Gut barrier dysfunction treatment and prevention
10933104 ยท 2021-03-02
Assignee
Inventors
Cpc classification
C07D211/92
CHEMISTRY; METALLURGY
A61K35/742
HUMAN NECESSITIES
Y02A90/10
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
G16H50/20
PHYSICS
C12Q1/025
CHEMISTRY; METALLURGY
International classification
G16H50/20
PHYSICS
C07D211/92
CHEMISTRY; METALLURGY
A61K35/742
HUMAN NECESSITIES
Abstract
Methods are disclosed for treating and preventing gut barrier dysfunction or an illness associated with gut barrier dysfunction in a subject comprising administering to the subject bacterium that produce an indole or an indole metabolite and for identifying compounds and bacteria for use in treatment and prevention of gut barrier dysfunction or an illness associated with gut barrier dysfunction.
Claims
1. A method of treating or preventing gut barrier dysfunction, an illness associated with gut barrier dysfunction, toxic or inflammatory injury to intestines, or leaky intestinal syndrome in a subject comprising administering to the subject a therapeutic effective amount of a bacterium, wherein the bacterium is Escherichia coli genetically engineered to constitutively express tryptophanase, wherein in the presence of tryptophan the bacterium produces indoleacetic acid from tryptophan, and wherein pregnane X receptor (PXR) is activated in apical intestinal epithelial cells, thereby decreasing intestinal permeability and inflammation.
2. The method of claim 1, wherein pregnane X receptor (PXR) is activated in gut apical enterocytes.
3. The method of claim 1, wherein the bacterium is administered orally to the subject.
4. The method of claim 3, further comprising orally administering tryptophan to the subject.
5. The method of claim 1, wherein the subject has irritable bowel syndrome, inflammatory bowel disease, intestinal allergic syndrome or celiac sprue.
6. The method of claim 1, wherein the bacterium colonizes the gut of the subject.
7. The method of claim 1, wherein indoleacetic produced by the bacterium induces target genes of PXR in intestinal mucosa in the subject, wherein the target genes are selected from the group consisting of Multi-drug resistant gene (Mdr 1), Cytochrome P450, family 3, subfamily a, polypeptide 11 (Cyp3a11) and Uridine diphosphate glucuronosyltransferase family 1 member a1 (Ugt1a1).
8. The method of claim 1, wherein indoleacetic produced by the bacterium reduces a mucosal myeloperoxidase enzyme activity in the subject.
9. The method of claim 1, wherein the subject is a human.
10. A method of treating or preventing gut barrier dysfunction, an illness associated with gut barrier dysfunction, toxic or inflammatory injury to intestines, or leaky intestinal syndrome in a subject comprising oral administration to the subject of a therapeutic effective amount of tryptophan and a bacterium, wherein the bacterium is Clostridium sporogenes comprising a tryptophanase operon, wherein in the presence of tryptophan, the tryptophanase operon is induced and the bacterium produces indole-3-propionic acid or indoleacetic acid from tryptophan, wherein pregnane X receptor (PXR) is activated in apical intestinal epithelial cells, thereby decreasing intestinal permeability and inflammation.
11. The method of claim 10, wherein pregnane X receptor (PXR) is activated in gut apical enterocytes.
12. The method of claim 10, wherein the subject has irritable bowel syndrome, inflammatory bowel disease, intestinal allergic syndrome or celiac sprue.
13. The method of claim 10, wherein the bacterium colonizes the gut of the subject.
14. The method of claim 10, wherein indoleacetic produced by the bacterium induces target genes of PXR in intestinal mucosa in the subject, wherein the target genes are selected from the group consisting of Multi-drug resistant gene (Mdr1), Cytochrome P450, family 3, subfamily a, polypeptide 11 (Cyp3a11) and Uridine diphosphate glucuronosyltransferase family 1 member al (Ugt1a1).
15. The method of claim 10, wherein indoleacetic produced by the bacterium reduces a mucosal myeloperoxidase enzyme activity in the subject.
16. The method of claim 10, wherein the subject is a human.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
DETAILED DESCRIPTION OF THE INVENTION
(16) The invention provides a method of treating or preventing gut barrier dysfunction or an illness associated with gut barrier dysfunction or toxic or inflammatory injury to intestines or leaky intestinal (gut) syndrome in a subject comprising administering to the subject bacterium that produce an indole or an indole metabolite.
(17) As used herein, treating or treat a condition means to alleviate or ameliorate or eliminate a sign or symptom of the condition that is being treated. Preventing or prevent a condition means that in a subject who is free of the condition, reducing the risk of the subject developing the condition or reducing the severity of the condition that the subject develops compared to the severity of the condition that would develop in the absence of administering to the subject bacterium that produce an indole or an indole metabolite.
(18) Preferably, the bacterium colonize the gut of the subject. Examples of bacterium that can be used include Clostridium sporogenes.
(19) Examples of indoles include indole-3-propionic acid and indoleacetic acid. Preferably, the indole activates the pregnane X receptor (PXR).
(20) The subject can have, for example, irritable bowel syndrome, inflammatory bowel disease, intestinal allergic syndrome or celiac sprue. The subject can be at risk for developing gut barrier dysfunction or an illness associated with gut barrier dysfunction due to, for example, exposure to a toxin, a medication, poor diet, an infection such as a parasite infection or a bacterial infection, dysbiosis, bacterial overgrowth, or long-term use of an antibiotic.
(21) In an embodiment, the bacterium is a recombinant bacterium genetically engineered to constitutively-express an indole-producing enzyme. In a preferred embodiment, the indole-producing enzyme is a tryptophanase. In a preferred embodiment, the tryptophanase is an E. Coli tryptophanase. In an embodiment, the bacterium is an E. coli. In an embodiment, the recombinant bacterium comprises a tnaC knockout. In an embodiment, the recombinant bacterium comprises a rut gene knockout. In an embodiment, the recombinant bacterium comprises a boxA mutation. In an embodiment, the boxA mutation comprises a deletion of the sequence CGC CCT in boxA.
(22) Preferably, the bacterium is administered orally to the subject. Bacteria can be cultured and reconstituted in common drinkables, e.g., yogurt as probiotic supplementation for conditions where, for example, there is a high risk for leaky gut, such as, e.g., irritable bowel syndrome, inflammatory bowel disease, intestinal allergic syndrome, celiac sprue, or prolonged antibiotic use.
(23) The subject can be any animal and is preferably a human.
(24) The invention also provides a probiotic oral supplement comprising a commensal bacterium that produces indole or an indole metabolite for treating or preventing gut barrier dysfunction or an illness associated with gut barrier dysfunction or toxic or inflammatory injury to intestines or leaky intestinal (gut) syndrome. Examples of such bacterium include Clostridium sporogenes. In an embodiment, the bacterium is a recombinant bacterium genetically engineered to constitutively-express an indole-producing enzyme. In a preferred embodiment, the indole-producing enzyme is a tryptophanase. In a preferred embodiment, the tryptophanase is an E. Coli tryptophanase. In an embodiment, the bacterium is an E. coli. In an embodiment, the recombinant bacterium comprises a tnaC knockout. In an embodiment, the recombinant bacterium comprises a rut gene knockout. In an embodiment, the recombinant bacterium comprises a boxA mutation. In an embodiment, the boxA mutation comprises a deletion of the sequence CGC CCT in boxA.
(25) The invention also provides a method of identifying a compound or a bacterium as a candidate for treating or preventing gut barrier dysfunction or an illness associated with gut barrier dysfunction or toxic or inflammatory injury to intestines or leaky intestinal (gut) syndrome comprising experimentally determining whether or not the compound activates pregnane X receptor (PXR) or the bacterium produces a compound that activates PXR, wherein a compound that activates PXR or a bacterium that produces a compound that activates PXR is a candidate for treating or preventing gut barrier dysfunction or an illness associated with gut barrier dysfunction or toxic or inflammatory injury to intestines or leaky intestinal (gut) syndrome and wherein a compound that does not activate PXR or a bacterium that does not produce a compound that activates PXR is not a candidate for treating or preventing gut barrier dysfunction or an illness associated with gut barrier dysfunction or toxic or inflammatory injury to intestines or leaky intestinal (gut) syndrome. As used herein, the step of determining requires an experimental determination that involves the use of a machine and/or involves a physical and/or chemical transformation.
(26) Methods for determining that a compound or compounds activate PXR include, for example, cell based assays (using transient or stable PXR expressing reporter systems), whole animal based assays in which there is either a functional (e.g., luciferase or GFP reporter), drug/compound kinetic (e.g., compound pharmacology suggesting PXR mediated metabolism), and/or genetic (e.g., PXR target gene assessments) or cell biology based (e.g., protein localization or binding) readout, biochemical (radio-ligand based assays, structural studies with protein-ligand complexes, thermal or chemical denaturation studies, electrophysiochemical approaches), and other assays that combine one or more of these components. The method can comprise transfecting a cell with nucleic acid that expresses PXR. Preferably, the cell is transfected with nucleic acid that expresses human PXR. A method comprising any study that uses PXR readout either biochemical or cell based, is appropriate to claim that a compound activates PXR.
(27) Human PXR has the amino acid sequence (SEQ ID NO:20, Accession: O75469.1 GI: 6093860)
(28) TABLE-US-00001 1 mevrpkeswnhadfvhcedtesvpgkpsvnadeevggpqicrvcgdkatgyhfnvmtceg 61 ckgffrramkrnarlrcpfrkgaceitrktrrqcqacrlrkclesgmkkemimsdeavee 121 rralikrkksertgtqplgvqglteeqrmmirelmdaqmktfdttfshfknfrlpgvlss 181 gcelpeslqapsreeaakwsqvrkdlcslkvslqlrgedgsvwnykppadsggkeifsll 241 phmadmstymfkgiisfakvisyfrdlpiedgisllkgaafelcqlrfntvfnaetgtwe 301 cgrlsycledtaggfqqlllepmlkfhymlkklqlheeeyvlmqaislfspdrpgvlqhr 361 vvdqlqeqfaitlksyiecnrpqpahrflflkimamltelrsinaqhtqrllriqdihpf 421 atplmqelfgitgs.
(29) Examples of cell lines can be used include Caco-2, LS174T, 293T, HepG2, SKOV-3 and LS174T cells.
(30) An in vitro transcription assay is described herein. As described in U.S. Patent Application Publication No. US 2011/0105522, published May 5, 2011, the contents of which are incorporated herein by reference, PXR activation has been shown to induce PXR target genes in SKOV-3 ovarian cancer cells. Gene expression can be evaluated using quantitative RT-PCR. In addition, PXR activation induces SKOV-3 cell proliferation in vitro and in vivo. PXR activation also induces multi-drug resistance in SKOV-3 cells. PXR activation in LS174T cells induces cell proliferation. In addition, pregnane X receptor activation has been shown to induce FGF19-dependent tumor aggressiveness in humans and mice (49).
(31) The compound being evaluated can be, for example, an indole derivative, an indole analog or an indole metabolite. The compound can be, for example, a metabolite, bacterial product or food substance that is derived from tryptophan or from an indole base. The bacterium can produce indole or an indole metabolite.
(32) The inventions also provides a method of determining whether or not a subject has intestinal inflammation, the method comprising experimentally determining the levels of indole-3-propionic acid (IPA) and tryptophan from a sample from the subject, and calculating the ratio of levels of indole-3-propionic acid (IPA)/tryptophan, wherein a low ratio is indicative of intestinal inflammation in the subject and a high ratio is indicative of no intestinal inflammation in the subject. The sample can be, for example, a blood sample or a stool sample. The ratio of levels of indole-3-propionic acid (IPA)/tryptophan serves as an indicator or biomarker for intestinal inflammation. In one embodiment, an IPA/tryptophan ratio less than 1 indicates intestinal inflammation in the subject. In one embodiment, an IPA/tryptophan ratio greater than 1 indicates no intestinal inflammation in the subject.
(33) Methods to determine tryptophan and tryptophan metabolites, particularly indoles and IPA, include, for example, chromatographic separation assays, liquid or solid chromatography, fluorescence, mass spectrometry and/or a combination of these methods.
(34) This invention will be better understood from the Experimental Details that follow. However, one skilled in the art will readily appreciate that the specific methods and results discussed are merely illustrative of the invention as described more fully in the claims that follow thereafter.
EXPERIMENTAL DETAILS
Example A
(35) Introduction
(36) To test the hypothesis that elements of the host environment, including symbiotic bacteria, regulate gut barrier function through the pregnane x receptor (PXR), the functions of indole metabolites (e.g., indole-3-propionic acid (IPA)), which are exclusively produced by gut commensal microbes (6) were explored. In mice, IPA synthesis appears linked to the gut commensal Clostridium sporogenes (6). In humans under homeostatic conditions, blood IPA and indole concentrations remain in micromolar and millimolar range, respectively, with gut concentrations predicted to be much higher (7, 8).
Example 1
(37) Materials and Methods
(38) Cell Lines, Human Tissue Samples and Reagents.
(39) The human colon cancer cell lines (Caco-2 and LS174T) and 293T cells were obtained from the American Type Culture Collection (ATCC) and cultured according to ATCC recommendations. DMSO, indole, IPA, I3 S, IAA, FITC-dextran, indomethacin, and LPS were obtained from Sigma Aldrich; DSS from MP Biomedicals; Hematoxylin and Eosin stain from Poly Scientific; BrdU from Becton Dickinson, anti-CD3 antibody from BD biosciences; KDO.sub.2 from Avanti Polar Lipids Inc. TLR2 inhibitory antibody from eBioscience (14-9024-82) and TLR4 inhibitor from Invivogen. For immunoblotting, antibodies used are as indicated: TLR4 (Santa Cruz, sc-16240), alkaline phosphatase (Santa Cruz, sc-30203), -actin (Abcam, ab8227), p-p38-MAPK (Cell Signaling, 9215), p38-MAPK (Cell Signaling, 9212), p-ERK (Santa Cruz, sc-7383), ERK (Santa Cruz, sc-93), p-JNK (Cell Signaling, 9251), JNK (Cell Signaling, 9252), p-IB- (Cell Signaling, 9246), IKB- (Cell signaling, 9242). Antibodies used for immunostaining are mentioned in appropriate section. For TLR4 transcription assay, 293T cells were co-transfected with PXR expression plasmid, PU.1 expression plasmid and TLR4 promoter luciferase construct (kindly provided by Dr. Michael Rehli of University Hospital Regensburg, Regensburg, Germany).
(40) Mice.
(41) All animal experiments were approved by the animal institute committee (protocol #20070715, 20100711) of the Albert Einstein College of Medicine and were performed in accordance with institutional and national guidelines. Pxr.sup.+/+ wild-type C57BL/6 mice (6-8 week old) were purchased from Jackson laboratory. Swiss Webster (SW, control) and Swiss Webster Germfree (SWGF) mice (7-8 weeks old, female) were purchased from Taconic (Hudson, N.Y.). Pxr.sup./ and humanized PXR transgenic mice (hPXR) mice were kindly provided by Dr. Jeff Staudinger (University of Kansas) and Dr. Wen Xie (University of Pittsburgh), respectively. Pxr.sup./ mice were crossed with Tlr4.sup./ mice (purchased from Jackson laboratory, stock no. 007227) to generate Pxr.sup.17 Tlr4.sup./ double knockout mice. All mice were sex and age matched within experiments, and maintained under a strict 12 hour light/dark cycle with free access to sterilized chow and water.
(42) Genotyping.
(43) Mouse tail DNAs were used for genotyping according to manufacturer's instructions (DNeasy Blood and Tissue kit, Qiagen). The primers used for Pxr genotyping were:
(44) TABLE-US-00002 Forwardprimer: (SEQIDNO:1) 5-CTGGTCATCACTGTTGCTGTACCA-3; Reverseprimer1: (SEQIDNO:2) 5-GCAGCATAGGACAAGTTATTCTAGAG-3; Reverseprimer2: (SEQIDNO:3) 5-CTAAAGCGCATGCTCCAGACTGC-3. ThefollowingprimerswereusedforTlr4geno- typing: Forwardprimer(wild-type): (SEQIDNO:4) 5-ATATGCATGATCAACACCACAG-3; Reverseprimer(wild-type): (SEQIDNO:5) 5-TTTCCATTGCTGCCCTATAG-3; Forwardprimer(knockout): (SEQIDNO:6) 5-GCAAGTTTCTATATGCATTCTC-3; Reverseprimer(knockout): (SEQIDNO:7) 5-CCTCCATTTCCAATAGGTAG-3.
For Pxr genotyping the following PCR conditions were used: 94 C. for 3 minutes, and then each cycle at 94 C. for 30 seconds, 60 C. for 1 minute, 72 C. for 1 minute, repeated for 38 cycles. The final cycle extension time was 2 minutes. PCR conditions used for Tlr4 genotyping were similar to Pxr genotyping except the annealing temperature, which was set at 55 C. for 1 minute. PCR products were subsequently run on 1% agarose gel for visualization. Genotyping for Pxr.sup./ and hPXR mice were performed as previously published (29, 30).
(45) Histology and Immunofluorescence Analysis.
(46) Intestinal tissue sections (paraffin and frozen) were prepared and Hematoxylin-Eosin staining were performed in the Histology core facility of Albert Einstein College of Medicine. Histological scoring was performed according to previously published methods (31). Briefly, Hematoxylin-Eosin stained sections were evaluated in a blinded fashion by a trained pathologist at Albert Einstein College of Medicine and quantified in the following manner: 0=normal bowel, 1=epithelial loss confined to villus tip, 2=epithelial detachment from underlying lamina propria, 3=epithelial detachment involving less than half of the villus and 4=epithelial detachment involving more than half of the villus and/or fluid accumulation. For immunofluorescence studies, cryostat intestinal sections of 5 m thickness were fixed (4% paraformaldehyde in PBS, pH 7.4) and blocked in buffer containing 5% goat serum, 1% BSA and 0.1% Triton X-100 in PBS. Sections were then incubated with primary and secondary antibodies overnight at 4 C. and for 2 h at room temperature, respectively. The following primary antibodies were used for immunofluorescence analysis: Zo-1 (1:100, Zymed, 40-2300) and E-cadherin (1:100, BD biolabs, 610182). Secondary antibodies, conjugated to Alexa Fluor 488, were obtained from Molecular Probes. Microscopy was performed in the Analytical Imaging Facility of Albert Einstein College of Medicine with Biorad Radiance 2000 Laser Scanning Confocal Microscope. Image acquisition was performed using Zeiss Laserscan 2000 software and image processing was performed with NIH ImageJ software.
(47) Isolation of Gut Apical Enterocytes.
(48) The Weiser method was used to isolate pure apical villus enterocytes from the jejunum in all mice experiments as previously published (32). Enterocytes isolated were subsequently pooled for down-stream experiments.
(49) In Vitro Transcription Assay.
(50) These assays were performed in 293T cells as previously published (33). In brief, transient transfection by lipofectamine (Invitrogen) were carried out in 293T cells with plasmids expressing human PXR (hPXR), mouse PXR (mPXR), GAL4-FXR, GAL4-LXR, GAL4-PPAR and mouse CAR (mCAR) with respective reporter plasmids (Tk-MRP2-luciferase, Tk-MH100-luciferase, CYP2B10-luciferase) and Renilla. For TLR4 promoter luciferase transcription assay, TLR4 promoter reporter construct (a gift from Dr. Michael Rehli of University of Regensburg, Germany) was transfected along with human PXR, mouse PU.1 expression plasmids and Renilla. 5 h after transfection, indole/IPA/I3 S/IAA, receptor agonists (rifampicin, hPXR ligand, 20 M; chenodeoxycholic acid, FXR ligand, 50 M; T0901315, LXR ligand, 5 M; rosiglitazone, PPAR ligand, 10 M; TCPOBOP, mCAR ligand, 0.2 M) was added to the media and incubated for a total period of 48 h. The cells were harvested in passive lysis buffer (Promega) and luciferase activity was detected using the dualluciferase reporter assay system from Promega in 20 l of cell lysate using the Turner Biosystems 20/20n Luminometer. Assays were performed at least two independent times each in triplicates.
(51) Time Resolved Fluorescence Resonance Energy Transfer (TR-FRET) Assay.
(52) A LanthaScreen TR-FRET PXR Competitive Binding Assay was conducted according to the manufacturer's protocol (Invitrogen) as previously published (14). Briefly, serial dilutions of indole 3-propionic acid (diluted in TR-FRET PXR Assay Buffer, Invitrogen) were dispensed into triplicate wells of a black, non-treated 384 well plate (Corning Life Sciences). Subsequently, 5 l of Fluormone PXR Green was added into each well. Finally, 5 l of a master mix containing hPXR ligand binding domain (LBD), terbium labeled anti-glutathione S transferase (final concentration 10 nM) and dithiothreitol (final concentration 0.05 mM) was added into each well. For mPXR ligand binding domain, GST tagged mPXR LBD was purified using Glutathione Sepharose 4 Fast Flow beads (GE Health Care) in Poly-Prep Chromatography columns (Bio-Rad). hPXR LBD of the assay kit was replaced with the similar concentrations of mPXR LBD. The content was mixed briefly (10 s) and incubated in dark at room temperature for 1 h. TR-FRET was measured using SpectraMaxR M5 microplate reader (Molecular Devices) with the excitation wavelength of 340 nm and emission wavelengths of 520 and 495 nm. TR-FRET ratio was calculated by dividing the emission signal at 520 nm by emission signal at 495 nm. Data are expressed as percentage TR-FRET ratio. Error bars represent s.e.m of duplicate wells from two separate experiments. The curve was fit to data (% TR-FRET vs. log IPA concentration) using a sigmoidal dose response (variable slope) equation in GraphPad Software.
(53) Oral Dosing of IPA.
(54) Pxr.sup.+/+ and Pxr.sup./ mice were gavaged with 10, 20 and 40 mg/kg IPA, dissolved in sterile PBS (pH 7.4) in 100 l volume per mice for four consecutive days. SW and SWGF mice were orally gavaged with 20 mg/kg IPA for four consecutive days.
(55) Ex Vivo Treatment of Gut Apical Enterocytes with OLA.
(56) Freshly isolated gut mucosa were incubated in the presence of OLA (5 mg/ml) for 3 h at 37 C., 5% CO2 (13). After 3 h of OLA treatment, enterocytes were isolated and pooled for RNA isolation. For rescue experiments, gut mucosa were incubated in the presence of indole (1 mM), IPA (1 M) and OLA (5 mg/ml) for 3 h duration and subsequently enterocytes were isolated and pooled for RNA isolation. The short duration of exposure (3 h) required to minimize tissue degradation ex vivo necessitated use of supraphysiological concentrations of IPA. Experiments were performed at least two independent times. OLA has excellent drug-like properties with high predicted oral bioavailability (log P), thus is unsuitable for in vivo studies of luminal bacterial enzyme inhibition (Pubchem, ST093573).
(57) Transmission Electron Microscopy.
(58) Jejunum from mice were removed and 1 mm thick tissue slices were placed in ice cold 4% paraformaldehyde in 0.1 M phosphate buffer, pH 7.4, for 3 h with continuous shaking, after which slices were rinsed in cold phosphate buffer. These sections were post-fixed in 1% osmium tetraoxide and embedded in epon (Polysciences). Ultrathin 50 nm sections were prepared with LKB ultramicrotome, stained with lead citrate, and examined under a Philips 300 electron microscope (FEI Co.). Twelve identical sections (mid jejunum) from each mouse strain were analyzed for TEM and seven out of twelve sections showed defective tight junctions in Pxr.sup./ mice, while none were observed in Pxr.sup.+/+ mice. For quantitation of average microvillus length, microvilli from all twelve sections were counted.
(59) Enzyme Activity Assay.
(60) Apical enterocytes isolated from mouse jejunum were pooled and subsequently lysed with RIPA lysis buffer and diluted in 0.1 M carbonate-bicarbonate buffer, pH 10.0. Differentially diluted enterocyte homogenate were exposed to p-Nitrophenyl Phosphate (pNPP) Liquid Substrate System (Sigma). Spectrophotometric quantitation (O.D. 405 nm) of p-nitrophenol (hydrolyzed product of pNPP), was used to measure alkaline phosphatase activity as previously published (34). Disaccharidase activity of pooled jejunal apical enterocytes was assessed using modified glucose oxidase peroxidase enzyme system as previously published (35). In brief, the assay was done in 96-well microtiter plates and to each well 10 l appropriately diluted enterocyte homogenate and 10 l substrate buffer solution of a disaccharidase were added. The plates were incubated at 37 C. in humidified atmosphere for 1 h. After incubation, 300 l of tris-glucose oxidase (TGO) reagent was added to each well and the plates were incubated further for 1 h. The plates were subsequently read at O.D. 414 nm using a microplate reader (SpectraMaxR M5, Molecular Devices). For each assay, eight reagent blanks (20 l distilled water and 300 l TGO reagent) and glucose standard series (0.01, 0.1, 0.5, 1, 2, 4, 8 and 10 g glucose) were performed. To assay Dipeptidyl Peptidase IV enzyme (DPPIV) activity, pooled jejunal apical enterocyte homogenate (differentially diluted) were used as enzyme source. The enzyme activity was measured with glycylproline p-nitroanilide (GP-pNA, Santa Cruz Biotechnology, Catalog #sc-201156) as a substrate. Spectrophotometric quantitation at O.D. 405 nm was analyzed to measure DPPIV enzyme activity as previously published (36). Experiments were performed at least two independent times each in triplicates.
(61) Tissue Myeloperoxidase (MPO) Activity Assay.
(62) Neutrophil infiltration in tissues was quantified by measuring MPO activity in pooled jejunum enterocyte homogenates as described previously (37). In brief, 50 mg of freshly isolated jejunum enterocytes were pooled and subsequently homogenized in 50 mM phosphate buffer and 0.5% hexadecyltrimethyl-ammonium bromide buffer (Sigma). The mixture was subjected to three cycles of freeze-thawing, followed by sonication for 20 seconds and centrifugation at full speed for 30 minutes. MPO activity was measured by incubating the supernatants with 20 mg/ml 0-dianisidine hydrochloride (Sigma) and 20 mM hydrogen peroxide. The reaction was terminated by adding 2% sodium azide. Optical density was read at 450 nm. Experiments were performed at least two independent times each in triplicates and are expressed as units per gram of tissue.
(63) In Vivo Gut Permeability Assay.
(64) Age and sex-matched mice were orally administered with 0.6 mg/g body weight of an 80 mg/ml solution of FITC-dextran (FD4, Sigma). 5 h later, retro-orbital blood was collected from each mouse. Serum was prepared by allowing the blood to clot by leaving it undisturbed overnight at 4 C. and then subsequently centrifuged at 3000 rpm for 20 minutes. Dilutions of FITC-dextran in PBS were used as a standard curve. Absorption of 50 l serum was measured at microplate reader with excitation and emission filters set at 490 and 530 nm, respectively (38). Experiments were performed at least two independent times each in triplicates.
(65) In Vivo Bacterial Translocation Assay.
(66) pNEI-EGFP was transformed into E. coli JM 109 competent cells (Stratagene) and high-expression E. coli-EGFP clones were selected by fluorescence microscopy. Mice were gavaged with once daily dose of 1 ml E. coli-EGFP suspension (11011 cells/ml) for 3 consecutive days. 1 h after last feed, mice were sacrificed and jejunum harvested for fluorescence microscopy. Mice were fed with sterile drinking water containing ampicillin (300 mg/L) for 3 days prior to bacterial infection to facilitate the transformed E. coli to colonize their enteric lumen (39, 40).
(67) Real-Time Quantitative RT-PCR.
(68) 2.0 g of total RNA extracted from pooled apical enterocytes with TRIzolR (Invitrogen), were reverse transcribed with random hexamer primers and SuperScript III-RT enzyme (Invitrogen). Quantitative PCR (qPCR) reactions using TaqMan universal PCR master mix and TaqMan probes containing FAM as the 5 reporter fluorochrome and tetramethylrhodamine (MGB) as the 3 quencher fluorochrome, were performed in triplicate for each sample and analyzed on the ABI Prism 7900HT system. Primers and minor groove binder/non-fluorescent quencher probes used for PCR amplification were obtained from Applied Biosystems as well as the following assays on demand: Mm00500910_m1 (Occludin), Mm00493695_g1 (Zo-1), Mm01247357_m1 (E-cadherin), Mm00516703_s1 (Claudin-2), Mm00516817_m1 (Claudin-7), Mm00439616_m1 (Il-10), Mm01178819_m1 (Tgf-), mB-Def3 (8-Defensin 3), mCryptdin4 (Cryptdin), Mm00458299_m1 (Mucin 2), Mm01612741_m1 (Lysozyme), Mm00438285_m1 (Cathelicidin), Mm00443258_m1 (Tnf-), Mm01210733_m1 (Il-6), Mm99999071_m1 (Ifn-), Mm00441889_m1 (Tnfr-2), Mm00446095_m1 (Tlr1), Mm00442346_m1 (Tlr2), Mm00628112_m1 (Tlr3), Mm00445273_m1 (Tlr4), Mm00546288_s1 (Tlr5), Mm02529782_s1 (Tlr6), Mm00446590_m1 (Tlr7), Mm01157262_m1 (Tlr8), Mm00446193_m1 (Tlr9), Mm01701924_s1 (Tlr11), Mm00440732_g1 (Mdr-1), Mm99999915_g1 (Gapdh), Hs00152937_m1 (human TLR4), Hs01114265_g1 (human PXR), Hs02511055_s1 (UGT1A1), Hs00184500_m1 (hMDR-1), Hs00604506_m1 (CYP3A4) and Hu ACTB (-actin). Controls include RT-minus RNA samples. PCR reaction conditions for all assays were set at 50 C. for 2 minutes, 95 C. for 10 minutes, followed by 40 cycles of amplification (95 C. for 15 seconds then 60 C. for 1 minute). Experiments were performed at least two independent times each in triplicates.
(69) Immunoblot.
(70) Freshly isolated jejunum apical enterocytes were pooled and subsequently lysed in RIPA lysis buffer containing 50 mM Tris (pH 7.5), 1% NP-40, 0.5% sodium deoxycholate, 0.05% SDS, 1 mM EDTA, 150 mM sodium chloride, protease inhibitors (Roche) and phosphates inhibitors (Sigma). 100 g total lysates were heated to 95 C. for 5 minutes in 5SDS sample buffer and loaded on 10% SDS-PAGE. Proteins were transferred to Nitrocellulose membranes (Bio-Rad laboratories). Membranes were stripped in western stripping buffer (Pierce) and reprobed sequentially with corresponding antibodies. Experiments were repeated at least two independent times each with three different exposure times.
(71) Tandem Mass Spectrometry (LC/MS/MS).
(72) IPA concentrations were analyzed in pooled plasma, intestinal tissue and feces by extraction and LC/MS/MS methods as previously published (14). In brief, samples were analyzed by ESCi multi-mode ionization (Waters TQ Tandem Quadrupole Mass Spec, Waters Corp.). The best ionization was achieved by positive ion electrospray. The MS/MS detection was developed and optimized using IntelliStart software. To demonstrate sensitivity, a linear calibration curve was created by serial dilutions of the stock standard (1-1000 ng/ml) in mouse plasma (data not shown, r2=99.909110-2). The lower limit of quantitation (LLQ) for this assay is 5 picogram on the column with a signal to noise (S/N) ratio of 168.00. Tissue concentrations were established by normalizing to total protein content (NanoDrop 1000 Spectrophotometer, Thermo Scientific) in cleared lysates (membrane-free) injected into columns.
(73) Molecular Docking Studies.
(74) Three dimensional structure of mPXR was modeled using the hPXR co-crystalized with hyperforin (PDB code: 1m13) as a template to the homology modeling program Modeller version 9.0 (41, 42). The resulting three dimensional structure was further refined via 1000 steps of conjugate gradient based energy minimization using Amber (version 9.0), with Amber charges as adopted in the Molecular Operating Environment (MOE) program (version 10; Chemical Computing Group, Montreal, Quebec, Canada). The binding site for mPXR was derived from hPXR-hyperforin complex and has been well characterized based on structural information derived from the variety of ligands that it binds to. Three dimensional models of IPA and indole were created using the Builder module of MOE and the structures were optimized using AM1 potentials. IPA structure was also subjected to stochastic conformational search adopted in MOE. The resulting conformations were clustered and a representative member from the highly populated, low energy ranking cluster was chosen for docking studies. To adequately sample this promiscuous binding site 50 independent docking runs were performed for each ligand and in combination to hPXR and mPXR using the GOLD program (Genetic Optimisation for Ligand Docking) (version 4.1) (43). The docked complexes were scored using Goldscore, Chemscore and a customizable scoring scheme that was previously designed to classify activators and non-activators of PXR (44-46). The best ranking complexes were then energy minimized using Amber force field adopted in MOE program.
(75) In Vivo Toxic Gut Injury Models.
(76) For indomethacin induced mouse jejunitis model, a protocol published by Ettarh and Carr was modified by using a single intraperitoneal dose of indomethacin to reduce the toxicity in Pxr.sup./ mice (17). In brief, mice were injected a single dose of indomethacin (85 mg/kg body weight) intraperitoneally and 48 h later mice were sacrificed and tissues harvested. For anti-CD3 antibody induced gut inflammation model, a previously published protocol (18) was followed. Briefly, mice were injected intraperitoneally with 200 anti-CD3 antibody (clone 2C11, BD biosciences) in 200 l of PBS. 3 h later, mice were sacrificed and jejunum sections were carefully removed and tied at both ends with same length sutures. Weights of individual jejunum sections were measured for quantitation of enteropooling (intestinal weight/length in mg/cm). In the intestinal FR injury model, a previously published protocol (19) was followed. Briefly, mice were gavaged with 0.6 mg/g body weight of an 80 mg/ml solution of FITC-dextran (FD4, Sigma) and 15 minutes later anaesthetized by pentobarbital (50 mg/kg intraperitoneally). A laparotomy was performed, followed by occlusion of superior mesenteric artery with a microvascular clamp (BRI, Inc. Catalog #34-2805). After 20 minutes of ischemia, the clamp was removed and incision closed. Mice were allowed to recover from anesthesia and serum collected retro-orbitally following 3 h of reperfusion. In the low dose endotoxic shock model, mice were initially sensitized with an intraperitoneal injection of 40 mg D-galactosamine (Sigma) administered 15 minutes before an intravenous injection of 50 ng of E. coli ultra pure O111:B4 lipopolysaccharide (LPS) (Sigma) (20). A protocol was developed for gut mucosal endotoxemia model, where 200 g of highly potent LPS substitute KDO2-lipid A (Catalog #699500P; Avanti Polar Lipids, Inc.) were delivered via sterile injection directly into mice jejunum. These mice were already pre-gavaged with 200 l of 10% sodiumbicarbonate 15 minutes earlier to decrease gastric acidity. 24 h after the injection, mice undergo FITC-dextran gavage, mRNA expression analysis and necropsy studies.
(77) Bone Marrow Transplantation.
(78) Mice (6-8 week) receiving bone marrow transplantation were irradiated (600 RAD) on the morning of transplantation and 4-6 hours later, immediately before transplantation. Bone marrow were harvested from femurs and tibias of 6 week old Pxr.sup.+/+ or Pxr.sup./ mice with RPMI (10% Fetal Calf Serum), and cell suspensions were washed and diluted to a concentration of 30106 cells/ml in HBSS. 7.5106 cells/250_l were injected intravenously into the lateral tail veins of the recipient mice. Transplanted mice were placed on antibiotic water (0.7 mM neomycin sulfate, 80 mM sulfamethaxazole and 0.37 mM trimethoprim) for 2 weeks after irradiation, and then given autoclaved water to reconstitute normal gut flora. Mice were kept for 6 weeks to ensure full engraftment and maturation of the immune system before experiments (47).
(79) BrdU and TUNEL Staining.
(80) Mice were injected with 1 mg bromodeoxyuridine (BrdU, Becton Dickinson) in 500 l PBS. Small gut was harvested after 24 h and paraffin embedded tissues was stained with anti-BrdU antibody (Calbiochem, JA1599). TUNEL staining in paraffin embedded small gut sections was performed in the Histology core facility of Albert Einstein College of Medicine.
(81) TLR2 and 4 Inhibition Experiments.
(82) Freshly isolated jejunum apical enterocytes were incubated in the presence of TLR2 inhibitory antibody (50 g/ml, eBioscience, 14-9024-82) and TLR4 inhibitor (100 g/ml, Invivogen, lps-rs) for 3 h at 37 C., 5% CO2. After incubation, enterocytes were isolated and pooled for RNA isolation. Experiments were repeated at least twice.
(83) Lenti-Based shRNA Knock-Down Systems.
(84) For PXR shRNA lentiviral plasmid design and construction, a protocol published by Sun et al. (48) was used. Details of the procedure can be found in a recent publication (49).
(85) Actinomycin D Chase Experiment.
(86) LS174T cells were plated into 6 well tissue culture dishes and treated with rifampicin for 48 h. After rifampicin treatment, 20 g/ml of Actinomycin D, dissolved in DMSO was added in each well and RNA isolated at different time points starting at t=0 after Actinomycin D exposure. RNA was subsequently used for reverse transcription and real-time qPCR analysis.
(87) RNA Immunoprecipitation Assay.
(88) 293T cells, transfected with PXR expression vector and TLR4 3UTR construct, were formaldehyde (1%) cross-linked prior to lysis. Cell lysates was prepared in RIPA buffer containing protease inhibitor and RNasin (Promega, catalog #N251A). Cell lysates were sonicated for three cycles (20 seconds each, amplitude 7, duty cycle 70%, output 8-9W). Pre-clearing steps by incubating cell lysates with protein A-agarose beads were performed to minimize non-specific binding. Pre-cleared cell lysates was incubated with antibody coated beads (protein A-agarose incubated with 10 g each of PXR and IgG antibody for 2 h at 4 C.) subsequently at 4 C. overnight. Next morning, beads were washed five times in RIPA buffer containing RNasin and resuspended in resuspension buffer (50 mM Tris-HCl, 5 mM EDTA, 10 mM DTT and 1% SDS) at 70 C. for 45 min to reverse the cross-link. RNA was extracted from the beads with TRIzol Reagent, ethanol-precipitated, and resuspended in 20 l RNase-free water. RNA solution prepared was further treated with TURBO DNase (Invitrogen, catalog #AM2238) to get rid of any contaminating DNA. This RNA solution was used for semiquantitative PCR.
(89) Isolation of Nuclei and Nuclear Run-on Assay.
(90) These assays were performed according to the methods previously published with minor modifications to allow for small scale RNA synthesis (50). For nuclear isolation, LS174T cells cultured in 10 cm dishes were digested with 5 ml volume of 0.25% trypsin/0.1% EDTA. The cells were centrifuged at 500 g for 10 min. The cells were resuspended in Buffer 1 (containing 10 mM Tris-HCl, pH 7.4/150 mM KCl/8 mM magnesium acetate) and centrifuged at 500 g for 10 min. Pellets were then resuspended and lysed in Buffer 1 with addition of 0.5% Nonidet P-40 on ice for 5 min. The lysates were set onto Buffer 2, which contained 100 mM Tris-HCl, 5 mM MgCl2 and 600 mM sucrose, and centrifuged at 500 g for 10 min. The pellets (nuclei) were then resuspended in Buffer 3 containing 40% glycerol, 50 mM Tris-HCl, 5 mM MCl2 and 0.1 mM EDTA. Nuclei were immediately stored at 80 C. in Buffer 3, until nuclear run-on transcription assay. For nuclear run-on assay, identical number of LS174T nuclei was used for preparation of nascent transcripts. To perform the nuclear run-on transcription, 5106 nuclei were incubated in a reaction buffer (5 mM Tris-HCl, pH 8.0, 2.5 Mm MgCl2, 150 mM KCl, 1.0 mM each of ATP, GTP, CTP) and 0.5 mM biotin-16-UTP at 30 C. for 45 min in a final volume of 25 l. The reaction was stopped by the addition of 60 U RNase-free DNase and incubated further for 10 min at 37 C. The nuclei were then lysed by the addition of lysis buffer containing 10 Mm Tris-HCl, 1% SDS, 5 mM EDTA. The reaction mixtures were treated with 20 l of proteinase K (10 mg/ml). RNA was extracted with TRIzol Reagent, ethanol-precipitated, and resuspended in 50 l RNase-free water. Biotinylated RNA was purified by adding streptavidin beads, followed by 2 h incubation at 25 C. on a shaker. Beads were separated by centrifugation at 2,000 rpm for 5 min, and washed once with 2SSC-15% formamide for 10 min and twice with 2SSC alone for 5 min. Finally, beads were resuspended in 30 l DEPC treated water. The biotinylated RNA solution was used for reverse-transcriptase cDNA synthesis and further real-time qPCR for the quantitative mRNA assay.
(91) Chromatin Immunoprecipitation (ChIP) Assay.
(92) A fast ChIP method was used as previously published (51). In fast ChIP method, LS174T cells were cross-linked with formaldehyde, following which the cells were lysed and fractions containing nuclear pellets isolated and chromatin sheared. The sheared chromatin samples were subsequently incubated with respective antibodies in an ultrasonic bath, followed by centrifugation to obtain pre-cleared samples. Precleared samples were then mixed with protein A agarose beads. After several washes, Chelex 100 suspension was added to the beads, the suspension boiled and tubes were allowed to cool. After shaking and repeated boiling, the centrifuged samples were analyzed for PCR-ready DNA. A 30 cycle PCR was used to detect interaction. The input reflects 0.5% of total lysate after sonication. Immunoprecipitation controls included H.sub.2O (water) and non-specific IgG (same class as PXR antibody). The primers used for PXR binding site within the TLR4 promoter were as follows.
(93) For proximal binding site (amplicon size is 320 bp):
(94) TABLE-US-00003 Forward: (SEQIDNO:8) 5-CAGTCTCTTCCCAGATGC-3 and Reverse: (SEQIDNO:9) 5-GTGAGGGACCATTTTGTG-3.
For distal binding site (amplicon size is 381 bp):
(95) TABLE-US-00004 Forward: (SEQIDNO:10) 5-GGACTGGTAATGGGTGTC-3 and Reverse: (SEQIDNO:11) 5-CCATCCAACCATCTCAAG-3.
The positive control in this assay was PXR binding site within the CYP3A4 promoter (ER3 elements 188 bp amplicon):
(96) TABLE-US-00005 Forward: (SEQIDNO:12) 5-GAGGTGTCACTGCCATCTTCAT-3 and Reverse: (SEQIDNO:13) 5-GAGGCTGCTTACTCTGGGTTTT-3.
(97) TLR4 3UTR Luciferase Construct.
(98) TLR4 mRNA 3UTR region was PCR amplified with the following primers:
(99) TABLE-US-00006 forward: (SEQIDNO:14) 5-GATCTCTAGAAAGAAGGAACAGTGGGTAC-3 and reverse: (SEQIDNO:15) 5-GATCTCTAGAACTTTCCCAGGTTTCATGG-3.
For TLR4 3 UTR luciferase reporters, PCR products were digested with Xba I restriction enzyme (New England Biolabs) and cloned into Xba I site, downstream of luciferase reporter of pGL4.13 vector. Luciferase assay was performed similar to the transcription assays as previously mentioned.
(100) Statistical Analysis.
(101) Data are shown as meanss.e.m. The significance of difference was analyzed by two-tailed Student's t-test or ANOVA with post-hoc Bonferroni test. The Kaplan-Meier method was used for survival and differences was analyzed by the log rank test. All analyses were performed using GraphPad PRISM version 5.03 (GraphPad Software). P<0.05 was considered statistically significant.
(102) Results and Discussion
(103) To simulate in vivo homeostatic conditions, PXR transcription assays were conducted using a combination of indole with its respective metabolites. While IPA alone is a weak human PXR (hPXR) agonist (EC.sub.50 120 M, Emax 6.38 fold over control); IPA [including indoxyl sulphate (I3 S), indole acetic acid (IAA)] in combination with indole significantly activates hPXR (
(104) The effect of indoles on enterocyte inflammatory signals and barrier function was examined in an in vivo model of 3-deoxy-D-manno-octulosonic acid (KDO2)-lipid A intubation, which elicits inflammatory signals without disrupting the intestinal tissue architecture (see Methods). Because TNF- plays a critical role in barrier dysfunction, it was used as marker of gut barrier dysfunction (11). There was no overt histologic evidence of inflammation; however, TNF-, MAPK phosphorylation and permeability to FITC-dextran were clearly induced after KDO2 treatment (
(105) Indoles are produced in the gut from L-tryptophan by the action of bacterial tryptophanase enzyme (6). IPA repletion in germ free mice decreased gut permeability to FITC-dextran (
(106) To study the function of PXR under steady-state conditions, detailed histological analysis was performed using 6-8 week old Pxr.sup./ and Pxr.sup.+/+ mouse intestines. While gross features appeared unchanged, histological examination of the mucosa of Pxr.sup./ mice small intestines showed significant diminution of the villus-crypt ratio, marked neutrophil infiltration and increased myeloperoxidase (MPO) enzyme activity (
(107) Notably, the ultra-structural defects observed in Pxr/ mice are not due to any gross changes in proliferation or apoptosis of the epithelium. Experiments with bone marrow chimeras between Pxr/ and Pxr+/+ mice show that immune reconstitution with either Pxr+/+ or Pxr/ hematopoietic cells have no effect on pro-inflammatory markers and intestinal permeability to FITC-dextran (
(108) Toll-like receptors (TLRs) were next focused on since they are critical regulators of intestinal barrier function as well as inflammation (23). Real-time qPCR was performed for all ten mammalian (mouse) TLRs. Tlr over-expression was modest (1.2 to 1.8 fold) and variable; however, downstream TLR pathway kinase activation was enhanced in Pxr.sup./ mice (
(109) TLR4 was focused on next because it is a critical determinant of LPS signaling in the gut (24-26). The basal expression of TLR4 protein was modestly elevated (1.8 fold) in Pxr.sup./ mice. An inverse relationship between PXR and TLR4 mRNA expressions was observed (
(110) Since these markers encode for proteins involved in epithelial junctional complex formation and inflammation, TLR4 may indeed be responsible for the barrier dysfunction observed in Pxr.sup./ mice. To validate this hypothesis, it was assessed whether the magnitude of Tnf- mRNA expression and FITC-dextran permeability was Tlr4 gene-dose dependent. Tlr4 heterozygotes (at least 50% reduction in protein) were generated in Pxr.sup./ mice background (
(111) An inverse relationship between PXR and TLR4 was previously observed and furthermore, a decrease in TLR4 expression secondary to PXR activation was also observed (
(112) The present data implicate epithelial PXR as a central regulator of TLR4 mediated control of the gut barrier function. This regulation is intrinsically associated with gut commensals, specifically those involved with the metabolism of tryptophan with production of indoles and specific metabolites. It was hypothesized that this association is tightly regulated to ensure fine-tuning of TLR4 expression in the gut at levels appropriate to the abundance of LPS and perhaps other microbial-derived ligands. For homeostasis, all three components of this system (indole secreting gut commensals, epithelial PXR expression, and TLR4) must be at appropriate levels for a given host a lack of IPA or PXR or an excess of TLR4 can lead to gut barrier dysfunction. In fact, compromised gut barrier function has been implicated in the pathogenesis of several disease states (e.g., type I diabetes, asthma, autism, acne, allergies etc.) including IBD (5). Hence, search for effective treatment options to prevent gut epithelial barrier defects may have broader implications beyond IBD. Moreover, the data in epithelial cells complement parallel nuclear receptor driven pathways in gut immune cells that regulate barrier function (27, 28). Thus, taken together, these observations provide important chemical biology steps toward a more comprehensive understanding of gut barrier function.
(113) TABLE-US-00007 TABLE 1 Summary of scores for IPA and indole docked either individually or concurrently to hPXR and mPXR structures. IPA Indole Organism Indole +Indole IPA +IPA hPXR 40.81 54.63 36.08 56.00 mPXR 43.82 61.21 42.93 62.23
Example 2
(114) Tryptophanase is a multifunctional enzyme found exclusively in bacteria. This enzyme is responsible for beta-elimination of a catabolite, tryptophan, to form indoles, which then serve as substrates for further modifications in certain bacteria (e.g., IPA in C. sporogenes, IAA in E. coli, and other species) (Proc Natl Acad Sci USA. 2009 Mar. 10; 106(10):3698-703; Microbiology 2006 August; 152(Pt 8):2421-3; hereby incorporated by reference in its entirety). The Tna operon contains two genes: promoter proximal gene, tnaA, encodes tryptophanase, while tnaB, is required for low-affinity tryptophan permease activity. The Tna E. coli operon is induced by tryptophan and is subject to catabolite repression (e.g., cAMP and other catabolites). Thus, developing constitutively-expressing strains will eliminate variability of expression due to human diet (from catabolites). One strategy is to start with E. coli and reproducing the isolation of TnaC (this removes tryptophan-induced antitermination) (J Bacteriol 164, 731-740, 1985; hereby incorporated by reference in its entirety). For example, E. coli K-12 can be used with ethyl methanesulfonate and 2-aminopurine mutagenesis as described by Miller (Experiments in Molecular Genetics. Cold Spring Harbor Laboratory, NY 19725; hereby incorporated by reference in its entirety). However, gene knockout strategies by homologous recombination are now a simpler route (e.g. see www.sigmaaldrich.com/life-science/molecular-biology/molecular-biology-products.html?TablePage=17058681) within the TnaC as well as the distal rut gene (J Bacteriol 172, 3100-3107, 1990) both of which will give constitutive expression of the operon. Mutations of the boxA and the rut site are also encompassed and readily achievable. (See also Rho-Dependent Transcription Termination in the tna Operon of Escherichia coli: Roles of the boxA Sequence and the rut Site, 182 J. Bacteriol. 3981-88 (2000); hereby incorporated by reference in its entirety).
Example 3
(115) C. sporogenes, which Makes Indoles and IPA, Protects Against Indomethacin Induced Intestinal Injury by Activating PXR.
(116) For validation of ex vivo experiments demonstrating IPA effects on junctional regulators, C. sporogenes was co-administered to germ-free mice in the presence or absence of L-tryptophan (
(117) IPA is not a AhR Receptor (Related to PXR) Agonist.
(118) The combination of indole and IPA also activated other orphan nuclear receptors that play a role in intestinal barrier protection (e.g., farnesoid x receptor), suggesting a crucial role of indoles in maintaining intestinal barrier function involving multiple nuclear receptors (10). However, hPXR activation was greater in comparison to other nuclear receptors tested. More importantly, as specific indoles have been shown to activate the aryl hydrocarbon receptor (AhR) (63), no activation was observed of AhR by IPA.
REFERENCES
(119) 1. A. Kaser, S. Zeissig, R. S. Blumberg, Annu Rev Immunol 28, 573 (2010). 2. J. R. Turner, Nat Rev Immunol 9, 799 (2009). 3. A. Krack, R. Sharma, H. R. Figulla, S. D. Anker, Eur Heart J 26, 2368 (2005). 4. O. Vaarala, Curr Opin Gastroenterol 24, 701 (2008). 5. Z. Liu, N. Li, J. Neu, Acta Paediatr 94, 386 (2005). 6. W. R. Wikoff et al., Proc Nall Acad Sci USA 106, 3698 (2009). 7. J. P. Danaceau, G. M. Anderson, W. M. McMahon, D. J. Crouch, J Anal Toxicol 27, 440 (2003). 8. T. Bansal, R. C. Alaniz, T. K. Wood, A. Jayaraman, Proc Natl Acad Sci USA 107, 228 (2010). 9. Z. Zhu et al., J Biomol Screen 9, 533 (2004). 10. T. Inagaki et al., Proc Nall Acad Sci USA 103, 3920 (2006). 11. F. Wang et al., Gastroenterology 131, 1153 (2006). 12. P. D. Martino, R. Fursy, L. Bret, B. Sundararaju, R. S. Phillips, Can J Microbiol 49, 443 (2003). 13. R. S. Phillips, E. W. Miles, L. A. Cohen, Biochemistry 23, 6228 (1984). 14. M. Venkatesh et al., Mol Pharmacol 80, 124 (2011). 15. Y. M. Shah, X. Ma, K. Morimura, I. Kim, F. J. Gonzalez, Am J Physiol Gastrointest Liver Physiol 292, G1114 (2007). 16. C. Zhou et al., J Clin Invest 116, 2280 (2006). 17. R. R. Ettarh, K. E. Carr, J Anat 189 (Pt 1), 51 (1996). 18. D. R. Clayburgh et al., J Clin Invest 115, 2702 (2005). 19. H. Zhao, M. C. Montalto, K. J. Pfeiffer, L. Hao, G. L. Stahl, J Appl Physiol 93, 338 (2002). 20. T. Roger et al., Proc Natl Acad Sci USA 106, 2348 (2009). 21. Y. Ohtsuka, I. R. Sanderson, Pediatr Res 53, 143 (2003). 22. C. M. Van Itallie, J. M. Anderson, Annu Rev Physiol 68, 403 (2006). 23. M. Asquith, F. Powrie, J Exp Med 207, 1573 (2010). 24. E. Cario, Inflamm Bowel Dis 16, 1583 (2010). 25. M. M. Fort et al., J Immunol 174, 6416 (2005). 26. M. T. Abreu et al., J Immunol 167, 1609 (2001). 27. E. A. Kiss et al., Science 334, 1561 (2011). 28. J. S. Lee et al., Nat Immunol 13, 144 (2011). 29. J. L. Staudinger et al., Proc Natl Acad Sci USA 98, 3369 (2001). 30. W. Xie et al., Nature 406, 435 (2000). 31. T. Asano et al., J Pharmacol Exp Ther 330, 458 (2009). 32. M. M. Weiser, J Biol Chem 248, 2542 (1973). 33. H. Huang et al., Oncogene 26, 258 (Jan. 11, 2007). 34. R. F. Goldberg et al., Proc Natl Acad Sci USA 105, 3551 (2008). 35. A. Dahlqvist, Anal Biochem 7, 18 (1964). 36. T. Nagatsu, M. Hino, H. Fuyamada, T. Hayakawa, S. Sakakibara, Anal Biochem 74, 466 (1976). 37. L. A. Pfister et al., Ann Neurol 47, 329 (2000). 38. A. Kaser et al., Cell 134, 743 (2008). 39. M. Zhao et al., Proc Natl Acad Sci USA 98, 9814 (2001). 40. D. Song et al., Curr Microbiol 52, 69 (2006). 41. R. E. Watkins et al., Biochemistry 42, 1430 (2003). 42. A. Sali, T. L. Blundell, J Mol Biol 234, 779 (1993). 43. G. Jones, P. Willett, R. C. Glen, A. R. Leach, R. Taylor, J Mol Blot 267, 727 (1997). 44. S. Kortagere et al., Environ Health Perspect 118, 1412 (2010). 45. S. Ekins et al., PLoS Comput Biol 5, e1000594 (2009). 46. S. Kortagere, D. Chekmarev, W. J. Welsh, S. Ekins, Pharm Res 26, 1001 (2009). 47. T. S. Olson et al., J Exp Med 203, 541 (2006). 48. D. Sun, M. Melegari, S. Sridhar, C. E. Rogler, L. Zhu, Biotechniques 41, 59 (2006). 49. H. Wang et al., J Clin Invest 121, 3220 (2011). 50. M. X. Zhang et al., Proc Natl Acad Sci USA 102, 16967 (2005). 51. J. D. Nelson, O. Denisenko, K. Bomsztyk, Nat Protoc 1, 179 (2006). 52. Chawla, A., Repa, J. J., Evans, R. M., and Mangelsdorf, D. J. (2001) Nuclear receptors and lipid physiology: opening the X-files. Science 294, 1866-70. 53. Gronemeyer, H., Gustafsson, J. A., and Laudet, V. (2004) Principles for modulation of the nuclear receptor superfamily. Nat Rev Drug Discov 3, 950-64. 54. Mangelsdorf, D. J., and Evans, R. M. (1995) The RXR heterodimers and orphan receptors. Cell 83, 841-50. 55. Mangelsdorf, D. J., Thummel, C., Beato, M., Herrlich, P., Schutz, G., Umesono, K., Blumberg, B., Kastner, P., Mark, M., Chambon, P., and et al. (1995) The nuclear receptor superfamily: the second decade. Cell 83, 835-9. 56. Ingraham, H. A., and Redinbo, M. R. (2005) Orphan nuclear receptors adopted by crystallography. Curr Opin Struct Biol 15, 708-15. 57. McDonnell, D. P., Connor, C. E., Wijayaratne, A., Chang, C. Y., and Norris, J. D. (2002) Definition of the molecular and cellular mechanisms underlying the tissue-selective agonist/antagonist activities of selective estrogen receptor modulators. Recent Prog Horm Res 57, 295-316. 58. Shiau, A. K., Barstad, D., Loria, P. M., Cheng, L., Kushner, P. J., Agard, D. A., and Greene, G. L. (1998) The structural basis of estrogen receptor/coactivator recognition and the antagonism of this interaction by tamoxifen. Cell 95, 927-937. 59. Kliewer, S. A., Moore, J. T., Wade, L., Staudinger, J. L., Watson, M. A., Jones, S. A., McKee, D. D., Oliver, B. B., Willson, T. M., Zetterstrom, R. H., Perlmann, T., and Lehmann, J. M. (1998) An orphan nuclear receptor activated by pregnanes defines a novel steroid signaling pathway. Cell 92, 73-82. 60. Fayard, E., Auwerx, J., and Schoonjans, K. (2004) LRH-1: an orphan nuclear receptor involved in development, metabolism and steroidogenesis. Trends Cell Biol 14, 250-60. 61. Bertilsson, G., Heidrich, J., Svensson, K., Asman, M., Jendeberg, L., Sydow-Backman, M., Ohlsson, R., Postlind, H., Blomquist, P., and Berkenstam, A. (1998) Identification of a human nuclear receptor defines a new signaling pathway for CYP3A induction. Proceedings of the National Academy of Sciences of the United States of America 95, 12208-13. 62. Mani S, Huang H, Sundarababu S, et al. Activation of the steroid and xenobiotic receptor (human pregnane X receptor) by nontaxane microtubule-stabilizing agents. Clin Cancer Res. 2005 Sep. 1; 11(17):6359-69. 63. Denison M S, Nagy S R. Activation of the aryl hydrocarbon receptor by structurally diverse exogenous and endogenous chemicals. Annual review of pharmacology and toxicology, 43: 309-334. (2003).
Example B
(120) Symbiotic Bacterial Metabolites Regulate Gastrointestinal Barrier Function Via the Xenobiotic Sensor PXR and Toll-Like Receptor 4
(121) Example B was published by inventors Sridhar Mani and Subhajit Mukherjee and colleagues as Venkatesh, M. et al., Symbiotic Bacterial Metabolites Regulate Gastrointestinal Barrier Function via the Xenobiotic Sensor PXR and Toll-like Receptor 4, Immunity 41: 296-310, Aug. 21, 2014, Epub 2014 Jul. 24, a copy of which is submitted in connection with this application.
(122) The results illustrate that microbial specific indoles regulate intestinal barrier function through the xenobiotic sensor, pregnane X receptor (PXR). Indole 3-propionic acid (IPA), in the context of indole, serves as a ligand for PXR in vivo and down-regulates enterocyte TNF- while up-regulating junctional protein-coding mRNAs. PXR null (Pxr.sup./) mice exhibit a distinctly leaky gut physiology coupled with up-regulation of the Toll-like receptor (TLR) signaling pathway. These defects in the epithelial barrier are corrected in Pxr.sup.//Tlr4.sup./ double-knockout mice. The results demonstrate that a direct chemical communication between the intestinal symbionts and PXR regulates mucosal integrity through a pathway that involves luminal sensing and signaling by TLR4.
Example C
(123) Model for Regulation of Gut Barrier Function by IPA
(124) Indole is exclusively produced by intestinal bacteria. Upon the availability of L-tryptophan, the repressed tryptophanase operon (trp ABCDE) and tna operon (tnaCAB), are induced. In the absence of L-tryptophan, the expression of the trp operon is elevated, whereas the expression of the tna operon consisting of TnaC (24 aa leader peptide, TnaL), TnaA (tryptophanase; EC4.1.99.1), and TnaB (permease) is repressed due to transcription-termination factor (Rho)-dependent termination at the tna operon. Thus, when tryptophan content is low, TnaA and TnaB are low, and indole concentrations are low. However, when tryptophan concentrations increase in the media, (Rho)-dependent transcriptional termination is no longer present, there is accumulation of TnaC-peptidyl-tRNA.sup.Pro (the C-terminal peptide is proline) accumulation, increase in TnaA and TnaB, so indole concentrations rise (E. coli pathway) (1-3). In addition, permeases (Mtr, TnaB, and AroP) have specific roles in tryptophan transport: it is clear that Mtr is the major importer of indoles, while TnaB (critical permease), Mtr and AroP participate in tryptophan import. The later permeases, AcrE and AcrF are also involved in export of indoles. Thus, indoles generated in one species can cross cell membrane boundaries of permissive cells and participate in interkingdom signaling. A recent review paper discuss the type of bacteria and species that encode the tnaA gene and its ramifications (1). There is also a significant influence of the environment, other than the availability of L-tryptophan on TnaA expression (e.g., cell density, high pH, low glucose availability) (3). The indoles have been implicated in interkingdom signaling among bacteria. Its role is central in regulating (inhibiting) biofilm formation, motility, chemotaxis, and cell adherence (notably all these functions are altered in pathophysiologic states such as inflammatory bowel disease, perhaps signifying loss of indole-mediated homeostasis). Other effects of indoles include regulation (enhancement) of plasmid stability, virulence and drug resistance. Indoles might be putative quorum-sensing molecules although this has yet to be proven.
(125) Additional direct evidence that tryptophan metabolism is altered in inflammatory bowel disease (IBD) come from the observation that L-tryptophan supplementation of mice exposed to inflammatory toxins (DSS, TNBS) ameliorates inflammatory indices in the intestines (4,5). Colitic mice have reduced indole metabolites (6). In humans, urinary excretion of tryptophan is increased, resulting in low serum tryptophan levels; this is further buttressed by enhanced Indoleamine 2,3-dioxygenase (IDO) expression in inflamed enterocytes and rapid tryptophan catabolism in the intestines, resulting in low serum tryptophan but also markedly increased serum kyneurine:tryptophan ratio (5, 7-15) and end metabolites (16). However, fecal tryptophan content is elevated suggesting a block in microbial tryptophan metabolism (17). Similar results have been found in mice with radiation-mediated intestinal damage, in that, serum indole and indole metabolites (IPA) are inversely correlated with the extent of intestinal inflammation (18-19). The observation that IPA is inversely related to systemic inflammation in overweight individuals (20) as well as the reversal of IPA levels (increased) upon administration of anti-inflammatory dietary interventions to humans (21) adds further proof of the importance of IPA in inflammation. Additionally, environmental factors, beyond availability of tryptophan influence the coding of TnaA. For example, it has been demonstrated that the intestinal intraluminal pH in patients with IBD and rodent model systems is low (22-24). Since high pH induces TnaA, low intraluminal pH in IBD likely represses TnaA expression, thus shutting off indole production regardless of the availability of tryptophan. While bacterial cell density induces TnaA, and that the mean density of mucosal biofilms is 2-fold higher in patients with IBD than normal controls, specific microbiota producing indoles may be attenuated by the inflammatory process, reducing diversity and microbial (indole)-specific biofilm density (25). Finally, diets high in refined sugar have been associated with IBD susceptibility (26); high glucose represses TnaA expression, suggesting loss of indoles in IBD (3).
(126) Thus, based on available evidence, ipa to tryptophan ratios can serve as a biomarker for intestinal inflammatory states, where, e.g., ipa/trp<1 indicates inflammation and ipa/trp>1 indicates homeostasis.
References for Example C
(127) 1. Lee J H, Lee J. Indole as an intercellular signal in microbial communities. FEMS microbiology reviews. 2010; 34(4):426-44. 2. Gong F, Ito K, Nakamura Y, Yanofsky C. The mechanism of tryptophan induction of tryptophanase operon expression: tryptophan inhibits release factor-mediated cleavage of TnaC-peptidyl-tRNA(Pro). Proceedings of the National Academy of Sciences of the United States of America. 2001; 98(16):8997-9001. 3. Han T H, Lee J H, Cho M H, Wood T K, Lee J. Environmental factors affecting indole production in Escherichia coli. Research in microbiology. 2011; 162(2):108-16. 4. Kim C J, Kovacs-Nolan J A, Yang C, Archbold T, Fan M Z, Mine Y. 1-Tryptophan exhibits therapeutic function in a porcine model of dextran sodium sulfate (DSS)-induced colitis. The Journal of nutritional biochemistry. 2010; 21(6):468-75. 5. Shizuma T, Mori H, Fukuyama N. Protective effect of tryptophan against dextran sulfate sodium-induced experimental colitis. The Turkish journal of gastroenterology: the official journal of Turkish Society of Gastroenterology. 2013; 24(1):30-5. 6. Shiomi Y, Nishiumi S, Ooi M, Hatano N, Shinohara M, Yoshie T, et al. GCMS-based metabolomic study in mice with colitis induced by dextran sulfate sodium. Inflamm Bowel Dis. 2011; 17(11):2261-74. 7. Barcelo-Batllori S, Andre M, Servis C, Levy N, Takikawa O, Michetti P, et al. Proteomic analysis of cytokine induced proteins in human intestinal epithelial cells: implications for inflammatory bowel diseases. Proteomics. 2002; 2(5):551-60. 8. Beeken W L. Serum tryptophan in Crohn's disease. Scand J Gastroenterol. 1976; 11(7): 735-40. 9. Cherayil B J. Indoleamine 2,3-dioxygenase in intestinal immunity and inflammation. Inflamm Bowel Dis. 2009; 15(9):1391-6. 10. Ferdinande L, Demetter P, Perez-Novo C, Waeytens A, Taildeman J, Rottiers I, et al. Inflamed intestinal mucosa features a specific epithelial expression pattern of indoleamine 2,3-dioxygenase. International journal of immunopathology and pharmacology. 2008; 21(2):289-95. 11. Lin H M, Barnett M P, Roy N C, Joyce N I, Zhu S, Armstrong K, et al. Metabolomic analysis identifies inflammatory and noninflammatory metabolic effects of genetic modification in a mouse model of Crohn's disease. Journal of proteome research. 2010; 9(4):1965-75. 12. Lin H M, Edmunds S I, Helsby N A, Ferguson L R, Rowan D D. Nontargeted urinary metabolite profiling of a mouse model of Crohn's disease. Journal of proteome research. 2009; 8(4):2045-57. 13. Minderhoud I M, Oldenburg B, Schipper M E, ter Linde J J, Samsom M. Serotonin synthesis and uptake in symptomatic patients with Crohn's disease in remission. Clinical gastroenterology and hepatology: the official clinical practice journal of the American Gastroenterological Association. 2007; 5(6):714-20. 14. Tones M I, Lopez-Casado M A, Lorite P, Rios A. Tryptophan metabolism and indoleamine 2,3-dioxygenase expression in coeliac disease. Clinical and experimental immunology. 2007; 148(3):419-24. 15. Wolf A M, Wolf D, Rumpold H, Moschen A R, Kaser A, Obrist P, et al. Overexpression of indoleamine 2,3-dioxygenase in human inflammatory bowel disease. Clinical immunology (Orlando, Fla.). 2004; 113(1):47-55. 16. Yau Y Y, Leong R W, Shin S, Bustamante S, Pickford R, Hejazi L, et al. Bimodal plasma metabolomics strategy identifies novel inflammatory metabolites in inflammatory bowel diseases. Discovery medicine. 2014; 18(98):113-24. 17. Jansson J, Willing B, Lucio M, Fekete A, Dicksved J, Halfvarson J, et al. Metabolomics reveals metabolic biomarkers of Crohn's disease. PloS one. 2009; 4(7):e6386. 18. P O B, Vaitheesvaran B, Saha S, Hartil K, Chen E I, Goldman D, et al. Intestinal microbiota-derived metabolomic blood plasma markers for prior radiation injury. International journal of radiation oncology, biology, physics. 2015; 91(2):360-7. 19. De Preter V, Machiels K, Joossens M, Arijs I, Matthys C, Vermeire S, et al. Faecal metabolite profiling identifies medium-chain fatty acids as discriminating compounds in IBD. Gut. 2014. 20. Bakker G C, van Erk M J, Pellis L, Wopereis S, Rubingh C M, Cnubben N H, et al. An antiinflammatory dietary mix modulates inflammation and oxidative and metabolic stress in overweight men: a nutrigenomics approach. The American journal of clinical nutrition. 2010; 91(4): 1044-59. 21. Bouwman J, Vogels J T, Wopereis S, Rubingh C M, Bijlsma S, Ommen B. Visualization and identification of health space, based on personalized molecular phenotype and treatment response to relevant underlying biological processes. BMC medical genomics. 2012; 5:1. 22. Nugent S, Kumar D, Rampton D, Evans D. Intestinal luminal pH in inflammatory bowel disease: possible determinants and implications for therapy with aminosalicylates and other drugs. Gut. 2001; 48(4):571-7. 23. Vernia P, Caprilli R Fau-Latella G, Latella G Fau-Barbetti F, Barbetti F Fau-Magliocca F M, Magliocca Fm Fau-Cittadini M, Cittadini M. Fecal lactate and ulcerative colitis. (0016-5085 (Print)). 24. Tchaptchet S, Fan T-J, Goeser L, Schoenborn A, Gulati A S, Sartor R B, et al. Inflammation-Induced Acid Tolerance Genes gadAB in Luminal Commensal Escherichia coli Attenuate Experimental Colitis. Infection and Immunity. 2013; 81(10):3662-71. 25. Li J, Butcher J, Mack D, Stintzi A. Functional impacts of the intestinal microbiome in the pathogenesis of inflammatory bowel disease. Inflamm Bowel Dis. 2015; 21(1):139-53. 26. Dixon L J, Kabi A Fau-Nickerson K P, Nickerson Kp Fau-McDonald C, McDonald C. Combinatorial Effects of Diet and Genetics on Inflammatory Bowel Disease Pathogenesis. (1536-4844 (Electronic)).