutated to Ala (A) or Ile (I), the first three residues of the BC loop are the same as the corresponding residues in the BC loop of SEQ ID NO: 1.
[0120] In some embodiments, if the amino acid corresponding to residue 58 of SEQ ID NO: 1 is mutated to Ala (A) or Ile (I), the first four residues of the BC loop are the same as the corresponding residues in the BC loop of SEQ ID NO: 1.
[0121] In some embodiments, if the amino acid corresponding to residue 58 of SEQ ID NO: 1 is mutated to Ala (A) or Ile (I), the first five residues of the BC loop are the same as the corresponding residues in the BC loop of SEQ ID NO: 1.
[0122] In some embodiments, if the amino acid corresponding to residue 58 of SEQ ID NO: 1 is mutated to Ala (A) or Ile (I), the BC loop has the amino acid sequence of the corresponding loop of SEQ ID NO: 1.
[0123] In some embodiments, a Fn3 domain comprises a solubility enhancing mutation at residue 58, and comprises an amino acid at position 19, 21 and/or 50 that corresponds to the wildtype residue at that position, e.g., Leu for residue 19, Ser for residue 21 and Ser for residue 60. In some embodiments, a Fn3 domain comprises a solubility enhancing mutation at residue 58, and an amino acid sequence wherein 1, 2, 3 or 4 of amino acids at positions 63-66 correspond to the wildtype residue at that position (e.g. K for residue 63, P for residue 64, G for residue 65, V for residue 66). In certain embodiments, a Fn3 domain may comprise a solubility enhancing mutation at residue 58, and an amino acid sequence wherein at least 1, 2, 3, 4, or 5 of the residues of loops AB, CD, DE EF or of the N-terminal 7 amino acids correspond to the wildtype residue at that position.
[0124] In certain embodiments, a Fn3 domain protein comprising a solubility enhancing mutation does not comprise an amino acid modification in loop AB relative to the amino acid sequence of the wildtype Fn3 domain. In certain embodiments, a Fn3 domain protein comprising a solubility enhancing mutation does not comprise an amino acid modification in loop BC relative to the amino acid sequence of the wildtype Fn3 domain. In certain embodiments, a Fn3 domain protein comprising a solubility enhancing mutation does not comprise an amino acid modification in loop CD relative to the amino acid sequence of the wildtype Fn3 domain. In certain embodiments, a Fn3 domain protein comprising a solubility enhancing mutation does not comprise an amino acid modification in loop DE relative to the amino acid sequence of the wildtype Fn3 domain. In certain embodiments, a Fn3 domain protein comprising a solubility enhancing mutation docs not comprise an amino acid modification in loop EF relative to the amino acid sequence of the wildtype Fn3 domain. In certain embodiments, a Fn3 domain protein comprising a solubility enhancing mutation does not comprise an amino acid modification in loop FG relative to the amino acid sequence of the wildtype Fn3 domain. In certain embodiments, a Fn3 domain protein comprising a solubility enhancing mutation does not comprise an amino acid modification in a non-loop region, e.g., a -strand relative to the amino acid sequence of the wildtype Fn3 domain. In certain embodiments, a Fn3 domain protein comprising a solubility enhancing mutation does not comprise an amino acid modification in the N-terminal or C-terminal domains relative to the amino acid sequence of the wildtype Fn3 domain. In certain embodiments, a Fn3 domain protein comprising a solubility enhancing mutation docs not comprise an amino acid modification in -strand A relative to the amino acid sequence of the wildtype Fn3 domain. In certain embodiments, a Fn3 domain protein comprising a solubility enhancing mutation does not comprise an amino acid modification in -strand B relative to the amino acid sequence of the wildtype Fn3 domain. In certain embodiments, a Fn3 domain protein comprising a solubility enhancing mutation does not comprise an amino acid modification in -strand C relative to the amino acid sequence of the wildtype Fn3 domain. In certain embodiments, a Fn3 domain protein comprising a solubility enhancing mutation does not comprise an amino acid modification in -strand D relative to the amino acid sequence of the wildtype Fn3 domain. In certain embodiments, a Fn3 domain protein comprising a solubility enhancing mutation does not comprise an amino acid modification in -strand E relative to the amino acid sequence of the wildtype Fn3 domain. In certain embodiments, a Fn3 domain protein comprising a solubility enhancing mutation does not comprise an amino acid modification in -strand F relative to the amino acid sequence of the wildtype Fn3 domain. In certain embodiments, a Fn3 domain protein comprising a solubility enhancing mutation does not comprise an amino acid modification in -strand G relative to the amino acid sequence of the wildtype Fn3 domain. In certain embodiments, a Fn3 domain protein comprising a solubility enhancing mutation does not comprise an amino acid modification in either of two loops, two strands, two loops and one strand, two loops and two strands, or one loop and two strands relative to the amino acid sequence of the wildtype Fn3 domain.
[0125] In certain embodiments, the BC loop of an Fn3 domain protein comprising a solubility enhancing mutation has the amino acid sequence of the corresponding loop of the wildtype human Fn3 domain, e.g., .sup.10Fn3 domain (SEQ ID NO: 1). In certain embodiments, the first 2 residues of the BC loop of an Fn3 domain protein comprising a solubility enhancing mutation are the same as the corresponding residues in the BC loop of the wildtype human Fn3 domain, e.g., .sup.10Fn3 domain (SEQ ID NO: 1). In certain embodiments, the first 3 residues of the BC loop of an Fn3 domain protein comprising a solubility enhancing mutation are the same as the corresponding residues in the BC loop of the wildtype human Fn3 domain, e.g., .sup.10Fn3 domain (SEQ ID NO: 1). In certain embodiments, the first 4 residues of the BC loop of an Fn3 domain protein comprising a solubility enhancing mutation are the same as the corresponding residues in the BC loop of the wildtype human Fn3 domain, e.g., .sup.10Fn3 domain (SEQ ID NO: 1). In certain embodiments, the first 5 residues of the BC loop of an Fn3 domain protein comprising a solubility enhancing mutation are the same as the corresponding residues in the BC loop of the wildtype human Fn3 domain, e.g., .sup.10Fn3 domain (SEQ ID NO: 1).
[0126] Amino acid changes in loop and/or non-loop regions of a Fn3 domain that are made to enhance the solubility of a Fn3 domain preferably do not significantly affect the biological activity of the Fn3 domain. For example, a solubility enhancing mutation preferably does not significantly reduce the affinity of binding (e.g., K.sub.d) of the Fn3 domain to its desired target. In some embodiments, a solubility enhancing mutation, e.g., a T58 mutation, may reduce the affinity of binding (K.sub.d) of an Fn3 domain by less than 1%, 3%, 5%, 10%, 20%, 30%, 50%, 70%, or 90%. In some embodiments, a solubility enhancing mutation may not significantly reduce the stability (e.g., Tm) of a Fn3 domain or protein comprising a Fn3 domain. In some embodiments, a solubility enhancing mutation, e.g., a T58 mutations, may reduce the stability (e.g., Tm) of a Fn3 domain or protein comprising a Fn3 domain by less than 1%, 3%, 5%, 10%, 20%, 30%, 50%, 70%, or 90%, or regarding Tm, by less than 0.1 C., 0.3 C., 0.5 C., 0.7 C., 1 C., 2 C., 3 C., 4 C., 5 C., 6 C., 7 C., 8 C., 9 C., 10 C., 11 C., 12 C., or 13 C. In some embodiments, a solubility enhancing mutation does not significantly reduce either the stability or binding affinity of an Fn3 protein.
[0127] In some embodiments, in a Fn3 domain, the amino acid corresponding to residue 58 of SEQ ID NO: 1 may be mutated to a hydrophilic amino acid, wherein the solubility of the modified Fn3 domain may be enhanced relative to the solubility of the Fn3 domain wherein the amino acid corresponding to residue 58 of SEQ ID NO: 1 is not mutated, and wherein the mutation may reduce the stability (e.g., Tm) of the Fn3 domain by less than 1%, 3%, 5%, 10%, 20%, 30%, or 50%, or regarding Tm, by less than 1 C., 2 C., 3 C., 4 C., 5 C., 6 C., 7 C., 8 C., 9 C., 10 C., 11 C., 12 C., or 13 C. In some embodiments, in a Fn3 domain, the amino acid corresponding to residue 58 of SEQ ID NO: 1 may be mutated to an amino acid selected from Gin (Q), Glu (E), and Asp (D), wherein the solubility of the modified Fn3 domain may be enhanced relative to the solubility of the Fn3 domain wherein the amino acid corresponding to residue 58 of SEQ ID NO: 1 is not mutated, and wherein the mutation may reduce the stability (e.g., Tm) of the Fn3 domain by less than 1%, 3%, 5%, 10%, 20%, 30%, or 50%, or regarding Tm, by less than 1 C., 2 C., 3 C., 4 C., 5 C., 6 C., 7 C., 8 C., 9 C., 10 C., 11 C., 12 C., or 13 C. In some embodiments, in a Fn3 domain, the amino acid corresponding to residue 58 of SEQ ID NO: 1 may be mutated to Glu (E), wherein the solubility of the modified Fn3 domain may be enhanced relative to the solubility of the Fn3 domain wherein the amino acid corresponding to residue 58 of SEQ ID NO: 1 is not mutated, and wherein the mutation may reduce the stability (e.g., Tm) of the Fn3 domain by less than 5% 10% or 15%, or regarding Tm, by less than 1 C., 2 C., 3 C., 4 C., 5 C. or 10 C. In some embodiments, in a Fn3 domain, the amino acid corresponding to residue 58 of SEQ ID NO: 1 may be mutated to Asp (D), wherein the solubility of the modified Fn3 domain may be enhanced relative to the solubility of the Fn3 domain wherein the amino acid corresponding to residue 58 of SEQ ID NO: 1 is not mutated, and wherein the mutation may reduce the stability (e.g., Tm) of the Fn3 domain by less than 15% or 20%, or regarding Tm, by less than 5 C., 10 C. or 15 C.
[0128] In certain embodiments, the mutations described herein enhance the solubility of a protein that is a multivalent protein that comprises two or more Fn3 domains, e.g., .sup.10Fn3 domains. For example, a multivalent protein may comprise 2, 3 or more Fn3 domains, e.g., .sup.10Fn3 domains, that are covalently associated. In exemplary embodiments, the protein may be a bispecific or dimeric protein comprising two .sup.10Fn3 domains. A solubility enhancing mutation, e.g., a mutation at T58, may be present in one or more of the Fn3 domains of a multimeric Fn3 protein. In certain embodiments, each Fn3 domain of a multimeric Fn3 protein may comprise a solubility enhancing mutation, e.g., a mutation at T58.
[0129] In some embodiments, the polypeptide described herein further comprise at least one pharmacokinetic (PK) moieties selected from: a polyoxyalkylene moiety, a human serum albumin binding protein, sialic acid, human serum albumin, transferrin, IgG, an IgG binding protein, and an Fc (or fragment thereof). In some embodiments, the PK moiety is the polyoxyalkylene moiety. In some embodiments, the polyoxyalkylene moiety is polyethylene glycol (PEG). In some embodiments, the PEG moiety is covalently linked to the polypeptide via a Cys or Lys amino acid. In some embodiments, the PEG is between about 0.5 kDa and about 100 kDa. In some embodiments, the PK moiety is an Fc fragment.
[0130] As described herein, the modified Fn3 domains may be used to bind to any target of interest for treatment of diseases or disorders. The diseases or disorders that may be treated will be dictated by the binding specificity of the Fn3 domains. In some embodiments, the polypeptide may specifically bind to a target that is not bound by a wildtype Fn3 domain (e.g., a human Fn3 domain of SEQ ID NO: 1-16, 65, or 66). Exemplary targets include, for example, TNF-alpha, VEGFR2, PCSK9, TL-23, EGFR, IGF1R, DLL4, IL-17 and PXR. Merely as an example, modified Fn3 domains that bind to TNF-alpha may be used to treat autoimmune disorders such as rheumatoid arthritis, inflammatory bowel disease, psoriasis, and asthma. Modified Fn3 domains that bind to IL-17 may be used to treat asthma; and modified Fn3 domains that bind to DLL4 or EGFR may be used to treat hyperproliferative disorders or diseases associated with unwanted angiogenesis, such as cancers or tumors.
[0131] The application also provides methods for administering the polypeptides described herein to a subject. In some embodiments, the subject is a human. In some embodiments, the proteins are pharmaceutically acceptable to a mammal, in particular a human. A pharmaceutically acceptable composition refers to a composition that is administered to an animal without significant adverse medical consequences.
[0132] In certain embodiments, the application provides pharmaceutically acceptable compositions comprising the polypeptide described herein. In some embodiments, the composition is essentially pyrogen free. In some embodiments, the composition is substantially free of microbial contamination making it suitable for in vivo administration. The composition may be formulated, for example, for intravenous (IV), intraperitoneal (IP) or subcutaneous (SubQ) administration. In some embodiments, the composition comprises a physiologically acceptable carrier. In some embodiments, the pH of the composition is between 2-9, 3-8, 4-7.5, 4-7, 4-6.5, or between 4-5.5, or is about 4.0, 4.5, 5.0, or 5.5. In some embodiments, the concentration of the polypeptide is 1-1000, 1-500, 1-200, 1-100, 1-50, 1-20, 1-10, 1-5, or 0.5-2 mg/ml in the composition.
[0133] In certain embodiments, the application provides a nucleic acid encoding the polypeptides as described herein. Vectors containing polynucleotides for such polypeptides are included as well. Suitable vectors include, for example, expression vectors. A further aspect of the application provides for a cell, comprising a polynucleotide, vector, or expression vector, encoding a polypeptide described herein.
[0134] Sequences are preferably optimized to maximize expression in the cell type used. In some embodiments, expression is in a bacterial cell, such as E. coli. In other embodiments, expression is in a mammalian cell. In one embodiment, the cell expresses a polypeptide comprising a modified Fn3 domain as described herein. In certain embodiments, the polynucleotides encoding polypeptides described herein are codon optimized for expression in the selected cell type. Also provided are methods for producing a polypeptide as described herein, comprising culturing a host cell comprising a nucleic acid, vector, or expression vector encoding the polypeptide described and recovering the expressed polypeptide from the culture.
[0135] In certain embodiments, the application provides libraries comprising a plurality of the polypeptides described herein. The libraries provided herein may comprise, for example, at least 10.sup.4, 10.sup.5, 10.sup.6, 10.sup.7, 10.sup.8, 10.sup.9, 10.sup.10, 10.sup.11, 10.sup.12, 10.sup.13, or 10.sup.14, or more polypeptides, each optional comprising a different amino acid sequence. Also provided are methods for identifying a polypeptide that binds to a target of interest from one of the libraries described herein. For example, a library screening method may comprise, for example, contacting a library of the polypeptides described herein with a target of interest, and isolating members of the library that bind to the target (e.g., with a particular affinity or under suitable wash conditions). The isolation step may be carried out using any suitable method, such as phage display or mRNA display. Similarly, target binding may be conducted using any suitable method such as immobilizing the target on a solid support (e.g., a column, chip, bead, etc.) and mixing the immobilized target with the library under conditions suitable to allow protein binding. The bound library members may then be separated from unbound library members to yield an isolated Fn3 protein that binds to the target. In certain embodiments, the isolation method may involve repeated rounds of target binding and isolation steps.
[0136] Provided are also isolated polypeptides identified by a method described herein. In some embodiments, the isolated polypeptide may bind to the target with a K.sub.d of less than 1500 nM (1.5 pM), 1000 nM (1 pM), 500 nM, 400 nM, 300 nM, 200 nM, 100 nM, 50 nM, 20 nM, 10 nM, 5 nM, 1 nM, 500 pM, 100 pM or less. In some embodiments, the polypeptide may bind to the target with a K.sub.d between 1 pM and 1 pM, between 100 pM and 500 nM, between 1 nM and 500 nM, or between 1 nM and 100 nM.
Exemplary Sequences
[0137]
TABLE-US-00003 WT.sup.10Fn3Domain: (SEQIDNO:1) VSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEF TVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEIDKPSQ .sup.10Fn3DomainofSEQIDNO:1withD97E: (SEQIDNO:2) VSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEF TVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEIEKPSQ WT.sup.10Fn3DomainCoreSequenceversion1: (SEQIDNO:3) LEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKST ATISGLKPGVDYTITVYAVTGRGDSPASSKPISINY WT.sup.10Fn3DomainCoreSequenceversion2: (SEQIDNO:4) EVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKST ATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRT WT.sup.10Fn3DomainCoreSequenceversion3: (SEQIDNO:5) VSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEF TVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRT WT.sup.10Fn3DomainCoreSequenceversion4: (SEQIDNO:6) VSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEF TVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTE WT.sup.10Fn3DomainCoreSequenceversion5: (SEQIDNO:7) VSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEF TVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEI WT.sup.10Fn3DomainCoreSequenceversion6: (SEQIDNO:8) VSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEF TVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEID .sup.10Fn3DomainCoreSequenceversion7(version6withD97E): (SEQIDNO:9) VSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEF TVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEIE WT.sup.10Fn3DomainCoreSequenceversion8: (SEQIDNO:10) VSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEF TVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEIDK .sup.10Fn3DomainCoreSequenceversion9(version8withD97E): (SEQIDNO:11) VSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEF TVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEIEK WT.sup.10Fn3DomainCoreSequenceversion10: (SEQIDNO:12) VSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEF TVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEIDKP .sup.10Fn3DomainCoreSequenceversion11(version10withD97E): (SEQIDNO:13) VSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEF TVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEIEKP WT.sup.10Fn3DomainCoreSequenceversion12: (SEQIDNO:14) VSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEF TVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEIDKPS .sup.10Fn3DomainCoreSequenceversion13(version12withD97E): (SEQIDNO:15) VSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEF TVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEIEKPS WT.sup.10Fn3DomainwithD80ESubstitution (SEQIDNO:16) VSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEF TVPGSKSTATISGLKPGVDYTITVYAVTGRGESPASSKPISINYRTEIDKPSQ DegenerateWT.sup.10Fn3DomainCoreSequence: (SEQIDNO:17) VSDVPRDLEVVAA(X).sub.uLLISW(X).sub.yYRITY(X).sub.wFTV(X).sub.xATISGL(X).sub.yYTIT VYA(X).sub.zISINYRT (SEQIDNO:18) VSDVPRDLEVVAA(X).sub.uLLISW(X).sub.yYRITY(X).sub.wFTV(X).sub.xATISGL(X).sub.yYTIT VYA(X).sub.zISINYRTE (SEQIDNO:19) VSDVPRDLEVVAA(X).sub.uLLISW(X).sub.yYRITY(X).sub.wFTV(X).sub.xATISGL(X).sub.yYTIT VYA(X).sub.zISINYRTEI (SEQIDNO:20) VSDVPRDLEVVAA(X).sub.uLLISW(X).sub.yYRITY(X).sub.wFTV(X).sub.xATISGL(X).sub.yYTIT VYA(X).sub.zISINYRTEID (SEQIDNO:21) VSDVPRDLEVVAA(X).sub.uLLISW(X).sub.yYRITY(X).sub.wFTV(X).sub.xATISGL(X).sub.yYTIT VYA(X).sub.zISINYRTEIE (SEQIDNO:22) VSDVPRDLEVVAA(X).sub.uLLISW(X).sub.yYRITY(X).sub.wFTV(X).sub.xATISGL(X).sub.yYTIT VYA(X).sub.zISINYRTEIDK (SEQIDNO:23) VSDVPRDLEVVAA(X).sub.uLLISW(X).sub.yYRITY(X).sub.wFTV(X).sub.xATISGL(X).sub.yYTIT VYA(X).sub.zISINYRTEIEK (SEQIDNO:24) VSDVPRDLEVVAA(X).sub.uLLISW(X).sub.yYRITY(X).sub.wFTV(X).sub.xATISGL(X).sub.yYTIT VYA(X).sub.zISINYRTEIDKP (SEQIDNO:25) VSDVPRDLEVVAA(X).sub.uLLISW(X).sub.yYRITY(X).sub.wFTV(X).sub.xATISGL(X).sub.yYTIT VYA(X).sub.zISINYRTEIEKP (SEQIDNO:26) VSDVPRDLEVVAA(X).sub.uLLISW(X).sub.yYRITY(X).sub.wFTV(X).sub.xATISGL(X).sub.yYTIT VYA(X).sub.zISINYRTEIDKPS (SEQIDNO:27) VSDVPRDLEVVAA(X).sub.uLLISW(X).sub.yYRITY(X).sub.wFTV(X).sub.xATISGL(X).sub.yYTIT VYA(X).sub.zISINYRTEIEKPS (SEQIDNO:28) VSDVPRDLEVVAA(X).sub.uLLISW(X).sub.yYRITY(X).sub.wFTV(X).sub.xATISGL(X).sub.yYTIT VYA(X).sub.zISINYRTEIDKPSQ (SEQIDNO:29) VSDVPRDLEVVAA(X).sub.uLLISW(X).sub.yYRITY(X).sub.wFTV(X).sub.xATISGL(X).sub.yYTIT VYA(X).sub.zISINYRTEIEKPSQ (SEQIDNO:30) MGVSDVPRDL (SEQIDNO:31) GVSDVPRDL (SEQIDNO:32) X.sub.nSDVPRDL (SEQIDNO:33) X.sub.nDVPRDL (SEQIDNO:34) X.sub.nVPRDL (SEQIDNO:35) X.sub.nPRDL (SEQIDNO:36) X.sub.nRDL (SEQIDNO:37) X.sub.nDL (SEQIDNO:38) MASTSG (SEQIDNO:39) EIEK (SEQIDNO:40) EGSGC (SEQIDNO:41) EIEKPCQ (SEQIDNO:42) EIEKPSQ (SEQIDNO:43) EIEKP (SEQIDNO:44) EIEKPS (SEQIDNO:45) EIEKPC (SEQIDNO:46) HHHHHH (SEQIDNO:47) EIDK (SEQIDNO:48) EIDKPCQ (SEQIDNO:49) EIDKPSQ (FibconB;SEQIDNO:50) MPAPTDLRFTNETPSSLLISWTPPRVQITGYIIRYGPVGSDGRVKEFTVP PSVSSATITGLKPGTEYTISVIALKDNQESEPLRGRVTTGG (SEQIDNO:51) TPSS (SEQIDNO:52) TPPRVQI (SEQIDNO:53) VGSDGR (SEQIDNO:54) PSVS (SEQIDNO:55) GLKPG (SEQIDNO:56) KDNQESEP (SEQIDNO:57) LDAPTDLQVTNVTDTSITVSWTPPSATITGYRITYTPSNGPGEPKELTVP PSSTSVTITGITPGVEYVVSVYALKDNQESPPLVGTCTT (SEQIDNO:58) LPAPKNLVVSEVTEDSLRLSWTAPDAAFDSFLIQYQESEKVGEAINLTV PGSERSYDLTGLKPGTEYTVSIYGVKGGHRSNPLSAEFTT (SEQIDNO:59) TEDS (SEQIDNO:60) TAPDAAF (SEQIDNO:61) SEKVGE (SEQIDNO:62) GSER (SEQIDNO:63) GLKPG (SEQIDNO:64) KGGHRSN Wildtype.sup.7Fn3domain: (SEQIDNO:65) PLSPPTNLHLEANPDTGVLTVSWERSTTPDITGYRITTTPTNGQQGNSL EEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPISDTTIP Wildtype.sup.14Fn3domain: (SEQIDNO:66) NVSPPRRARVTDATETTITISWRTKTETITGFQVDAVPANGQTPIQRTIK PDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDAST EGFR#8.sup.10Fn3domain: (SEQIDNO:67) MGVSDVPRDLEVVAATPTSLLISWDSGRGSYQYYRITYGETGGNSPVQ EFTVPGPVHTATISGLKPGVDYTITVYAVTDHKPHADGPHTYHESPISINYRTEID KPSQ EGFR#4.sup.10Fn3domain: (SEQIDNO:68) MGVSDVPRDLEVVAATPTSLLISWYWEGLPYQYYRITYGETGGNSPV QEFTVPRDVNTATISGLKPGVDYTITVYAVTDWYNPDTHEYIYHTIPISINYRTEID KPSQ EGFR#8-T58E.sup.10Fn3domain: (SEQIDNO:69) MGVSDVPRDLEVVAATPTSLLISWDSGRGSYQYYRITYGETGGNSPVQ EFTVPGPVHTAEISGLKPGVDYTITVYAVTDHKPHADGPHTYHESPISINYRTEID KPSQ EGFR#8-T58D.sup.10Fn3domain: (SEQIDNO:70) MGVSDVPRDLEVVAATPTSLLISWDSGRGSYQYYRITYGETGGNSPVQ EFTVPGPVHTADISGLKPGVDYTITVYAVTDHKPHADGPHTYHESPISINYRTEID KPSQ EGFR#4-T58E.sup.10Fn3domain: (SEQIDNO:71) MGVSDVPRDLEVVAATPTSLLISWYWEGLPYQYYRITYGETGGNSPV QEFTVPRDVNTAEISGLKPGVDYTITVYAVTDWYNPDTHEYIYHTIPISINYRTEID KPSQ
EXAMPLES
[0138] The invention described herein will be more readily understood by reference to the following examples which are included merely for purposes of illustration of certain aspects and embodiments of the present disclosure, and are not intended to limit the invention in any way.
Example 1: Proteins Solubility Based on a Kosmotrope-Based Assay
[0139] This example describes aggregation propensity of proteins based on their relative solubility in ammonium sulfate (AS).
[0140] The effect of AS on protein solubility has been known for more than 80 years (Green, A. A., 1931, J. Biol. Chem. 93, 495-516), where it has most commonly been used for protein fractionation and purification. The mechanism of AS-induced protein precipitation or salting out, is believed to involve the strong binding of water molecules by the polar kosmotropic sulfate anion, which dehydrates the protein surfaces, increases the chemical potential of the protein and causes the protein molecules to aggregate into an amorphous precipitate (Baldwin, R. L., 1996, Biophys J. 77:2056-63). Because the hydrophobic surfaces on the protein are preferentially dehydrated over the polar surfaces, AS-induced protein self-association is driven by the interaction of exposed hydrophobic surfaces, similar to the forces that drive aggregation in the absence of AS (Young, L. et al., 1994, Protein Sci. 3, 717-29; Arunachalam, J. and Gautham, N., 2008, Proteins. 71, 2012-25; Fink, A. L. 1998, Fold Des. 3, R9-23).
[0141] Described in this example is a method around this concept and its application in analyzing solubility or aggregation propensity of protein therapeutics of several different formats including single domain adnectins, multi-domain/multi-specific adnectins, adnectin-Fc fusions (Adn-Fcs), domain antibody (dAb) Fc-fusions (dAb-Fcs), and monoclonal antibodies (mAbs). The AS solubility data correlated with the protein aggregation propensity observed by other established methods (see Yamniuk, A. P. et al, 2013, J Pharm. Sci. 102, 2424-2439).
Materials and Methods
Proteins:
[0142] Single domain anti-EGFR adnectins, anti-EGFR/IGF1R bispecific tandem adnectins (EI-tandems), and PEGylated anti-EGFR/IGFR bispecific tandem adnectins were expressed and purified as previously described (Emanuel, S. L. et al., 2011, MAbs 3, 38-48). Adnectin-Fc and dAb-Fc fusions, as well as mAbs were expressed in HEK293-6E or CHO-S cells and purified by standard protein A affinity chromatography followed by preparative size exclusion chromatography (SEC). The Adn-Fc fusion proteins Adn-Fc-a, Adn-Fc-b, and Adn-Fc-e were over-expressed in E. coli, and each protein was refolded by resuspending the insoluble lysate fraction in 6 M Guanadinium HCl at pH 10.0 followed by dialysis against neutral pH buffer. The resulting refolded protein was purified as described above for the mammalian expressed fusions. All proteins were >95% pure as judged by SDS-PAGE.
Bench Scale Ammonium Sulfate Solubility Assay:
[0143] Bench-scale AS solubility studies were conducted at room temperature, and unless otherwise specified, the buffer was 10 mM NaPO.sub.4, 130 mM NaCl pH 7.1. Samples were prepared by mixing protein stock solution with buffer and 3.5 M AS in matched buffer and pH, to produce a series of 8-12 samples of identical [protein] and increasing [AS] over a desired range. As observed in other studies (Trevino, S. R. et al., 2007, J Mol Biol. 366, 449-60; Schein, C. H., 1990, Biotechnology 8, 308-17), protein precipitation was rapid (<5 min), largely reversible upon dilution, and the soluble protein concentration remained stable for hours to days following removal of precipitated protein by centrifugation or filtration. In some instances the reversibility of precipitation was taken advantage of by generating samples of a given protein concentration at the lowest and highest desired AS concentrations, and mixing these two samples in appropriate volumes to generate the intermediate AS concentrations of the titration series. Samples were incubated for 10 minutes at room temperature, followed by either centrifugation or filtration to remove precipitated protein, and protein concentration was determined using absorbance at 280 nm (A.sub.280) of 2-3 ul of sample on a NanoDrop 2000 (Thermo Scientific) instrument.
Automated Ammonium Sulfate Solubility Assay:
[0144] Samples for the automated AS solubility assay were prepared using a Tecan Genesis Freedom 200 instrument at room temperature. First, 125 ul of protein stock solution was aspirated from a stock tube or plate, and 15 ul was dispensed into each of 8 wells in a 384 well plate (Whatman Uniplate #7701-5101). Next, 40 ul of 8 different AS solutions in buffer were aspirated from a 96 deep well plate and 35 ul was dispensed into the 8 protein wells with immediate gentle mixing. Following preparation of the last sample in a given set, all samples were incubated for an additional 5 minutes at room temperature. Then, samples were gently mixed and 47 ul of the protein/AS mixture was aspirated and 45 ul dispensed into a 384-well filter plate (PALL AcroPrcp384 100 ul 0.45 um GHP #PN5071) placed on top of 384 well coming clear flat bottom U V plate (Corning UV 384 well #3675). Precipitated protein was filtered by centrifuging for 5 min at 21 C. Soluble protein was detected using a SpectroMax M5 plate reader, by measuring either the absorbance at 280 nm (A.sub.280), or intrinsic fluorescence using an excitation wavelength of 280 nm and emission wavelength of 350 nm. Both detection methods generally gave comparable results, but A.sub.280 detection was implemented as the default method for analysis.
Ammonium Sulfate Solubility Data Analysis and Curve Fitting:
[0145] The solubility of a protein in AS within the salting out region can be described by the linear relationship (Eq. 1) (Green, A. A., 1931, J. Biol. Chem. 93, 495-516):
log S=Ks[AS](1)
[0146] where S is the protein solubility (protein concentration), is the theoretical solubility at zero molar AS, Ks is the salting out constant, and [AS] is the AS concentration. Theoretically, the solubility of different proteins can be evaluated by comparing values extrapolated from data in the salting out region. However, at the low protein concentrations and volumes desired for high throughput screening, there was limited data within the salting out region and therefore considerable uncertainty in the extrapolation, making value comparison unreliable. Therefore, the salting out data were fitted to a sigmoidal curve function (Eq, 2):
where A.sub.1 is the initial Y value (absorbance or fluorescence), A2 is the final Y value, dx is the slope, and ASm is the salting out midpoint value. ASm analysis enabled a rapid quantitative comparison of the relative solubility of different proteins using either A.sub.280 or fluorescence detection, and eliminated the necessity of converting the data to units of protein concentration. In general, calculated curve-fitting errors were in a similar range as the typical standard deviation for multiple independent measurements of a given protein (0.01-0.04 M). The analysis of ASm values is also similar to the determination of PEGmidpoint values recently described by Gibson, T. J. et al (2011, J Pharm Sci. 100, 1009-21)
Accelerated Stability Studies:
[0147] Accelerated stability (forced degradation) studies were carried out for several adnectin-Fc molecules by incubating 1 mg/ml protein samples in 50 mM sodium phosphate (NaH.sub.2PO.sub.4) pH 7.0 and/or 50 mM sodium succinate (Na.sub.2C.sub.4H.sub.4O.sub.4) pH 6.0 for 2-4 weeks at temperatures ranging from 30-37 C. In all cases the incubation temperatures were at least 15 below the melting temperature (Tm) of the molecules as determined by either differential scanning calorimetry or thermal scanning fluorescence, in order to minimize non-native state degradation pathways. At various time points during the incubation, aliquots were removed and subjected to analytical size exclusion chromatography (SEC) analysis to determine the percentage of monomer, high molecular weight (HMW) and low molecular weight (LMW) species.
Ultrafiltration:
[0148] Ultrafiltration studies with anti-EGFR adnectin molecules were performed in VivaSpin 3000 MWCO concentrators at room temperature. 0.5-1.0 mg/ml protein in PBS pH 7.1 were slowly concentrated using centrifugal force to a target of30-40 mg/ml with periodic mixing to avoid gradient formation, and then samples were incubated at 4 C. for 5 days. Precipitated protein was removed by centrifugation, and the soluble protein concentration was measured by A280 on a Nanodrop 2000 instrument, with the aggregation state measured by DLS as described below. Ultrafiltration studies for adnectin-Fc or dAb-Fc molecules were performed at 4 C. in VivaSpin 10,000 MWCO concentrators using positive pneumatic pressure regulated at 15 psi. To minimize gradient formation the concentrators were placed on a rocker plate set to 60 rpm for continual mixing, and samples were periodically removed and gently mixed by pipette. Typically starting samples were 1-7 mg/ml protein and were concentrated to 50 mg/ml or higher over the course of 6-8 hours. 20-40 ul aliquots were removed at various time points and stored overnight at 4 C., followed by centrifugation to remove any precipitates, and then protein concentration was determined by A280 and the aggregation state of undiluted samples characterized by analytical SEC.
Dynamic Light Scattering:
[0149] Dynamic light scattering (DLS) studies were performed on a Wyatt DynaPro plate reader in 384 well plates at 25 C., using protein samples in 10 mM NaPO.sub.4, 130 mM NaCl pH 7.1. Typical experimental parameters were 20 acquisitions of 5 s each per measurement, and measurements were recorded at least in triplicate and averaged to give the reported values. Intensity autocorrelation functions were fitted using the Regularization algorithm in the Dynamics software (Wyatt Technologies).
Results
Ammonium Sulfate Solubility of Adnectins:
[0150] Initial AS solubility studies were performed at bench scale using a set of single domain adnectin molecules (monoadnectins) with loops engineered to specifically bind to the EGFR receptor (EGFR #1-7), or IGF1R receptor (IGFR #1) (Emanuel, S. L. et at., 2011, MAbs 3, 38-48). An example salting out curve for 1 mg/ml IGF1R #1 is shown in
[0151] Salting out curves for EGFR #1-7 as well as IGFR #1 are shown in
[0152] Similar bench scale salting out studies were performed using each of the EGFR #1-7 adnectins fused in-line with IGF1R #1 (EI-tandems), as well as for the EI-tandems covalently linked with a 40 kDa branched polyethylene glycol on the C-terminus (EI-tandem-PEG) which was done to extend serum half life (Emanuel et al., 2011, mAbs 3, 38-48). The slope of the salting out curves for the ET-tandems was similar to the monoadnectins (
Ammonium Sulfate Solubility of Adnectin-Fc Fusions:
[0153] To determine if the AS solubility was predictive of the aggregation propensity of other protein therapeutic formats such as Fc-fusions, an automated, plate-based AS solubility method was used to generate salting out curves using either UV absorbance (A280) or fluorescence detection using as little as 50 micrograms of protein to generate an 8-point curve (Figure SB and C). The relative solubility comparisons described below for Adn-Fcs, dAb-Fcs and mAbs were all performed using identical protein concentrations of 0.45 mg/ml.
[0154] The automated AS solubility method was applied to a series of Adn-Fc molecules with diverse binding loops specifically selected to bind different therapeutic target proteins, each of which was fused to a human IgG1 Fc-domain (Adn-Fcs). Most Adn-Fcs were produced in mammalian cells and are indicated with upper case letters (i.e., Adn-Fc-A), but a few molecules were also produced in E. coli, and are indicated with lower case letters (i.e., Adn-Fc-a). The aggregation propensity of many of these Adn-Fc molecules had been previously characterized at low concentration (1 mg/ml) under accelerated conditions of thermal stress, where three molecules (Adn-A, Adn-a, and Adn-L) were shown to have a significantly higher aggregation propensity than the others (
[0155] The salting out properties of the Adn-Fc molecules were characterized using the automated method, and the salting out behavior was compared to the accelerated stability and ultrafiltration data. The Adn-Fc molecules were found to salt out over a fairly broad range of [AS], with ASm values of 0.67-1.33 M (
[0156] Therefore, the AS solubility assay was able to rapidly identify the same high aggregation propensity Adn-Fc molecules that were identified in the accelerated stability and ultrafiltration studies.
Solubility of dAb-Fc Fusions:
[0157] To determine if the AS solubility method was predictive of the relative solubility of protein therapeutics other than adnectins, a series of domain antibody Fc-fusion (dAb-Fc) molecules were tested using the automated method. The dAbs were from several different sequence families with binding loops specifically selected to bind different therapeutic targets. The nomenclature for these molecules includes an identifier for the sequence family (ex. 3 in dAb3-1) as well as for the specific sequence variant within the family (example, 1 in dAb3-1). The dAb molecules were produced as fusions to either human IgG4 Fc domain containing a hinge stabilizing S228P mutation (Newman, R. et al., 2001, Clin Immunol. 98, 164-74) (referred to as IgG4), or fused to one of several modified human IgG1 Fc domains which are identified with asterisks, for example IgG 1*, IgG 1**, IgG 1***, etc. Many of these dAb-Fc molecules (dAb3, dAb5, dAb6, dAb9 families) could be purified as stable monomers as judged by SEC-MALS (not shown) or DLS (
[0158] Example salting out curves for representative dAb-Fc molecules are shown in
Solubility of Monoclonal Antibodies:
[0159] The AS solubility of a panel of monoclonal antibodies (mAbs) were tested which had either the same Fc domain but different target binding Fab domains, or the same Fab domains fused to different Fc domains. The Fc domains in this sample set included wild type IgG1, various modified IgG1 Fc domains (IgG1*, IgG1**, IgG1***), IgG4-S228P (identified as IgG4), IgG2a, or a modified IgG2a (identified as IgG2a*). The salting out data for the mAbs is shown in
Application of Ammonium Sulfate Solubility Assay in Drug Optimization:
[0160] As described herein, an Alanine scanning approach was used to examine the contribution of binding loop residues to the interaction energy for an adnectin binding to the EGFR receptor (referred to as EGFR #8, comprising a .sup.10Fn3 domain of SEQ ID NO:67). All residues in the BC, DE and FG target binding loops were individually replaced with Ala, and the effects on target binding were evaluated. In addition, one residue adjacent to the DE loop, T58, was also identified based on molecular modeling as a site at which binding energy might be modified through mutation. Thus three additional mutants (T58.fwdarw.E, T58.fwdarw.D, T58.fwdarw.Q) were created and studied for target binding. Those Ala and T58 mutants were also tested to determine whether any of the mutations could enhance the solubility of EGFR #8.
[0161] Wild type EGFR #8 Adnectin (SEQ ID NO:67), tested at 0.33 mg/ml, was found to salt out between 1.9-2.3 M AS, with ASm=2.1 M (
[0162] Since the structure of EGFR #8 was determined, the residue-specific aggregation propensities were calculated for all mutated residues in the protein using the spatial-aggregation-propensity (SAP) algorithm (Chennamsetty, N. et al., 2009, Proc. Natl. Acad. Sci. USA. 106, 11937-42). SAP values were calculated at high resolution using a radius of 5 to identify specific aggregation-prone residues, as well as at low resolution with R=10 to identify larger aggregation-prone hydrophobic patches. The SAP data for the mutated residues are shown in
TABLE-US-00004 TABLE 1 Summary of experimental data and theoretical properties of anti-EGFR adnectins. GRAVY EGFR ASm Conc Conc Tm score Theoretical Theoretical Adnectin (M).sup.1 (mg/ml) Rh (nm).sup.2 (mg/ml).sup.3 Rh (nm).sup.2 ( C.).sup.4 Hydropathy.sup.5 pI charge at pH 7 EGFR#1 1.85 0.9 1.7 0.1 33 2.3 0.2 71 0.58 5.9 4.2 EGFR#2 1.64 1.0 1.9 0.1 22* 5.9 0.7 59 0.54 6.2 2.3 EGFR#3 1.34 1.1 1.8 0.5 14* 2.5 1.5 82 0.57 6.0 3.3 EGFR#4 0.67 0.6 1.9 0.1 4.9* 3.0 0.1 77 0.50 5.4 6.3 EGFR#5 1.45 1.4 2.0 0.1 40 4.4 0.0 78 0.43 5.9 3.4 EGFR#6 2.01 0.9 1.9 0.0 36 2.5 0.0 74 0.56 5.9 4.2 EGFR#7 1.53 1.2 1.7 0.1 35 2.7 0.1 n.d..sup.6 0.48 5.9 4.2 .sup.1at protein concentration of 0.28 mg/ml. .sup.2Rh determined by dynamic light scattering .sup.3values with an asterisk (*) indicate an apparent solubility limit .sup.4Tm = melting temperature .sup.5GRAVY hydropathy score calculate for variable target binding loop residues. All scaffold residues were identical in each adnectin. .sup.6not determined
TABLE-US-00005 TABLE 2 ASm values for mAbs having different Fab or Fc domains. Antibody Fab Fc ASm.sup.1 mAb-A-IgG1 A IgG1 1.59 0.01 mAb-A-IgG1* A IgG1* 1.62 mAb-A-IgG4 A IgG4 1.54, 1.56 mAb-B-IgG1 B IgG1 1.50 mAb-B-IgG1** B IgG1** 1.38 mAb-B-IgG2 B IgG2 1.51 mAb-B-IgG2* B IgG2* 1.40 mAb-B-IgG4 B IgG4 1.40 mAb-C-IgG1**** C IgG1**** 1.32, 1.33 mAb-D-IgG1 D IgG1 1.61 mAb-E-IgG1 E IgG1 1.31 mAb-F-IgG1**** F IgG1**** 1.38 mAb-G-IgG4 G IgG4 1.53 mAb-H-IgG4 H IgG4 1.43 0.05 .sup.1ASm values for experiments performed three or more times are represented average standard deviation.
Example 2: Structure of Adnectin/Protein Complex
[0163] Adnectins that specifically bound epidermal growth factor receptor (EGFR) or interleukin 23 (IL-23), two therapeutically-validated targets, were generated using the mRNA display technique described previously (Xu et al., 2002, Chem. Biol. 9, 933-942). These Adnectins inhibit the binding of their target to the target's cognate receptor or ligand and also block intracellular signaling of the target/ligand interactions in cell-based assays. A representative Adnectin that blocked each target was selected for co-crystallization with its target to identify the nature of the contacts.
[0164] Analysis of the structures of EGFR- and IL-23-binding Adnectins yields multiple insights into the molecular interactions between .sup.10Fn3-based variants and their targets. Many of the diversified loop residues contact the target. More interestingly, not all the residues in the three diversified loops (
Experimental Procedures:
Adnectin Selection
[0165] Initial Adnectin binders against EGFR and IL-23 were obtained using PROfusion (Xu et al., 2002, Chem. Biol. 9, 933-942; Getmanova et al., 2006, Chem. Biol. 13, 549-556), also known as mRNA display. Starting .sup.10Fn3 libraries were designed to randomize the underlined positions indicated in
Purification and Activity Assays.
[0166] Expression and Purification of anti-IL-23 and anti-EGFR Adnectins was analogous to that described previously (Mamluk et al., 2010, mAbs 2, 199-208). Inhibition of EGFR and IL-23 activities by these proteins was measured by competition ELISA binding assays of Interleukin-23 and native IL-23 receptor (IL-23R). Nunc Maxisorp plates (Thermo Fisher Scientific, Denmark) coated overnight with 50 L Recombinant human IL-23R-Fc (R&D Systems, Minneapolis, Minn.), 4 g/mL in PBS at 4 C. Plates were washed with PBS containing 0.05% w/v Tween-20 using an automated plate washer (Biotek, VT). OptEIA buffer (BD Bioscience, CA) was used as blocking agent and assay diluent. Adnectin dilutions ranging from 28 pM to 200 nM were pre-incubated with 1 nM IL-23 for an hour prior to transfer to blocked IL-23R-Fc coated plates. After a 30 minute incubation bound IL-23 was detected via anti-IL-23 (GeneTex, CA) and anti-mouse-HRP (R&D Systems, MN) followed by TMB (3,3,5,5-tetramethylbenzidine) (BD Bioscience, CA) addition. Percent inhibition was calculated by using a known IL-23 Adnectin neutralizing standard to define 100% inhibition and a non-binding Adnectin standard as a negative control. IC50S were generated from the average of four runs with an in-house curve fitting application. Adnectin inhibition of phosphorylation of EGFR on tyrosine 1068 was determined using an H292 cell in vitro ELISA assay as described elsewhere (Emanuel et al., 2011, mAbs 3, 38-48).
Surface Plasmon Resonance (SPR) Determination of Adnectin Binding Constants.
[0167] The K.sub.D for Adnectin 2 was determined by surface plasmon resonance (SPR) on a Biacore T100 instrument (GE Healthcare, Piscataway, N.J.), by injecting a concentration series of the Adnectin over three densities of immobilized human IL-23 in single cycle kinetics mode without regeneration of the surface.
[0168] The K.sub.D for Adnectin 1 binding to recombinant EGFR-Fc (containing amino acids 25 to 645 of human EGFR ectodomain, R&D Systems) captured on mouse anti-human IgG antibody (GE Healthcare) was assessed by SPR. Anti-human IgG was immobilized on flow cells 1-4 of CMS sensor chips according to the manufacturer's instructions to an average of 7500-10000 RU. All kinetic measurements were conducted in HBS-P (10 mM HEPES, 150 mM NaCl, 0.05% Surfactant P20) at 37 C. with 3 M MgCl2 as regeneration solution. Kinetics of Adnectin-EGFR association were monitored for 250 seconds followed by dissociation for up to 3000 seconds with Adnectin concentrations of 0.78-100 nM. Kinetic parameters for both were calculated using Biacore T100 software.
Expression and Purification of Human IL-23.
[0169] A bi-cistronic construct for expressing the p40 and p19 subunits of IL-23 was created by cloning the p19 subunit into pFastBac Dual vector (Invitrogen) under control of the PpH promoter and the p40 subunit using hp19-pFastBac Dual under control of the Pp10 promoter. Human IL-23 was expressed in Sf9 cells which secreted the IL-23 protein into the growth media. The media containing IL-23 was concentrated and buffer exchanged into either PBS or Tris-buffered saline using tangential flow filtration. Active IL-23 was affinity purified from this concentrate by means of a novel Adnectin affinity column consisting of purified anti-IL-23 Adnectin protein covalently linked via primary amine coupling to CNBr-activated Sepharose 4 Fast Flow resin (GE Healthcare) according to the manufacturer's instructions and employing an overnight linkage incubation at 4 C. Concentrated, buffer exchanged media was passed through a column packed with this affinity resin at a linear flow rate of 20 cm/hr. The column bed was washed with five column volumes of buffer alone. Highly purified IL-23 was eluted with 0.1 M acetate, pH 4.0, 1.0 M NaCl and the eluate was immediately pH neutralized with 1/10 volume Tris HCl, pH 8.0. The sample was further purified using a preparative scale Superdex 200 size exclusion chromatography (SEC) column equilibrated and run in HBS buffer.
Purification of EGFR.
[0170] Human EGFR (residues 1-642) with a C-terminal His-tag was expressed in Sf9 cells. The secreted media containing human EGFR was concentrated and buffer exchanged into 25 mM Tris-HCl, pH 8.0, 250 mM NaCl, 5% (v/v) glycerol using tangential flow filtration. The human EGFR was purified by Ni-NTA chromatography followed by size exclusion chromatography on a Superdex 200 column (GE Healthcare) and fractions corresponding to the EGFR monomer were combined.
Preparation and Purification of EGFR/Adnectin 1 and IL-23/Adnectin 2 Complexes.
[0171] Human EGFR was mixed with anti-EGFR Adnectin at a 1:6 molar ratio and incubated on ice for 2 hours. A 1:1 EGFR: Adenectin-1 complex was purified using SEC on a Superdex 200 column equilibrated and run in 25 mM HEPES, pH 7.5, 200 mM NaCl. Purified complex was concentrated using a Vivaspin 5 kDa cutoff concentrator to 20 mg/mL.
[0172] Human IL-23/Adnectin 2 complex was purified analogously with the following modifications using IL-23 purified as described above: IL-23 and Adnectin-2 were mixed at 1:3 molar ratio and incubated overnight at 4 C.; the final complex was concentrated to 12 mg/mL.
Crystallization of Protein Complexes.
[0173] EGFR/Adnectin-1 complex was crystallized at 20 C. using hanging drop vapor diffusion method by mixing 1 L of protein complex with 1 L of reservoir solution containing 60% Tacsimate (Hampton Research, Aliso Viejo, Calif.). IL-23/Adnectin-2 complex with a one-fold molar excess of Adnectin-2 was crystallized in the same manner at 20 C., but used 1M tri-sodium citrate, 0.2M NaCl, 0.1M Tris, pH 7.0 for Adenectin 2. The crystal quality of IL-23/Adnectin-2 complex was improved using crystal seeding.
Data Collection and Processing.
[0174] Data for the EGFR/Adnectin 1 complex were collected at beamline 211D-G at LS-CAT at the Advanced Photon Source at Argonne National Laboratory. The wavelength used was 0.979 and the detector was a Rayonix MX-300. Data were indexed, integrated, and scaled with HKL2000 (Otwinowski & Minor, 1997, Methods Enzymol. 276, 307-326). Data for IL-23/Adnectin 2 were collected at beamline 17ID at IMCA-CAT at the Advanced Photon Source at Argonne National Laboratory. The wavelength used was 1.0 and the detector was a MAR 165 CCD. Data were indexed, integrated, and scaled with D*TREK (Pflugrath, 1999, Acta Crystallogr. D Biol. Crystallogr. 55, 1718-1725). Space group, unit cell parameters and data collection statistics for both data sets are listed in Table 7.
Molecular Replacement.
[0175] A model for the Adnectins was derived from PDB 1FNF by deleting the BC, EF, and FG loops. The model for EGFR was based on domains of 1NQL. The model for IL-23 was a structure determined in a different crystal form from those published in the literature (3DUH, 3D87). PHASER (McCoy et al., 2007, J. Appl. Crystallogr. 40, 658-674) was used for molecular replacement. When PHASER failed to find the Adnectin in the IL-23/Adnectin 2 complex, a six-dimensional search using the AMoRe translation function was successfully used (Sheriff et al., 1999, J. Appl. Crystallogr. 32, 98-101; Navaza & Vcmoslova, 1995, Acta Crystallogr. Sect. A 51, 445-449; and CCP4, 1994, Acta Crystallogr. D Biol. Crystallogr. 50, 760-763).
Model Building, Refinement and Analysis.
[0176] COOT (Emsley et al., 2010, Acta Crystallogr. D Biol. Crystallogr. 66, 486-501) was used for model building. Refinement was carried out with autoBUSTER (BUSTER, version 2.13.0. Cambridge, UK: Global Phasing Ltd.). Refinement statistics are listed in Table 7. Initial electron density for the diversified loops with the final model is shown in
Estimates of Residue Free Energies & Interaction Energies.
[0177] The atomic models of the complexes were optimized using the Protein Preparation Wizard workflow in MAESTRO 9.0.211 (Schrodinger, LLC. 2009). The estimate of Gibbs free energy was calculated as described previously (Novotny et al., 1989, Biochemistry 28, 4735-4749; Krystek et al., 1993, J. Mol. Biol. 234, 661-679) and implemented in a python script using MAESTRO (Maestro, version 9.0, Schrdinger, LLC, New York, N.Y., 2009).
Energetics Calculations
[0178] Tables 8-10 contain the calculated energies for all mutant and wild type residues. For alanine-scanning mutagenesis the interaction energies and estimates of free energy were compared to experimental values for Adnectin target binding. The change in interaction energy from wildtype to mutant is reported in Tables 3-5 along with the experimental data. For all contact residues in each complex individual homology models were created substituting all amino acids at each contact position. For each of the models energetic calculations of the interaction energy and estimates of free energy were analyzed focusing on the amino acids corresponding to contact positions within the Adnectins. The calculated values for the selected models are presented in Tables 8-10.
Estimates of Residue Free Energies & Interaction Energies.
[0179] The atomic models of the complexes were optimized using the Protein Preparation Wizard workflow in MAESTRO 9.0.211 (Schrodinger, LLC. 2009). During this process side chain protonation states, histidine tautomers and terminal Chi retainers for histidine, asparagine and glutamine side chains are optimized. The final step in the workflow is restrained minimization of the complex (0.3 RMSD) which allows for subtle optimization of the complex within the OPLS_2005 force field. Protein models were created for each mutant protein using PRIME side chain refinement protocol followed by two minimization steps. The first minimization was applied to only side chains for the subset of residues that were within 5 of a mutation site. The final minimization step was applied to the same subset of residues but it included the backbone of the residues in the minimization.
[0180] The estimate of Gibbs free energy was calculated as described previously and implemented in a python script using MAESTRO (Maestro, version 9.0, Schrdinger, LLC, New York, N.Y., 2009). The residue interaction energies were determined using the OPLS_2005 force field as implemented in the Component Interactions script (Schrodinger, LLC) using Macromodel (MacroModel, version 9.7, Schrdinger, LLC, New York, N.Y., 2009). The script calculates the molecular mechanics interaction energy between a set of residues and outputs the individual VDW and electrostatic contribution terms. For the electrostatic component, distance-dependent dielectric was used with a constant of 4.0, similar to the free energy calculations.
Accession Numbers.
[0181] Coordinates and structure amplitudes have been deposited in the RCSB Protein Data Bank under ID codes 3QWQ (EGFR/Adnectin 1) and 3QWR (IL-23/Adnectin 2).
Results
Identification of EGFR and IL-23 Antagonistic Adnectins.
[0182] Adnectins that bound to and blocked activity of either EGFR (Adnectin 1) or IL-23 (Adnectin 2) were identified using the biochemical selection technique of mRNA display in which a protein was covalently attached to its coding nucleic acid sequences (Xu et al., 2002, Chem. Biol. 9, 933-942; Getmanova et al., 2006, Chem. Biol. 13, 549-556; Roberts & Szostak, 1997, Proc. Natl. Acad. Sci., USA 94, 12297-12302) (
Overview of the Structure of the EGFR/Adnectin 1 Complex.
[0183] EGFR is a remarkably flexible molecule with differing interactions between the four domains. EGFR structures deposited in the PDB (1IVO, 1NQL, 1YY9) show that domains I and III are relatively rigid while parts of domains II and IV may adopt multiple conformations that orient domain III differently with respect to domain I (Ogiso et al., 2002, Cell 110, 775-787; Ferguson et al., 2003, Mol. Cell 11, 507-517; Li et al., 2005, Cancer Cell 7, 301-311). The structure of EGFR in the EGFR/Adnectin 1 complex most closely resembled 1NQL, which Ls a complex of EGFR with EGF at low pH and Ls considered to be an inactive form of the receptor. However, superimposition of domain I of the two complexes leads to centers of domain III of the two complexes being separated by 25 , showing once again the remarkable flexibility of EGFR. The Adnectin bound to EGFR domain I (
[0184] Adnectin 1 described herein had an insertion of 5 residues in the FG loop. To retain a consistent numbering scheme, residues inserted in the FG loop were given insertion letters (
Specific Interactions of Adnectin 1 with EGFR.
[0185] The interaction between Adnectin 1 and EGFR domain I resulted in 520 .sup.2 on the Adnectin and 590 .sup.2 on EGFR domain I that were buried by the interaction (
[0186] The principal interactions of the Adnectin occurred through the FG loop (175 .sup.2 of buried surface), the D strand (175 .sup.2), the DE loop (70 .sup.2), the C strand (50 .sup.2), and the BC loop (40 .sup.2) (
Alanine-Scanning Mutagenesis of EGFR/Adnectin 1.
[0187] Single-site alanine mutants (Wells, 1991, Methods Enzymol. 202, 390-411) were made for 30 of the 101 residues of the Adnectin. All residues in the BC, DE, and FG loops that were diversified as part of the selection process were included as well as any other residue that was in contact (see above) with EGFR (Table 4, Table 8). Mutation of the following residues led to significantly diminished binding: Tyr 29, Gin 30, Tyr 31, Gly 52, Val 54, Asp 77, Lys 79, His 81, and Tyr 83. Surprisingly, Tyr 29, Gly 52, and Tyr 83 do not directly interact with EGFR. These may be explained on the basis of structural interactions within the Adnectin. Tyr29 side chain packed in the interior of the BC loop and against the F strand and mutation to Ala may be expected to disrupt the BC loop. Since Gly52 was part of a Pro-Gly-Pro turn, changing Gly to Ala might have disrupted this structural element. Tyr83 side chain formed an edge-to-face interaction with His81 side chain and a hydrogen bond with Glu85 side chain. His81 side chain in turn interacted with EGFR Thr15. The diminished activity resulted from the mutation Tyr83.fwdarw.Ala may be due to its helping maintain the position of His81.
[0188] Prior to the alanine-scanning mutagenesis, the energetics of the interaction was calculated on a per residue basis. These calculations correctly identified Gin 30, Tyr 31, and Asp 77 as important to the interaction, but also identified Pro 51 as being important, although mutation to Ala did not affect binding (Table 4, Table 8). The remaining residues that interacted with EGFR and were identified by alanine scanning, Val 54, Lys 79, and His 81, all showed changes in the correct direction (Table 4), but the magnitude of the change did not reach the threshold considered significant (3 kcal/mol).
Mutagenesis of Contact Residues of EGFR/Adnectin 1.
[0189] Six residues, Tyr31, Glu47, Thr49, Pro51, Thr58, and Ala79C, were targeted for additional mutation studies based upon interaction energy predictions calculated from models to explore the possibility that mutations might increase the binding affinity of Adnectin 1. Most mutations, which were typically attempts to create either hydrogen-bond or charged interactions, did not substantially change the affinity compared to the parent (Table 5, Table 9). However, the three mutations to residue 49 to increase the van der Waals interactions by converting a Thr to a Val, lie, or Tyr, increased the affinity of the Adnectin 8-to-40 fold (Table 5, Table 9). Since the side chain of Thr49 was not in contact with EGFR, mutation to a larger side chain (lie, Tyr) may have created additional hydrophobic contacts with residues from EGFR located in the surface depression next to Thr 49 (
[0190] Tyr 31 was mutated to Ser, Leu, and Phe to see whether the prediction that small residues (Scr) would lead to a decrease in affinity, but larger residues such as Leu and Phe, which potentially maintained VDW interactions might have a favorable effect on binding. Phe and, surprisingly, Ser had little effect, but Leu, led to much weaker binding despite modeling and energetics calculations that suggested it would be very similar to the parent.
[0191] Glu 47 side chain was not involved in interactions with EGFR, but modeling showed it to be close enough that a mutation to Arg or Lys would potentially form a salt bridge with EGFR Glu 90. Although energetics calculations suggested that this salt bridge would be favorable, experimentally neither materially affected the binding, nor did a mutation to Asp, which changed the relative position of the charge.
[0192] Pro 51 was the first residue of the DE-loop and was within VDW contact of EGFR Leu 69 side chain and the main chain carbonyl oxygen atoms of EGFR Ser 99 and Tyr 101. Modeling showed that Leu potentially improved VDW contacts or that Thr formed a hydrogen bond. Leu at position 51 was not significantly different than the parent, but Thr led to weak binding, maybe because the Pro 51-Gly 52-Pro 53 structure at the beginning of the DE-loop was disrupted.
[0193] Thr 49 side chain had no significant contacts with EGFR, but modeling suggested mutation to lie, Val, or Tyr may allow those residues to maintain the backbone hydrogen bond and pick up additional packing interactions with EGFR residues Leu 14 and Leu 69 that form a hydrophobic surface patch. Of the three mutations Tyr was predicted to be energetically favorable compared to the parent, while Val and Ile were predicted to be similar to the parent. Nevertheless, mutation of Thr 49 to Val or He showed a 12 and 37-fold, respectively, increase in binding affinity while mutation to tyrosine produced an 8-fold increase in binding affinity.
[0194] Thr 58 was not in contact with EGFR in the crystal structure, but modeling suggested that replacement with an acidic residue might lead to a salt bridge with Lys 105 although the NZ atom was not placed in crystallographic model due to inadequate electron density. Despite the prediction of large favorable changes in interaction energy, none of the three substitutions (Glu, Gin, or Asp) led to any significant change in activity. However, the substitutions at this position resulted in enhanced solubility of the protein, as described herein (see Example 1).
[0195] Ala 79C was marginally in contact with EGFR, but modeling showed that a longer residue might lead to additional interactions and energetics calculations suggested considerable increase in binding affinity for five mutations (Arg, Asn, Glu, Leu, and Tyr). Nevertheless all five mutations showed a slight, but insignificant, diminution of activity.
Overview of the Structure of the IL-23/Adnectin 2 Complex.
[0196] IL-23 is a two subunit protein consisting of a p40 subunit that is shared with IL-12 and a p19 subunit that is distinct from the p35 subunit of IL-12. The p40 subunit consists of three Ig-like 7 stranded -sheet domains, while the p19 consists of a 4-helix bundle. Adnectin 2 bound at the junction of the p40 and p19 subunits making considerable interactions with both subunits including domains 2 and 3 of the p40 subunit (
Specific Interactions of Adnectin 2 with IL-23.
[0197] The interaction between Adnectin 2 and IL-23 was quite large, burying 1320 .sup.2 on the Adnectin surface and 1370 .sup.2 on the IL-23 surface (
[0198] The principal interactions occurred through the FG (610 .sup.2) and BC (380 .sup.2) loops, but most segments of secondary structure had at least some surface area buried by the interaction (
Mutagenesis of Contact Residues of IL-23/Adnectin 2.
[0199] Four amino acids, Tyr28, Tyr73, Tyr81 and Pro87 were mutated to alanine to demonstrate that energetically important residues could be predicted. This proved to be the case for Tyr28, Tyr81, and Pro87 but not for Tyr73, which had little effect when mutated to alanine (Table 6). Tyr28 was located in the center of the BC loop and forms significant contacts with amino acids that were at the terminus of the IL-23 p 19 domain A-helix, e.g. edge-to-face interactions with Trp26 and His29. Similarly, Tyr81 which was located in the center of the FG loop had significant contacts with the IL-23 p40 subunit, e.g. Ser204. Pro87, which was located at the C-terminus of the FG loop, may be required for retaining the FG loop conformation and contacted residues Gly 100 and Pro 101 from the IL-23 p40 subunit. Although Tyr73 was predicted to contribute 6 kcal (Table 10) to the interaction, this was less than half that predicted for Tyr28 (16 kcal) and Tyr81 (13 kcal) (Table 10). In the minimized structure the Tyr73 side chain formed a hydrogen bond with IL-23 p40 subunit Lys99 carbonyl oxygen, but the Tyr73.fwdarw.Ala mutant showed that it was not a key energetic residue.
Interactions of Mutated Contact Residues in the IL-23/Adnectin 2Complex
[0200] Some mutations were made in an attempt to improve the affinity by specific interactions in the IL-23/Adnectin 2 complex. Four positions in ATI-000929, Thr 35, Val 45, Tyr 73, and Val 75, that were all on the same face of the -sandwich fold (-strands C, D, F, and G) of the Adnectin, were selected for mutagenesis in an attempt to improve the affinity through interactions with the p40 subunit (Table 6). Thr 35 and Val 45 were near each other and were mutated in an attempt to create an interaction with IL-23 p40 subunit Lys 99. At each position the same four mutations (asparagine, glutamine, aspartic acid, and glutamic acid) were made individually, in hopes of forming electrostatic interactions with Lys 99. The acidic residues were especially favored by modeling. However, no improvement in binding was seen at either position. The Thr 35.fwdarw.Asp mutant showed a significant decrease in binding. This may be due to unfavorable interactions that Asp 35 might have with the Adnectin Glu 49. Val 75 was mutated in an attempt to form a hydrogen bond with IL-23 p40 subunit Pro 101 carbonyl oxygen. No mutation of this residue altered binding. Tyr 73, as noted above, contacts IL-23 p40 subunit residues 99-101 as well as forming a hydrogen bond with the carbonyl oxygen of Lys 99. Modeling of Tyr 73 suggested that an arginine mutant could form an additional hydrogen bond with Glu 100 and increased contacts with IL-23 p40 subunit residues 99-101. Three mutations at this position had no effect, but Tyr 73.fwdarw.Gln led to a modest, 4-fold, increase in activity.
Comparison of the Structures of Adnectin 1 and Adnectin 2 with .sup.10Fn3.
[0201] Structural comparisons showed that the wildtype molecule (.sup.10Fn3; 1FNF residues 1416-1509) has a very similar topology to that of Adnectin 1 and Adnectin 2 when bound to their target molecules (
Crystallographic Data.
[0202] Space group, unit cell parameters and data collection statistics for both complexes are listed in Table 7. Initial electron density for the diversified loops, which were excluded from the molecular replacement model, is shown for the final model for both complexes in
TABLE-US-00006 TABLE 3 Comparison of Buried Surface Area, Contacts, and Surface Complementarity for .sup.10Fn3-based Domain Complexes Target Protein .sup.10Fn3-based Domain Type of Contacts PDB ID Protein Pair Area, .sup.2 # res # atom Area, .sup.2 # res # atom # H-bond # Salt Links # VDW Sc 2OCF ER 900 22 47 870 17 51 6 2 77 0.66 3CSB MBP 650 16 59 600 14 51 7 0 121 0.70 3CSG MBP 750 15 56 680 15 53 11 1 125 0.64 3K2M SH2 AD 570 16 47 580 10 48 11 2 105 0.72 BC 570 13 48 530 12 49 11 3 109 0.76 3QHT ySUMO AC 600 13 48 560 12 43 8 0 87 0.71 BD 610 12 46 570 13 35 9 0 74 0.67 3QWQ EGFR 585 14 39 520 13 41 8 0 75 0.71 3QWR IL-23 1370 38 97 1320 29 99 16 4 197 0.73 Proteins: ERestrogen receptor ; MBPmaltose binding protein; SH2Src homology 2 from Abelson kinase; ySUMOyeast small ubiquitin-related modifier Pairs: In cases of multiple complexes per asymmetric unit all are tabulated. The letters indicates chain names in the pairs. Area: calculated by the method of Connolly, 1983 and rounded to the nearest 10 .sup.2. # res, # atom: Number of residues and number of atoms in contact as calculated by the method of Sheriff et al., 1987a; Sheriff, 1993. # H-bond, # Salt Links, # VDW: Number of atom pairwise hydrogen bonds and van der Waals interactions as calculated by the method of Sheriff et al., 1987a; Sheriff, 1993. Number of salt links is tabulated on a per residue basis. Sc: Surface complementarity calculated by the method of Lawrence & Colman, 1993
TABLE-US-00007 TABLE 4 EGFR Alanine Scan Secondary Activity pEGFR IC.sub.50 Interaction Structural K.sub.D, (parent/ (parent/ Energy, Mutation Element nM mutant) mutant) kcal/mol Parent 1.8 1 1.sup. 0 D23.fwdarw.A BC loop 2.4 0.7 0.3 0 S24.fwdarw.A BC loop 1.3 1.4 0.7 0 G25.fwdarw.A BC loop 2.0 0.9 0.3 0 R26.fwdarw.A BC loop 2.0 0.9 0.8 0 G27.fwdarw.A BC loop 1.1 1.6 1.4 0 S28.fwdarw.A BC loop 1.5 1.2 0.5 0 Y29.fwdarw.A BC loop 14 0.1 0.02 0 Q30.fwdarw.A BC loop >50 <0.04 N.T. 3 Y31.fwdarw.A C strand N.D. N.T. 5 F48.fwdarw.A D strand 3.9 0.5 0.1 1 T49.fwdarw.A D strand 1.5 1.2 0.1 1 V50.fwdarw.A D strand 3.4 0.5 0.1 1 P51.fwdarw.A D strand 1.8 1 N.T. 3 G52.fwdarw.A DE loop 14 0.1 0.04 0 P53.fwdarw.A DE loop 2.8 0.6 0.3 1 V54.fwdarw.A DE loop 17 0.1 0.03 2 H55.fwdarw.A DE loop 3.0 0.6 0.6 0 D77.fwdarw.A FG loop N.D. N.D. 6 H78.fwdarw.A FG loop 5.5 0.3 0.1 2 K79.fwdarw.A FG loop 17 0.1 0.0 1 P79A.fwdarw.A FG loop 4.0 0.4 0.1 0 H79B.fwdarw.A FG loop 3.9 0.5 0.1 0 H79D.fwdarw.A FG loop 2.8 0.6 0.2 1 G79E.fwdarw.A FG loop 4.4 0.4 0.1 0 P80.fwdarw.A FG loop 4.2 0.4 0.1 0 H81.fwdarw.A FG loop 10 0.2 0.0 1 T82.fwdarw.A FG loop 6.1 0.3 0.1 0 Y83.fwdarw.A FG loop N.D. N.D. 0 H84.fwdarw.A FG loop 2.1 0.8 0.4 0 E85.fwdarw.A FG loop 4.9 0.4 0.05 0 N.D. not detected; N.T. not tested. pEGFR IC.sub.50 is the inhibitory concentration at which phosphorylation of EGFR is inhibited 50%. In the Interaction Energy column bold numbers indicate what are expected to be significant losses of interaction energy. See also Table 8.
TABLE-US-00008 TABLE 5 EGFR Mutants that Attempt to Improve Binding Secondary Activity pEGFR IC.sub.50 Interaction Structural K.sub.D, (parent/ (parent/ Energy, Mutation Element nM mutant) mutant) kcal/mol Parent 1.8 1 1.sup. Y31.fwdarw.F BC loop 2.0 0.9 N.T. 2 Y31.fwdarw.S BC loop 0.70 2.5 N.T. 5 Y31.fwdarw.L BC loop N.D. N.D. 2 E47.fwdarw.R D strand 0.83 2.1 N.T. 4 E47.fwdarw.K D strand 0.9 2.0 N.T. 6 E47.fwdarw.D D strand 0.78 2.3 N.T. 0 T49.fwdarw.I D strand 0.05 37 4.2 0 T49.fwdarw.V D strand 0.14 12 3.1 1 T49.fwdarw.Y D strand 0.21 8.4 1.0 3 P51.fwdarw.T D strand N.D. N.T. 1 P51.fwdarw.L D strand 1.5 1.2 N.T. 1 T58.fwdarw.Q E strand 2.2 0.8 0.3 0 T58.fwdarw.E E strand 1.3 1.3 0.7 9 T58.fwdarw.D E strand 1.1 1.7 1.4 7 A79C.fwdarw.L FG loop 4.0 0.4 N.T. 3 A79C.fwdarw.N FG loop 2.3 0.8 N.T. 4 A79C.fwdarw.Y FG loop 3.2 0.5 N.T. 8 A79C.fwdarw.R FG loop 4.3 0.4 N.T. 11 A79C.fwdarw.E FG loop 2.7 0.7 N.T. 8 N.D. not detected; N.T. not tested. pEGFR IC50 is the inhibitory concentration at which phosphorylation of EGFR is inhibited 50%. In the Interaction Energy column bold numbers indicate what are expected to be significant losses of interaction energy, and underline indicates what are expected to significant gains of interaction energy. See also Table 9.
TABLE-US-00009 TABLE 6 IL-23 IC.sub.50 Secondary Interaction Structural Activity Energy, Mutation Element IC.sub.50, nM (parent/mutant) kcal/mol Parent 1.0 1 Y28.fwdarw.A BC loop 13 0.08 10 Y73.fwdarw.A F strand 0.65 1.5 5 Y81.fwdarw.A FG loop 35 0.03 7 P87.fwdarw.A FG loop 8.3 0.1 2 T35.fwdarw.N C strand 1.7 0.6 0 T35.fwdarw.Q C strand 1.0 1 2 T35.fwdarw.E C strand 0.6 1.7 6 T35.fwdarw.D C strand 49 0.02 7 V45.fwdarw.N D strand 0.54 1.8 1 V45.fwdarw.Q D strand 0.34 2.9 0 V45.fwdarw.E D strand 0.51 1.9 6 V45.fwdarw.D D strand 0.83 1.2 6 Y73.fwdarw.N F strand 1.2 0.8 2 Y73.fwdarw.Q F strand 0.26 3.8 3 Y73.fwdarw.R F strand 1.2 0.8 2 V75.fwdarw.Y F strand 2.2 0.4 1 V75.fwdarw.Q F strand 2.3 0.4 0 V75.fwdarw.K F strand 5.7 0.2 1 In the Interaction Energy column bold numbers indicate what are expected to be significant losses of interaction energy, and underline indicates what are expected to significant gains of interaction energy. See also Table 10.
TABLE-US-00010 TABLE 7 Data collection and refinement statistics EGFR/Adnectin 1 IL-23/Adnectin 2 Data collection Space group P2.sub.12.sub.12.sub.1 I2.sub.12.sub.12.sub.1 Cell dimensions a, b, c () 68.0, 72.1, 262.0 77.7 , 91.7, 225.8 , , () 90, 90, 90 90, 90, 90 Resolution () .sup.50-2.75 (2.85-2.75) 42.47-3.25 (3.37-3.25) R.sub.sym 0.069 (0.552) 0.096 (0.320) I/I 23.1 (3.1) 7.6 (3.2) Completeness (%) 99.6 (100.0) 98.0 (99.5) Redundancy 4.8 (5.0) 4.0 (3.9) Refinement Resolution () 49.47-2.75 42.48-3.25 No. reflections 34,224 12,815 R.sub.work/R.sub.free 0.202/0.246 0.234/0.264 No. atoms 5610 4040 B-factors 65 101 Protein 63 101 Carbohydrate 100 115 Water 43 68 R.m.s. deviations Bond lengths () 0.010 0.010 Bond angles () 1.4 1.4 Ramachandran Plot Statistics.sup.a Most favored (%) 84.5 85.8 Additional allowed 13.7 11.3 (%) Disallowed (%) 0.8 1.1 One crystal was used for each complex. .sup.aAs defined by Laskowski et al., 1993.
TABLE-US-00011 TABLE 8 Energetic calculations for alanine scan of EGFR/Adnectin f complex (summarized in Table 4). Mutant Wild Type Mutation I.E. VDW ELE % B G I.E. VDW ELE % B G D23.fwdarw.A 0 0 0 0 0 0 0 0 0 0 S24.fwdarw.A 0 0 0 0 0 0 0 0 0 0 G25.fwdarw.A 0 0 0 0 0 0 0 0 0 0 R26.fwdarw.A 0 0 0 0 0 0 0 0 0 0 G27.fwdarw.A 0 0 0 0 0 0 0 0 0 0 S28.fwdarw.A 0 0 0 0 0 0 0 0 0 0 Y29.fwdarw.A 0 0 0 0 0 0 0 0 0 0 Q30.fwdarw.A 2.9 2.6 0.3 70 0.2 6.1 4.9 1.2 75 2.4 Y31.fwdarw.A 3.7 3.8 0.1 65 0.8 6.1 6 0.1 78 1.3 F48.fwdarw.A 1 1.2 0.2 36 0.6 1.9 2.2 0.3 55 0.5 T49.fwdarw.A 4 0.9 3.1 50 2.7 5.2 2.2 2.9 70 3.2 V50.fwdarw.A 2 1.9 0.1 43 0 3.1 3 0.1 99 0.7 P51.fwdarw.A 7.5 6.1 1.5 86 1.5 6.1 5.8 0.3 92 0.5 G52.fwdarw.A 0.4 0.3 0.1 0 0.4 0.3 0.2 0.1 0 1.8 P53.fwdarw.A 0.7 0.6 0.1 6 0.7 1.2 1.1 0.1 14 0 V54.fwdarw.A 1.3 1.6 0.3 60 1.3 3.3 3.5 0.2 95 0.3 H55.fwdarw.A 0 0 0 0 0 0 0 0 0 0 D77.fwdarw.A 4.7 3.3 1.3 87 1.3 10.3 3.8 6.5 96 7.2 H78.fwdarw.A 4 4.2 0.2 63 0.9 6 6.3 0.3 53 0.1 K79.fwdarw.A 1.2 0.7 0.5 93 0 2.1 2.4 0.3 28 1.7 P79A.fwdarw.A 2.5 2.6 0.1 27 0.6 2.4 2.7 0.3 27 0.6 H79B.fwdarw.A 1.8 1.8 15 0.2 1.9 2.2 0.3 7 0.7 H79D.fwdarw.A 0 0 0 0 0 1.3 0.1 1.2 0 2.4 G79E.fwdarw.A 0 0 0 0 0 0 0 0 0 0 P80.fwdarw.A 0 0 0 0 0 0 0 0 0 0 H81.fwdarw.A 0 0 0 0 0 1.5 1.6 0.1 19 0.8 T82.fwdarw.A 0 0 0 0 0 0.1 0.1 0 1.2 Y83.fwdarw.A 0 0 0 0 0 0.1 0.1 0 0 1.8 H84.fwdarw.A 0 0 0 0 0 0 0 0 0 0 E85.fwdarw.A 0 0 0 0 0 0 0 0 0 0 *Columns: I.E. = Interaction energy; VDW = Van der Waals interactions; ELE = electrostatic interactions; % B = % buried surface
TABLE-US-00012 TABLE 9 Energetic calculations for mutations to certain contact residues of EGFR/Adnectin 1 complex (Summarized in Table 5). Mutant Wild Type Mutation I.E. VDW ELE % B G I.E. VDW ELE % B G Y31.fwdarw.F 3.7 3.8 0.1 65 0.8 6.1 6 0.1 78 1.3 Y31.fwdarw.S 1.5 1.6 0.1 93 0.9 Y31.fwdarw.L 3.9 4 0.1 87 0.4 E47.fwdarw.R 5.2 1.7 3.5 55 4.3 1 0.5 0.5 8 2.2 E47.fwdarw.K 6.7 1.3 5.4 27 7 E47.fwdarw.D 0.8 0.4 0.4 17 1.6 T49.fwdarw.I 5.3 3.3 2 67 2.5 5.2 2.2 2.9 70 3.2 T49.fwdarw.V 4.3 2.3 2 60 2.2 T49.fwdarw.Y 5.3 3.3 2 67 2.5 P51.fwdarw.T 5.3 3.3 2 67 2.5 6.1 5.8 0.3 92 0.5 P51.fwdarw.A 4.3 2.3 2 60 2.2 P51.fwdarw.L 6.6 6.2 0.4 86 0.6 T58.fwdarw.Q 0.2 0.1 0.1 1 1.9 0.6 0.2 0.4 2 1.6 T58.fwdarw.E 9.7 1.1 8.6 38 9.8 T58.fwdarw.D 7.9 0.8 7.1 32 7.7 A79C.fwdarw.L 3.7 3.6 0.1 66 0.1 1.1 1.1 0 63 1 A79C.fwdarw.N 5 3.2 1.8 50 1.5 A79C.fwdarw.Y 9.7 8.8 0.9 77 1.3 A79C.fwdarw.R 12.3 7.6 4.7 81 2.5 A79C.fwdarw.E 9.2 6.7 2.5 77 1.4 *Columns: I.E. = Interaction energy; VDW = Van der Waals interactions; ELE = electrostatic interactions; % B = % buried surface
TABLE-US-00013 TABLE 10 Energetic calculations for contact residues of Adnectin 2/IL-23 complex (Summarized in Table 6). Mutant Wild Type Mutation I.E. VDW ELE % B G I.E. VDW ELE % B G Y28.fwdarw.A Y73.fwdarw.A Y81.fwdarw.A P87.fwdarw.A T35.fwdarw.N 0 0 0 11 1 0.8 0.6 0.2 25 0.5 T35.fwdarw.Q 3.2 1.8 1.4 77 2.7 T35.fwdarw.E 6.4 1 5.4 61 6.7 T35.fwdarw.D 7.5 0.5 7 78 8 V45.fwdarw.N 0.2 0.3 0.1 5 1.1 0.8 0.6 0.2 25 0.5 V45.fwdarw.Q 0.4 0.3 0.1 7 1.9 V45.fwdarw.E 7 0.9 6.1 42 7.3 V45.fwdarw.D 6.9 0.5 6.4 42 6.9 Y73.fwdarw.N 3.9 1.3 2.6 76 3.4 5.6 2.5 3.1 84 3.8 Y73.fwdarw.Q 2.8 0.6 2.2 60 3.4 Y73.fwdarw.R 7.6 4.7 2.9 75 4.1 V75.fwdarw.Y 1.3 1.1 0.2 20 1.8 0.7 0.7 0 28 0.6 V75.fwdarw.Q 1.1 0.7 0.4 24 2.1 V75.fwdarw.K 1.4 1.5 0.1 32 1.7 *Columns: I.E. = Interaction energy VDW = van der Waals interactions; ELE = electrostatic interactions; % B = % buried surface
Example 3: Solubility of Adnectin Mutants
Experimental Procedures:
[0203] EGFR #8 (SEQ ID NO:67), EGFR #8-T58E (SEQ ID NO:69), EGFR #8-T58D (SEQ ID NO:70), EGFR #4 (SEQ ID NO:68) and EGFR #4-T58E (SEQ ID NO:71) Adnectins were expressed and purified as described above in Examples 1 and 2. All proteins were dialyzed into 10 mM NaPO4, 130 mM NaCl (PBS) pH 7.1, and samples were confirmed to be >97% monomeric using analytical size exclusion chromatography on a Zenix-C SEC-300 column in buffer containing 200 mM K2HPO4, 150 mM NaCl, 10 pH 6.8, plus 0.02% Na azide, running at 0.35 mL/min.
[0204] Analysis of the thermal stability of EGFR #8, EGFR #8-T58E, EGFR #8-T58D, EGFR #4 and EGFR #4-T58E was conducted by differential scanning calorimetry (DSC) using a MicroCal Capillary DSC instrument. To stabilize the DSC instrument baseline and obtain a consistent thermal history, multiple scans of PBS pH 7.1 buffer alone in both the sample and reference cell were recorded prior to sample analysis. Sample scans contained 1.0 mg/ml Adnectin in the sample cell and matched PBS pH 7.1 buffer in the reference cell. All scans were run from 10-100 C. at a scan rate of 60/hr using a 15 minute pre-cycle thermostat period and no post-cycle thermostat period. Data were analyzed using MicroCal Origin analysis software.
[0205] Ammonium sulfate solubility experiments for the EGFR #4 Adnectins were performed using the automated assay method described in Example 1. Ammonium sulfate solubility experiments for the EGFR #8 proteins were performed using the benchscale method described in Example 1 which enabled titration to higher ammonium sulfate concentrations than the automated method.
[0206] Small scale ultrafiltration experiments for EGFR #8, EGFR #8-T58E and EGFR #8-T58D were performed by slowly concentrating the Adnectins at 2-8 C. in VivaSpin 3000 MWCO concentrators with periodic mixing to avoid gradient formation. Volumes were visually monitored during the concentration process to enable estimation of the expected sample concentration based on volume reduction, and aliquots were removed at various points for analysis. These aliquots were incubated overnight at 2-8 C., and any insoluble material was removed by centrifugation prior to determination of soluble protein concentration by A.sub.280, and oligomeric state by SEC using a Zenix-C SEC-300 column in buffer containing 200 mM K2HPO4, 150 mM NaCl, pH 6.8, plus 0.02% Na azide, running at 0.35 mL/min.
[0207] Initial small scale ultrafiltration experiments using EGFR #4 and EGFR #4-T58E performed at 2-8 C. were hindered by very slow rates of volume reduction. Therefore, EGFR #4 and EGFR #4-T58E were instead concentrated near room temperature (21 C.), where a faster rate of volume reduction was observed. Volumes were visually monitored during the concentration process to enable estimation of the expected sample concentration based on volume reduction, and aliquots were removed at various points for analysis. To follow up on the temperature dependent ultrafiltration rate observations, each aliquot was divided into two sister aliquots, with one set incubated overnight at 2-8 C. and the other set incubated overnight at room temperature. The following morning, insoluble material was removed by centrifugation and then the soluble protein concentration was determined by A.sub.280, and the oligomeric state characterized by SEC using a Zenix-C SEC-300 column in buffer containing 200 mM K2HPO4, 150 mM NaCl, pH 6.8, plus 0.02% Na azide, running at 0.35 mL/min.
[0208] Accelerated stability studies for EGFR #8, EGFR #8-T58E and EGFR #8-T58D were conducted by incubating 46 mg/ml samples of each Adnectin at 40 C. for two weeks. Aliquots were removed at time zero (immediately before initiation of the 40 C. incubation), and at time 1 week and 2 weeks. Aliquots were centrifuged to remove and insoluble material and then the soluble protein concentration was determined by A.sub.280, and the oligomeric state characterized by SEC using a Zenix-C SEC-300 column in buffer containing 200 mM K2HPO4, 150 mM NaCl, pH 6.8, plus 0.02% Na azide, running at 0.35 mL/min.
Results:
[0209] The initial ammonium sulfate solubility experiments with EGFR #8 (
[0210] The impact of the T58E and T58D mutations on the aggregation of EGFR #8 was next investigated using the ammonium sulfate solubility assay. Ammonium sulfate salting out curves generated using the larger scale preparations of purified Adnectin material confirmed that the solubility in ammonium sulfate was increased for each mutant compared to the wild type protein of EGFR #8 (
[0211] As an orthogonal measure of aggregation propensity to the AS method, we performed small scale ultrafiltration experiments using EGFR #8, EGFR #8-T58E and EGFR #8-T58D as described above. Each of the three Adnectins were found to have high solubility (>100 mg/ml) (
[0212] Because solubility differences between wild type EGFR #8 and EGFR #8-T58E were difficult to resolve in the ultrafiltration studies due to the high solubility of each molecule, we attempted to differentiate the aggregation propensity of the Adnectins using accelerated stability studies. Here, time zero (t0) samples of 46 mg/ml EGFR #8, EGFR #8-T58E and EGFR #8-T58D were prepared in PBS pH 7.1, and confirmed to be >98% monomer by SEC (
[0213] The data comparing the aggregation properties of EGFR #8 to EGFR #8-T58E (
[0214] Purified EGFR #4 and EGFR #4-T58E proteins were shown by SEC to be of suitable purity for biophysical studies, with more than 97% monomer for each sample (
[0215] Ammonium sulfate salting out curves for the large scale preparations of wild type EGFR #4 and EGFR #4-T58E show that the T58E mutation increases the solubility of the protein in AS, with ASm=0.8650.014 M for wild type EGFR #4, and ASm=1.0240.003 for EGFR #4-T58E (average and standard deviation of quadruplicate measurements), when tested at 0.3 mg/ml [protein] (
[0216] Small scale ultrafiltration studies were performed with EGFR #4 and EGFR #4-T58E to examine their aggregation propensity. Initial ultrafiltration studies performed at 2-8 C. were unsuccessful for both the wild type and mutant Adnectin due to very slow rates of volume reduction, suggesting possibly high aggregation propensity of each protein at these low temperatures. However, both Adnectins concentrated at considerably faster rates when the ultrafiltration study was conducted near room temperature (21 C.).
[0217] Therefore, to investigate this temperature-dependent phenomenon, samples were concentrated by ultrafiltration at room temperature and aliquots were stored at either 2-8 C. or at room temperature overnight. The next morning the insoluble material was removed by centrifugation (and 2-8 C. or room temperature respectively) and the soluble protein concentration was measured by A.sub.280, and the oligomeric state was characterized by SEC. The data for wild type EGFR #4 showed that the majority of the protein precipitated during 2-8 C. storage, such that the highest concentration of soluble EGFR #4 after overnight storage was 5.2 mg/ml (
[0218] The entire disclosure of each document cited herein (including patents, patent applications, journal articles, abstracts, laboratory manuals, books, GENBANK Accession numbers, SWISS-PROT Accession numbers, RCSB Protein Data Bank Accession numbers, or other disclosures) is hereby incorporated herein by reference in their entirety.
[0219] The present invention is not to be limited in scope by the embodiments disclosed herein, which are intended as single illustrations of individual aspects of the invention, and any that are functionally equivalent are within the scope of the invention. Various modifications to the models and methods of the invention, in addition to those described herein, will become apparent to those skilled in the art from the foregoing description and teachings, and are similarly intended to fall within the scope of the invention. Such modifications or other embodiments can be practiced without departing from the true scope and spirit of the invention.