Antibodies Against Infectious Diseases
20210079072 ยท 2021-03-18
Inventors
- Sy-Jye LEU (Taipei City, CN)
- Yi-Yuan YANG (Taipei City, CN)
- Yu-Ching LEE (New Taipei City, CN)
- CHING-HUA SU (Taipei City, TW)
- Ko-Jiunn LIU (Taichung City, CN)
- Hsiu-Jung LO (New Taipei City, CN)
- Yun-Liang YANG (New Taipei City, CN)
Cpc classification
C07K16/14
CHEMISTRY; METALLURGY
A61K39/395
HUMAN NECESSITIES
A61K45/06
HUMAN NECESSITIES
C07K2317/33
CHEMISTRY; METALLURGY
G01N2333/988
PHYSICS
C12Y402/01011
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
C07K2317/76
CHEMISTRY; METALLURGY
C07K2317/34
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
A61K39/0002
HUMAN NECESSITIES
International classification
C07K16/14
CHEMISTRY; METALLURGY
A61K39/00
HUMAN NECESSITIES
A61K39/395
HUMAN NECESSITIES
A61K45/06
HUMAN NECESSITIES
Abstract
The invention provides anti-CaENO1 antibodies and humanized antibodies as effective diagnostic agent or therapeutic treatment against infections caused by Candida spp. (preferably Candida. albicans, Candida tropicalis), fluconazole resistance Candida spp., Streptococcus, or Staphylococcus.
Claims
1. An epitope, consisting of .sub.283LYEQLISEYP.sub.292 (SEQ ID NO:1), .sub.278PQLADLYEQL.sub.287 (SEQ ID NO:2), .sub.240KGKVGIAMDV.sub.249 (SEQ ID NO:3) or .sub.278PQLADLYEQLISEYP.sub.292 (SEQ ID NO:4) located in CaENO1.
2. A pharmaceutical composition comprising the epitope of claim 1 and a pharmaceutically acceptable carrier, excipient or adjuvant.
3. The pharmaceutical composition of claim 2, which is used as a vaccine.
4. The pharmaceutical composition of claim 2, which further comprises one or more additional anti-Candida, anti-Streptococcus or anti-Staphylococcus drugs.
5. The pharmaceutical composition of claim 4, wherein the additional anti-Candida drug is fluconazole, itraconazole, posaconazole, echinocandins caspofungin, micafungin, anidulafungin, voriconazole, lipid formulations of amphotericin B, Ketoconazole, clotrimazole, econazole, ciclopirox, miconazole, ketoconazole or nystatin.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0009]
[0010]
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
DETAILED DESCRIPTION OF THE INVENTION
[0027] The invention develops an epitope of CaENO1 and anti-CaENO1 antibodies (CaS1) as an effective diagnostic agent or therapeutic treatment against infections caused by Candida, Streptococcus and Staphylococcus.
Definitions
[0028] In the description that follows, a number of terms are used for which the following definitions are provided to facilitate understanding of the claimed subject matter. Terms that are not expressly defined herein are used in accordance with their plain and ordinary meanings.
[0029] Unless otherwise specified, a or an means one or more.
[0030] As used herein, the term epitope refers to the site on the antigen to which an antibody binds.
[0031] As used herein, the term candidiasis refers to a fungal infection due to any type of Candida (a type of yeast).
[0032] As used herein, the term antibody refers to single chain, two-chain, and multi-chain proteins and polypeptides belonging to the classes of polyclonal, monoclonal, chimeric, and humanized antibodies; it also includes synthetic and genetically engineered variants of these antibodies. Antibody fragment includes Fab, Fab, F(ab).sub.2, and Fv fragments, as well as any portion of an antibody having specificity toward a desired target epitope or epitopes.
[0033] As used herein, the term polyclonal antibody refers to an antibody which is produced among or in the presence of one or more other, non-identical antibodies. In general, polyclonal antibodies are produced from a B-lymphocyte in the presence of several other B-lymphocytes producing non-identical antibodies. Usually, polyclonal antibodies are obtained directly from an immunized animal.
[0034] As used herein, the term monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous antibodies. In other words, a monoclonal antibody consists of a homogeneous antibody arising from the growth of a single cell clone (for example a hybridoma, a eukaryotic host cell transfected with a DNA molecule coding for the homogeneous antibody or a prokaryotic host cell transfected with a DNA molecule coding for the homogeneous antibody). These antibodies are directed against a single epitope and are therefore highly specific.
[0035] As used herein, the term single chain Fv or scFv refers to an antibody in which the heavy chain and the light chain of a traditional two chain antibody have been joined to form one chain. Typically, a linker peptide is inserted between the two chains to allow for proper folding and creation of an active binding site.
[0036] The term linker peptide includes reference to a peptide within an antibody binding fragment (e.g., Fv fragment) which serves to indirectly bond the variable heavy chain to the variable light chain. The linker may be a series of a single amino acid or an alternating pattern of amino acids, for example.
[0037] As used herein, the term complementarity determining region (CDR) refers to the non-contiguous antigen combining sites found within the variable region of both heavy and light chain polypeptides. CDRs have been described by Kabat et al., J. Biol. Chem. 252:6609-6616 (1977); Kabat et al., U.S. Dept. of Health and Human Services, Sequences of proteins of immunological interest (1991); by Chothia et al., J. Mol. Biol. 196:901-917 (1987); and MacCallum et al., J. Mol. Biol. 262:732-745 (1996), where the definitions include overlapping or subsets of amino acid residues when compared against each other.
[0038] As used herein, the term humanized antibody refers to a recombinant protein in which the CDRs from an antibody from one species; e.g., a murine or a chicken antibody, are transferred from the heavy and light variable chains of the antibody from the species into human heavy and light variable domains (framework regions). The constant domains of the antibody molecule are derived from those of a human antibody. In some cases, specific residues of the framework region of the humanized antibody, particularly those that are touching or close to the CDR sequences, may be modified, for example replaced with the corresponding residues from the original murine, rodent, subhuman primate, or other antibody. The humanized antibody may be achieved by various methods including (a) grafting only the non-human CDRs onto human framework and constant regions with or without retention of critical framework residues, or (b) transplanting the entire non-human variable domains, but cloaking them with a human-like section by replacement of surface residues. Such methods as are useful in practicing the present invention include that disclosed in Padlan, Mol. Immunol., 31(3):169-217 (1994).
[0039] As used herein, the term chimeric antibody refers to a recombinant protein that contains the variable domains of both the heavy and light antibody chains, including the complementarity determining regions (CDRs) of an antibody derived from one species, preferably a rodent antibody or a chicken antibody, more preferably a murine antibody, while the constant domains of the antibody molecule are derived from those of a human antibody.
[0040] As used herein, the term phage display library refers to a population of bacteriophage, each of which contains a foreign cDNA recombinantly fused in frame to a surface protein. The phage displays the foreign protein encoded by the cDNA on its surface. After replication in a bacterial host, typically E. coli, the phage which contain the foreign cDNA of interest are selected by the expression of the foreign protein on the phage surface.
[0041] As used herein, the term sequence identity in the context of two nucleic acid or polypeptide sequences includes reference to the nucleotides (or residues) in the two sequences which are the same when aligned for maximum correspondence over a specified comparison window. When percentage of sequence identity is used in reference to proteins it is recognized that residue positions which are not identical often differ by conservative amino acid substitutions, where amino acid residues are substituted for other amino acid residues with similar chemical properties (e.g., charge or hydrophobicity) and therefore do not change the functional properties of the molecule. Where sequences differ in conservative substitutions, the percent sequence identity may be adjusted upwards to correct for the conservative nature of the substitution. Means for making this adjustment are well known to those of skill in the art. Typically this involves scoring a conservative substitution as a partial rather than a full mismatch, thereby increasing the percentage sequence identity. Thus, for example, where an identical amino acid is given a score of 1 and a non-conservative substitution is given a score of zero, a conservative substitution is given a score between zero and 1. The scoring of conservative substitutions is calculated, e.g., according to the algorithm of Meyers & Miller, Computer Applic. Biol. Sci. 4:11-17 (1988), e.g., as implemented in the program PC/GENE (Intelligenetics, Mountain View, Calif., USA). An indication that two peptide sequences are substantially similar is that one peptide is immunologically reactive with antibodies raised against the second peptide. Thus, a peptide is substantially similar to a second peptide, for example, where the two peptides differ only by a conservative substitution.
[0042] A comparison window, as used herein, includes reference to a segment of about 10-20 residues in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. Methods of alignment of sequences for comparison are well known in the art. Optimal alignment of sequences for comparison may be conducted by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981); by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970); by the search for similarity method of Pearson & Lipman, Proc. Nat'l Acad. Sci. USA 85:2444 (1988); by computerized implementations of these algorithms (including, but not limited to CLUSTAL in the PC/Gene program by Intelligenetics, Mountain View, Calif., GAP, BESTFIT, BLAST, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group (GCG), Madison, Wis., USA); the CLUSTAL program is well described by Higgins & Sharp, Gene 73:237-244 (1988) and Higgins & Sharp, CABIOS 5:151-153 (1989); Corpet, et al., Nucl. Acids Res. 16:10881-90 (1988); Huang, et al., Computer Applications in the Biosciences 8:155-65 (1992); and Pearson, et al., Meth. in Molec. Biol. 24:307-31 (1994).
[0043] As used herein, the term diagnostic or diagnosed means identifying the presence or nature of a pathologic condition.
[0044] As used herein, the terms treatment, treating, and the like, cover any treatment of a disease in a mammal, particularly in a human, and includes: (a) preventing the disease from occurring in a subject which may be predisposed to the disease but has not yet been diagnosed as having it; (b) inhibiting the disease, i.e., arresting its development; and (c) relieving the disease, i.e., causing regression of the disease.
[0045] As interchangeably used herein, the terms individual, subject, host, and patient, refer to a mammal, including, but not limited to, murines (rats, mice), non-human primates, humans, canines, felines, ungulates (e.g., equines, bovines, ovines, porcines, caprines), etc.
[0046] As used herein, the term therapeutically effective amount or efficacious amount refers to the amount of a subject anti-CaENO1 antibody that, when administered to a mammal or other subject for treating a disease, is sufficient to effect such treatment for the disease.
[0047] As used herein, the term biological sample encompasses a variety of sample types obtained from an individual, subject or patient that can be used in a diagnostic or monitoring assay. The definition encompasses blood and other liquid samples of biological origin, solid tissue samples such as a biopsy specimen or tissue cultures or cells derived therefrom and the progeny thereof.
Epitopes Located in Candida albicans ENO1 (CaENO1) and Antibodies Against Candida Alpha-Enolase
[0048] In one aspect, the invention provides an epitope sequence, comprising an amino acid sequence consisting of .sub.283LYEQLISEYP.sub.292 (SEQ ID NO:1), .sub.278PQLADLYEQL.sub.287 (SEQ ID NO:2), .sub.240KGKVGIAMDV.sub.249 (SEQ ID NO:3) or .sub.278PQLADLYEQLISEYP.sub.292 (SEQ ID NO:4) located in CaENO1. In one embodiment, the epitope sequence comprises an amino acid sequence consisting of .sub.240KGKVGIAMDV.sub.249 (SEQ ID NO:3) or .sub.278PQLADLYEQLISEYP.sub.292 (SEQ ID NO:4) located in CaENO1.
[0049] The purified CaS1 scFv is used to recognize recombinant CaENO1 protein. The epitope region is mapped to contain 198 bp nucleotides, which deduces the following amino acid sequence (residues 235 to 300): DKAGYKGKVGIAMDVASSEFYKDGKYDLDFKNPESDPSKWLSGPQLADLYEQLISEYPIVS IEDPF (SEQ ID NO:19) (66 amino acids). To further determine the epitopic location, site directed mutagenesis is used to construct nine peptide-expressing phages according to the nucleotide sequences of 198 bp of mapped antigenic fragment. In one embodiment, CaS1 scFv antibody binds to a fragment of plasminogen spanning amino acid residues 301 to 437, which sequences are AEDDWDAWVHFFERVGDKIQIVGDDLTVTNPTRIKTAIEKKAANALLLKVNQIGTLTESIQ AANDSYAAGWGVMVSHRSGETEDTFIADLSVGLRSGQIKTGAPARSERLAKLNQILRIEEEL GSEAIYAGKDFQKA (SEQ ID NO:20).
[0050] In one aspect, the present invention provides an isolated anti-CaENO1 antibody or an antigen-binding portion thereof, comprising at least one of a light chain complementarity determining region 1 (L-CDR1) of SEQ ID NO:5 or a variant having amino acid sequence with at least 80% identity to any of L-CDR1s; a light chain CDR2 (L-CDR2) of SEQ ID NO:6 or a variant having amino acid sequence with at least 80% identity to any of L-CDR2s; and a light chain CDR3 (L-CDR3) of SEQ ID NO:7 or a variant having amino acid sequence with at least 80% identity to any of L-CDR3s; and at least one of a heavy chain CDR1 (H-CDR1) of SEQ ID NO:8 or a variant having amino acid sequence with at least 80% identity to any of H-CDR1s; a heavy chain CDR2 (H-CDR2) of SEQ ID NO:9 or a variant having amino acid sequence with at least 80% identity to any of H-CDR2s; and a heavy chain CDR3 (H-CDR3) of SEQ ID NO:10 or a variant having amino acid sequence with at least 80% identity to any of H-CDR3s; such that said isolated antibody or antigen-binding portion thereof binds to CaENO1. Preferably, the sequence identity as mentioned above is at least 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%.
[0051] The amino acid sequences of the complementarity determining regions (CDRs) in heavy chains and light chains are listed in the table below.
TABLE-US-00001 CDRsofLightChain L-CDR1 L-CDR2 L-CDR3 SGSYG SNN GSRDSSYVGV (SEQIDNO:5) (SEQIDNO:6) (SEQIDNO:7) CDRsofHeavyChain H-CDR1 H-CDR2 H-CDR3 GFTFIDYG IGSSGSST AKSAGGYCVNGAGCNGGSIDA (SEQIDNO:8) (SEQIDNO:9) (SEQIDNO:10)
[0052] The preceeding CDR sequences are determined by using the international ImMunoGeneTics information System (http://www.imgt.org).
[0053] In some embodiments, the isolated anti-CaENO1 antibody is a monocloncal antibody, chimeric antibody, humanized antibody or human antibody.
[0054] Accordingly, the invention provides a light chain of an anti-CaENO1 scFv monoclonal antibody (CaS1) comprising an amino acid sequence consisting of the sequence: ALTQPSSVSANLGGTVKITCSGGSGSYGWYQQKSPGSAPVTVIYSNNQRPSNIPSRFSGSPSG STGTLTITGVQADDEAVYFCGSRDSSYVGFGAGTTLTVL (SEQ ID NO:11). The invention provides a heavy chain of an anti-CaENO1 scFv monoclonal antibody (CaS1) comprising an amino acid sequence consisting of the sequence: TVTLDESGGGLQTPRGALSLVCKASGFTHDYGMQWVRQAPGKGLEWVAGIGSSGSSTNY GAAVKGRATISRDDGQSTVRLQLNNLRAEDTGTYYCAKSAGGYCVNGAGCNGGSIDAWG HGTEVIVSS (SEQ ID NO:12). The invention also provides an anti-CaENO1 scFv monoclonal antibody (CaS1) comprising a light chain having an amino acid sequence consisting of the sequence of SEQ ID NO:11 and a heavy chain comprising an amino acid sequence consisting of the sequence SEQ ID NO:12.
[0055] The antibody molecule can be a polyclonal or a monoclonal antibody or any other suitable type of an antibody, such as a fragment or a derivative of an antibody, a single chain variable fragment (ScFv) or a synthetic homolog of the antibody, provided that the antibody has the same binding characteristics as, or that has binding characteristics comparable to, those of the whole antibody. In some embodiments, the antibody can be recombinantly produced, e.g., produced by any suitable phage display or combinatorial methods. Various phage display and combinatorial methods for generating antibodies are known in the art (as described in, e.g., Griffths et al. (1993) EMBO J 12:725-734; Hawkins et al. (1992) J Mol Biol 226:889-896; Clackson et al. (1991) Nature 352:624-628; Gram et al. (1992) PNAS 89:3576-3580; Garrad et al. (1991) Bio/Technology 9:1373-1377; Hoogenboom et al. (1991) Nuc Acid Res 19:4133-4137; and Barbas et al. (1991) PNAS 88:7978-7982).
[0056] Antibody fragments can be produced by cleaving a whole antibody, or by expressing DNA that encodes the fragment. Fragments of antibodies may be prepared by methods described in the published literature (Lamoyi et al., J. Immunol. Methods, 56:235, 1983; Parham, J. Immunol., 131:2895, 1983). Such fragments may contain one or both of an Fab fragment and an F(ab)2 fragment. Such fragments may also contain single chain variable fragment antibodies, i.e. scFv, dibodies, or other antibody fragments.
[0057] Single chain variable fragments (scFv) are polypeptides that consist of the variable region of a heavy chain of an antibody linked to the variable region of a light chain with a short peptide linker). Thus, the scFv comprises the entire antibody-combining site. These chains may be produced in bacteria, or in eukaryotic cells.
[0058] Various techniques, such as production of chimeric or humanized antibodies, may involve procedures of antibody cloning and construction. The antigen-binding variable light chain and variable heavy chain sequences for an antibody of interest may be obtained by a variety of molecular cloning procedures, such as RT-PCR, 5-RACE, and cDNA library screening. The variable heavy or light chain sequence genes of an antibody from a cell that expresses a murine antibody can be cloned by PCR amplification and sequencing. To confirm their authenticity, the cloned V.sub.L and V.sub.H genes can be expressed in cell culture as a chimeric antibody as described by Orlandi et al., (Proc. Natl. Acad. Sci., USA, 86: 3833 (1989)). Based on the variable heavy or light chain gene sequences, a humanized antibody can then be designed and constructed as described by Leung et al. (Mol. Immunol., 32: 1413 (1995)).
[0059] A chimeric antibody is a recombinant protein in which the variable regions of a human antibody have been replaced by the variable regions of, for example, a mouse antibody, including the complementarity-determining regions (CDRs) of the mouse antibody. Chimeric antibodies exhibit decreased immunogenicity and increased stability when administered to a subject. Methods for constructing chimeric antibodies are well known in the art (e.g., Leung et al., 1994, Hybridoma 13:469).
[0060] A chimeric monoclonal antibody may be humanized by transferring the mouse CDRs from the heavy and light variable chains of the mouse immunoglobulin into the corresponding variable domains of a human antibody. The mouse framework regions (FR) in the chimeric monoclonal antibody are also replaced with human FR sequences. To preserve the stability and antigen specificity of the humanized monoclonal, one or more human FR residues may be replaced by the mouse counterpart residues. Humanized monoclonal antibodies may be used for therapeutic treatment of subjects. Techniques for production of humanized monoclonal antibodies are well known in the art. (See, e.g., Jones et al., 1986, Nature, 321:522; Riechmann et al., Nature, 1988, 332:323; Verhoeyen et al., 1988, Science, 239:1534; Carter et al., 1992, Proc. Nat'l Acad. Sci. USA, 89:4285; Sandhu, Crit. Rev. Biotech., 1992, 12:437; Tempest et al., 1991, Biotechnology 9:266; Singer et al., J. Immun., 1993, 150:2844.)
[0061] In one embodiment, the invention provides the followings amino acids of the light chains and heavy chains of humanized antibodies.
TABLE-US-00002 EmbodimentsofAminoAcidSequencesofLight Chains (SEQIDNO:13) DIQLTQSPSSLSASVGDRVTITCRASSGSYGLGWYQQKPGKAPKRLIYSN NSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCGSRDSSYVGNTGQ GTKVEIK(hzCaS1-V1scFv) (SEQIDNO:14) DIQMTQSPSSLSASVGDRVTITCRASSGSYGVAWYQQKPGKAPKLLIYSN NFLYSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCGSRDSSVGVFGQG TKVEIK(hzCaS1-V3scFv) EmbodimentsofAminoAcidSequencesofHeavy chains (SEQIDNO:15) EVKLEESGGGLVQPGGSMKLSCAASGFTFIDYGMDWVRQSPEKGLEWVAE IGSSGSSTHYAESVKGRFTVSRDDSKSSVYLQMNSLRAEDTGIYYCAKSA GGYCVNGAGCNGGSIDAWGQGTLVTVSA(hzCaS1-V1scFv) (SEQIDNO:16) EVQLVESGGGLVQPGGSLRLSCAASGFTFIDYGIHWVRQAPGKGLEWVAG IGSSGSSTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCAKSA GGYCVNGAGCNGGSIDAWGQGTLVTVSS(hzCaS1-V3scFv)
[0062] In some embodiments, the invention provides alight chain comprising an amino acid sequence having a sequence selected from the group consisting of those as set forth in SEQ ID NOs:13 to 14.
[0063] In some embodiments, the invention provides a heavy chain comprising an amino acid sequence having a sequence selected from the group consisting of those as set forth in SEQ ID NOs:15 to 16.
[0064] In further embodiments, the invention comprises a humanized antibody, comprising (i) alight chain having an amino acid sequence as set forth in the sequence selected from the group consisting of SEQ ID NOs:13 to 14 or a variant having at least 80% identity to any of SEQ ID NOs:13 to 14, and (ii) a heavy chain having an amino acid sequence as set forth in the sequence selected from the group consisting of SEQ ID NOs:15 to 16 or a variant having at least 80% identity to any of SEQ ID NOs:15 to 16. Preferably, the sequence identity as mentioned above is at least 90%, 91%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%.
[0065] In a preferred embodiment, the humanized antibody comprises (i) a light chain having an amino acid sequence as set forth in SEQ ID NO:13 and (ii) a heavy chain having an amino acid sequence as set forth in SEQ ID NO:15 (hzCaS1-V1). In another preferred embodiment, the humanized antibody comprises (i) a light chain having an amino acid sequence as set forth in SEQ ID NO:14 and (ii) a heavy chain having an amino acid sequence as set forth in SEQ ID NO:16 (hzCaS1-V3).
[0066] In addition to recombinant methods, the antibodies and variants thereof that are disclosed herein can also be constructed in whole or in part using standard peptide synthesis. Solid phase synthesis of the polypeptides can be accomplished by attaching the C-terminal amino acid of the sequence to an insoluble support followed by sequential addition of the remaining amino acids in the sequence. Techniques for solid phase synthesis are described by Barany & Merrifield, The Peptides: Analysis, Synthesis, Biology. Vol. 2: Special Methods in Peptide Synthesis, Part A. pp. 3-284; Merrifield et al., J. Am. Chem. Soc. 85:2149-2156, 1963, and Stewart et al., Solid Phase Peptide Synthesis, 2nd ed., Pierce Chem. Co., Rockford, Ill., 1984. Proteins of greater length may be synthesized by condensation of the amino and carboxyl termini of shorter fragments.
Compositions and Methods of Administrations
[0067] Certain embodiments relate to a pharmaceutical composition comprising an epitope 20 of the invention or an antibody against Candida alpha-enolase of the invention and a pharmaceutically acceptable carrier or excipient. By pharmaceutically acceptable carrier is intended, but not limited thereto, a non-toxic solid, semisolid or liquid filler, diluent, encapsulating material or formulation auxiliary of any type known to persons skilled in the art. Diluents, such as polyols, polyethylene glycol and dextrans, may be used to increase the biological half-life of the conjugate.
[0068] The pharmaceutical compositions of the present invention can be formulated according to conventional methods (for example, Remington's Pharmaceutical Science, latest edition, Mark Publishing Company, Easton, U.S.A.), and may also contain pharmaceutically acceptable carriers and additives. Examples include, but are not limited to, surfactants, excipients, coloring agents, flavoring agents, preservatives, stabilizers, buffers, suspension agents, isotonic agents, binders, disintegrants, lubricants, fluidity promoting agents, and corrigents, and other commonly used carriers can be suitably used. Specific examples of the carriers include light anhydrous silicic acid, lactose, crystalline cellulose, mannitol, starch, carmellose calcium, carmellose sodium, hydroxypropyl cellulose, hydroxypropyl methylcellulose, polyvinylacetal diethylaminoacetate, polyvinylpyrrolidone, gelatin, medium-chain triglyceride, polyoxyethylene hardened castor oil 60, saccharose, carboxymethyl cellulose, corn starch, inorganic salt, and such.
[0069] The invention also provide methods for inhibition of Candida, Streptococcus and Staphylococcus growth and treatment of infection caused thereby.
[0070] One embodiment is directed to a method for inhibition of Candida, Streptococcus or Staphylococcus growth and treatment of infection caused thereby in a subject, comprising administering an antibody against alpha-enolase of the invention to the subject. Accordingly, also provided is the use of an antibody against alpha-enolase of the invention in the manufacture of a medicament for inhibition of Candida, Streptococcus or Staphylococcus growth or treatment of infection caused thereby in a subject.
[0071] Another embodiment is directed to a method for prevention of growth or infection caused by Candida, Streptococcus or Staphylococcus in a subject, comprising administering an epitope of the invention to the subject. Accordingly, also provided is the use of epitope of the invention in the manufacture of a medicament for prevention of growth or infection caused by Candida, Streptococcus or Staphylococcus in a subject.
[0072] In some embodiments, the Candida is C. albicans, Candida tropicalis, and Candida glabrate, C. albicans, the Streptococcus is S. pneumoniae and the Staphylococcus is S. aureus.
[0073] Another embodiment is directed to a method for treating candidiasis in a subject comprising administering an antibody against alpha-enolase of the invention to the subject. Accordingly, also provided is the use of an antibody against alpha-enolase in the invention in the manufacture of a medicament for treatment of candidiasis in a subject. Preferably, the candidiasis disease is invasive candidiasis, antibiotic candidiasis, dysbiosis of the gut mycobiota, onychomycosis, cutaneous candidiasis, or mucosal candidiasis.
[0074] Another embodiment is directed to a method for inhibition of fluconazole-resistance Candida growth or treatment of infection caused thereby in a subject, comprising administering an antibody against alpha-enolase of the invention to the subject. Accordingly, also provided is the use of an antibody against alpha-enolase in the invention in the manufacture of a medicament for inhibition of fluconazole-resistance Candida spp. growth or treatment of infection caused thereby in a subject. Preferably, the fluconazole-resistance Candida is Candida spp.; more preferably, the fluconazole-resistance Candida is fluconazole resistance C. albicans or C. tropicalis.
[0075] Another further embodiment is to provide a method for inhibition of biofilm formation caused by Candida, comprising administering an antibody against alpha-enolase of the invention to the subject. Accordingly, also provided is the use of an antibody against alpha-enolase in the invention in the manufacture of a medicament for inhibition of biofilm formation caused by Candida. Preferably, the Candida is C. albicans, Candida tropicalis and Candida glabrate, C. albicans. Biofilms are one of the main reasons why a Candida overgrowth is so hard to defeat. A longstanding Candida overgrowth has had plenty of time to create biofilms, and these are very resistant to many treatments. The longer the biofilm has had to develop, the more resistant it will be to antifungal treatments. This is why using antifungal drugs alone is often not enough to inhibit a Candida overgrowth. Surprisingly, the invention found that the antibodies of the invention can effectively inhibit Candida biofilm formation.
[0076] The above methods also comprise administering the antibody against alpha-enolase of the invention concomitantly with or subsequent to other standard therapies as described in updated guidelines published in March 2009 by the Infectious Disease Society of America (IDSA) (Pappas P G, Kauffman C A, Andes D, Benjamin D K Jr, Calandra T F, Edwards J E Jr, et al. Clinical practice guidelines for the management of candidiasis: 2009 update by the Infectious Diseases Society of America. Clin Infect Dis. 2009 Mar. 1. 48(5):503-35).
[0077] In preferred embodiments, the subject is a mammal. Exemplary mammals include human, pig, sheep, goat, horse, mouse, dog, cat, cow, etc. Diseases that may be treated with the antibody or a pharmaceutical composition thereof include candidiasis. Examples of candidiasis include but are not limited to invasive candidiasis, antibiotic candidiasis, dysbiosis of the gut mycobiota, onychomycosis, cutaneous candidiasis, and mucosal candidiasis.
[0078] The antibody against alpha-enolase as disclosed herein or the pharmaceutical composition thereof may be administered intravenously, topically, intra-peritoneally, intra-arterially, intra-thecally, intra-vesically, or intratumorally. One of ordinary skill will appreciate that effective amounts of the antibody against alpha-enolase or its composition can be determined empirically. It will be understood that, when administered to a human patient, the total daily usage of the antibody against alpha-enolase or its composition will be decided by the attending physician within the scope of sound medical judgment. The specific therapeutically effective dose level for any particular patient will depend upon a variety of factors: the type and degree of the cellular response to be achieved; activity of the specific the antibody against alpha-enolase or its composition employed; the age, body weight, general health, sex and diet of the patient; the time of administration, route of administration, and rate of excretion of the antibody against alpha-enolase or its composition; the duration of the treatment; drugs used in combination or coincidental with the antibody against alpha-enolase or its composition; and like factors well known in the medical arts.
[0079] Each of the above identified compositions and methods of treatment may additionally include an additional anti-Candida, anti-Streptococcus or anti-Staphylococcus drug. In some embodiments, anti-Candida drugs suitable for use with the present invention include, but are not limited to, fluconazole, itraconazole, posaconazole, echinocandins caspofungin, micafungin, anidulafungin, voriconazole, lipid formulations of amphotericin B, Ketoconazole, clotrimazole, econazole, ciclopirox, miconazole, ketoconazole and nystatin. In the method of treatment, the antibody against alpha-enolase of the invention can be administered concurrently, subsequently or separately with the additional one or more anti-Candida, anti-Streptococcus or anti-Staphylococcus drugs.
Diagnosis of Candida, Streptococcus or Staphylococcus Infection
[0080] The present invention surprisingly found that anti-CaENO1 antibodies (CaS1) are an effective diagnostic agent or therapeutic treatment against Candida, Streptococcus or Staphylococcus infection. Accordingly, in another aspect, the present invention provides a method for diagnosing Candida, Streptococcus or Staphylococcus infection in a biological sample of a subject, comprising contacting an anti-CaENO1 antibody of the invention with the biological sample and detecting the binding of the anti-CaENO1 antibody to an epitope of CaENO1 of the invention wherein the presence of the binding indicates that the subject is suspected of suffering from Candida, Streptococcus or Staphylococcus infection. Alternatively, the present invention provides a method for diagnosing Candida, Streptococcus or Staphylococcus infection in a biological sample of a subject, comprising contacting an epitope sequence of the invention with the biological sample and detecting the binding of the epitope sequence of the invention to an anti-CaENO1 antibody wherein the presence of the binding indicates that the subject is suspected of suffering from Candida infection.
[0081] In the present invention, detection includes quantitative and qualitative detection. Examples of qualitative detection include the following: simple detection of the presence or absence of the binding of the anti-CaENO1 antibody to an epitope of CaENO1 of the invention; determination of whether or not the binding is present above a certain amount; and comparison of the amount of the binding with that of other samples (for example, a control sample).
[0082] Biological samples used in the diagnostic methods of the present invention are not particularly limited as long as they are samples that may contain a CaENO1 protein. Specifically, samples collected from the body of an organism such as a mammal are preferred. Samples collected from humans are more preferred. Specific examples of the test samples include blood, interstitial fluid, plasma, cerebrospinal fluid, synovial fluid, pleural fluid, serum, lymphatic fluid, saliva, urine, tissue and ascites.
[0083] In the present invention, control refers to samples serving as a standard for comparison, including negative controls and biological samples from healthy subjects. Negative control can be obtained by collecting biological samples from healthy subjects and mixing them as necessary. The level of binding of the anti-CaENO1 antibody to an epitope of CaENO1 in a control can be detected in parallel with the binding level in the biological sample of a subject. Alternatively, by detecting the binding level in biological samples of many healthy subjects in advance, a standard expression level in healthy subjects can be determined statistically.
[0084] In the present invention, the binding level can be determined by any method. Methods for detecting the binding in a test sample are not particularly limited. An immunological method using an anti-CaENO1 antibody for detection is provided, such as radioimmunoassay (RIA); enzyme immunoassay (EIA); fluorescence immunoassay (FIA); luminescence immunoassay (LIA); immunoprecipitation (IP); turbidimetric immunoassay (TIA); Western blotting (WB); immunohistochemical (IHC) method; and single radial immunodiffusion (SRID).
[0085] The present invention also provides diagnostic agents or kits for diagnosing a Candida, Streptococcus or Staphylococcus infection, comprising a diagnostic agent for detecting the binding of the anti-CaENO1 antibody to a CaENO1 in a test sample. The diagnostic agents of the present invention comprise at least a Candida infection.
[0086] Kits for diagnosing cancer can be produced by combining the agents for diagnosing a Candida infection with another element used for detecting the anti-CaENO1 antibody. More specifically, the present invention relates to kits for diagnosing a Candida, Streptococcus or Staphylococcus infection which comprise an anti-CaENO1 antibody that binds to CaENO1 and a reagent for detecting binding between the antibody and CaENO1. In addition, instructions that describe the measurement operation can be attached to the kits of the present invention.
EXAMPLES
Materials and Methods
[0087] Expression and Purification of his-CaENO1 Protein
[0088] Briefly, C. albicans alpha-enolase genes were constructed in pQE30 plasmids to form pQE30-CaENO1 vector, and then the resulting vectors were transformed with E. coli BL21 cells. The bacterial culture was grown in 10 ml LB medium containing ampicillin (50 g/ml) at 37 C. overnight, diluted 10-fold in the same LB medium and further grown until the OD.sub.600 reached between 0.6 and 1.0. To induce CaENO1 protein expression, isopropyl--D-thiogalactopyranoside (IPTG) was added to a final concentration of 0.5 mM in the culture. The cell pellet was resuspended in 2 ml of 1PBS containing 1% Triton x-100 and lysed by three cycles of freezing (70 C.) and thawing (37 C.). After centrifugation, the resulting cellular lysate was incubated with a Ni.sup.2+-charged resin column to purify His-CaENO1 protein according to the manufacturer's instruction (GE Healthcare Bio-Sciences AB, Sweden). ENO1 from human, mouse, S. pneumonia, S. aureus were expressed and purified in the same way.
[0089] Animal Immunization
[0090] Female white leghorn (Gallus domesticus) chickens were immunized with 50 Hg of purified His-CaENO1 in an equal volume of Freund's complete adjuvant (Sigma, USA) by intramuscular injection. Three additional immunizations with His-CaENO1 in Freund's incomplete adjuvant were performed at intervals of 7 days. After each immunization, polyclonal IgY antibodies in egg yolk were partially purified and titrated by an enzyme-linked immunosorbent assay (ELISA) to determine the presence of humoral anti-his-CaENO1 immune response. The IgY antibodies were purified from the yolk separated from the egg white using 10% Dextran sulphate as described previously (Akita E M, Nakai S. Comparison of four purification methods for the production of immunoglobulins from eggs laid by hens immunized with an enterotoxigenic E. coli strain. J Immunol Methods 1993; 160: 207-14; Akita E M, Nakai S. Production and purification of Fab fragments from chicken egg yolk immunoglobulin Y (IgY). J Immunol Methods 1993; 162: 155-64). The purified IgY antibodies were dissolved in 5 ml of TBS containing 0.05% sodium azide and stored at 20 C.
[0091] Construction of scFv Antibody Libraries and Panning
[0092] The antibody libraries were established based on the previous report (Andris-Widhopf J, Rader C, Steinberger P et al. Methods for the generation of chicken monoclonal antibody fragments by phage display. J Immunol Methods 2000; 242: 159-81). Briefly, spleens harvested from chickens following the final immunization were placed immediately in Trizol (Gibco BRL., USA) for homogenization. Ten g of total RNA was reversely transcribed into the first-strand cDNA using a SuperScript RT kit (Invitrogen, USA). After amplification using chicken-specific primers, PCR products of heavy and light chain variable (VH and VL) regions were subjected to a second round of PCR to form full-length scFv fragments with a short or long linker, which were further digested with SfiI and cloned into the pComb3X vector. Recombinant phage DNAs were transformed into E. coli ER2738 strain by electroporation (MicroPulser from Bio-Rad). The production of recombinant phages was initiated by the addition of wild-type VCS-M13 helper phage, which were subsequently precipitated with 4% polyethylene glycol 8000 and 3% NaCl (w/v), and finally re-suspended in 1 phosphate-buffered saline (PBS) containing 1% bovine serum albumin (BSA). Then, 10.sup.11 plaque-forming units (pfu) of recombinant phages in the scFv antibody libraries were added to wells pre-coated with purified His-CaENO1 protein (0.5 g/well) and incubated at 37 C. for 2 hrs. After the unbound phages were removed, bound phages were eluted with 0.1 M HCl/glycine (pH 2.2)/0.1% BSA, neutralized with 2 M Tris base buffer and used to infect the E. coli ER2738 strain. The amplified phages were precipitated and recovered as described above for the next round of selection. After 4.sup.th biopanning, total phagemid DNA from E. coli ER2738 was purified and transformed into E. coli TOP10F. A panel of randomly selected clones was cultured overnight, diluted 100 in super broth containing 1 mM MgCl2 and ampicillin (50 g/ml) and further grown for 8 hr. After induction with 1 mM isopropyl--D-thiogalactopyranoside (IPTG) overnight, the bacteria were harvested through centrifugation, resuspended in histidine (His)-binding buffer (20 mM sodium phosphate, 0.5 M NaCl, 20 mM imidazole, pH7.4), and lysed by 3 cycles of freezing, thawing/sonication. The scFv antibodies were purified using Ni.sup.2+-charged Sepharose (GE Healthcare Bio-Sciences AB, Sweden) according to the manufacturer's instructions. The purified scFv antibodies were further concentrated in 1PBS using Amicon Ultra-4 Centrifugal Filter Devices (Merck Millipore, Germany) and examined for their binding or neutralizing capability against C. albicans.
[0093] C. albicans Growth and Hyphal Formation
[0094] To determine the effect of scFv antibodies on the cell growth and hyphal formation, anti-CaENO1 IgY (0.5 mg/ml) or CaS1 scFv (0.5 mg/ml) or PBS were pre-incubated with C. albicans (110.sup.6 cfu) for 1 hr at 37 C. After incubation, 1 ul of each mixture in 10-fold dilutions was spotted on YPD agar plate and incubated at 37 C. overnight. 10.sup.3 cfu of C. albicans was mixed with 0 (1PBS control), 10 or 100 g/ml CaS1 scFv at room temperature for 1 hr. Thereafter, 1 ul of each mixture was spotted on YPD agar plate and incubated at 37 C. for 5 days. Candida spp. strains.
[0095] C. albicans (SC 5314), C. kruesi (clinical isolate), C. tropicalis (BCRC 20520), C. parapsilosis (BCRC 20515) and C. glabrate (BCRC 20586) were kindly provided by Dr. Ching-Hua Su from Taipei Medical University, Taipei, Taiwan. C. albicans (CA6-17, CA7-26, CA7-3, CA10-50, CA7-30, CA10-65), C. tropicalis (CT11-52, CT6-29, CT6-50, CT12-54), C. glabrate (CG5-8, CG8-11, CG7-37, CG5-66), and C. parapsilosis (CP8-20, CP12-37, CP6-20, CP7-17, CP8-48) were kindly provided by Department of Laboratory Medicine, Wan Fang Hospital, Taipei Medical University, Taipei, Taiwan. Candida species were cultured in YPD medium and their identities were confirmed by CHROMagar Candida plate (CHROMagar, Paris, France). MIC test strips were used and MIC was read at 80% inhibition as recommended by the manufacturer.
[0096] Western Blotting
[0097] To detect the presence of ENO1 proteins, the purified recombinant ENO1 protein or cell lysates of five Candida spp were subjected to SDS-PAGE analysis, transferred onto nitrocellulose membranes (Amersham Biosciences, UK) and then blocked with 5% skim milk in TBST for 1 hr. The anti-CaENO1 IgY from chicken after 7.sup.th immunization (1:3,000) or purified CaS1 scFv antibody (1 g/ml) were added and incubated for 1 hr at room temperature. After vigorous washings, horseradish peroxidase (HRP)-conjugated polyclonal donkey anti-chicken IgY antibodies (1:3,000) (Bethyl Laboratories, Montgomery, Tex., USA) were added and incubated for an additional 1 hr for detecting the bound IgY antibodies. However, goat anti-chicken light chain antibodies (1:3,000) (Bethyl Laboratories, Montgomery, Tex., USA), followed by HRP-conjugated donkey anti-goat IgG antibodies (Jackson ImmunoResearch, USA) were used for detecting the bound scFv antibodies. After washings as above, the membranes were developed with diaminobenzidine (DAB) or ECL substrate. The ImageQuant LAS4500 was used for ECL intensity detection.
[0098] ELISA and Competitive ELISA
[0099] To examine their binding reactivity, a series of diluted IgY antibodies (500-256,000-fold) purified from chicken after 7.sup.th immunization or the recombinant CaS1 scFv antibodies (40-0.078 g/ml) were incubated with the purified CaENO1 (10 g/ml) immobilized on ELISA plate wells. After vigorous washings, the bound IgY antibodies were detected by adding HRP-conjugated polyclonal donkey anti-chicken IgY antibodies (1:3,000) (Bethyl Laboratories, Montgomery, Tex., USA) while the bound CaS1 scFv antibodies were detected by goat anti-chicken light chain antibodies (1:3,000) (Bethyl Laboratories, Montgomery, Tex., USA), followed by HRP-conjugated donkey anti-goat IgG antibodies (Jackson ImmunoResearch, USA). After washing as above, a tetramethylbenzidine (TMB) substrate solution (Sigma, USA) was added to the wells for color development. The reaction was stopped with 1 N HCl and optical density was measured at 450 nm using an ELISA plate reader (BioTek Synergy HT). Dissociate constant (K.sub.D) was calculated according to the equation, grams/molecular weight (Da)volume (L).sup.1.
[0100] For the competitive ELISA, the procedure described above was performed except a series of diluted CaENO1 proteins (50-0.097 g/ml) were first mixed with equal volume of CaS1 scFv antibodies (1 g/ml) for 1 hr and added to the plates for detecting the binding specificity. The ELISA tests were carried out in the duplicated wells for each sample. ELISA data were presented as meanSD of the duplicated experiments.
[0101] Fibrin Matrix-Gel Degradation Analysis
[0102] The matrix gel was prepared for fibrinolysis activity detection.sup.33. C. albicans (10.sup.6 cells) were washed and incubated with or without CaS1scFv (10 and 100 g) at 37 C. for 1 hr. After incubation, cells were washed and incubated with plasminogen (10 g) for 30 min. The mixtures were washed with PBS to remove free plasminogen. The resulting cell pellets were placed in a matrix gel that contained 1.25% low-melting-temperature agarose, thrombin (0.05 U/ml, Sigma) and fibrinogen (2 mg/ml, Sigma). The gel was incubated in a humidified chamber at 37 C. for 10-14 hrs until the appearance of clear spots indicated the presence of fibrinolysis activity.
[0103] Adhesion Assay
[0104] Cell adhesion assay was performed using human oral epidermal cells (OECM-1) (XXX). C. albicans (110.sup.6 cfu) were pre-incubated with CaS1 scFv antibodies (50 or 100 g) at 37 C. for 1 hr. After incubation, the mixtures were two-fold diluted and added onto 10.sup.4 OECM-1 cells cultured in 96-well plates. The plates were further incubated at 4 C. for 2 hrs. After being washed three times with 1PBS, the plates were fixed with 10% formaldehyde. After being washed as above, the wells were blocked with skim milk for 1 hr. Thereafter, rabbit anti-C. albicans antibodies (1:3,000, Bethyl, USA) were added and incubated for another 1 hr, followed by adding the HRP-conjugated anti-rabbit antibodies (1:3,000, Bethyl, USA). Washings as above were always carried out between steps. TMB was used for color development, which was stopped with 1 N HCl. The intensity of the color was measured at 450 nm on an ELISA plate reader.
[0105] Mouse Model of C. albicans Infection
[0106] A total of 20 ICR female mice (purchased from National Laboratory Animal Center, Taiwan) weighing about 30 g were randomly grouped with 5 mice in each group. C. albicans were grown overnight and washed in normal saline. Four groups of mice were treated through the lateral tail vein with the following preparations: (i) 1PBS alone; (ii) 110.sup.6 cfu of C. albicans cells pre-incubated with 50 g of CaS1; (iii) 110.sup.6 cfu of C. albicans cells pre-incubated with 100 g of CaS1; (iv) 110.sup.6 cfu of C. albicans cells pre-incubated with anti-CaENO1 IgY. Mice were monitored for survival at 1 day intervals for 10 days. All treatments and handling of mice were carried out according to animal experimental protocols approved by the Institutional Animal Care and Use Committee of Taipei Medical University.
Example 1 Expression and Purification of Fusion Protein of His-C. albicans Alpha-Enoloase (his-CaENO1)
[0107] C. albicans alpha-enolase genes were constructed in pQE30 plasmids to form pQE30-CaENO1 vector and then the resulting vectors were transformed with E. coli BL21 cells. The expression of the cells were was induced with IPTG at a concentrations 1.0 mM, 0.5 mM and 0.1 mM for 4 hours, 5 hours, 8 hours and overnight. It was found that the expressed protein hads a molecular weight at of about 49 kDa by SDS-PAGE (
[0108] C. albicans alpha-enolase genes were constructed in pQE30 plasmids to form pQE30-CaENO1 vector and then the resulting vectors were transformed with E. coli BL21 cells. The expression of the cells were was induced with IPTG at a concentrations 1.0 mM, 0.5 mM and 0.1 mM for 4 hours, 5 hours, 8 hours and overnight. It was found that the expressed protein hads a molecular weight at of about 49 kDa by SDS-PAGE and Western blot analysis. To confirm that the expressed protein mentioned above is the desired CaENO1 protein, the protein obtained in Example 1 was purified with Ni Sepharose High Performance, the purified protein was analyzed by SDS-PAGE and a protein with 49 kDa was confirmed as His-CaENO1 (
Example 2 Binding Assay of his-CaENO1 IgY Polyclonal Antibody to Antigen his-CaENO1
[0109] 50 g of the purified His-CaENO1 protein of Example 1 was administered to chickens to produce anti-his-CaENO1 IgY polyclonal antibodies. The polyclonal antibodies were purified from eggs by SDS-PAGE and Western blot analysis. The binding ability of the purified antibodies was assayed by Western blot and enzyme-linked immunosorbent assay (ELISA). In the ELISA assay, BSA was used as negative control, mouse anti-his IgG was used as the first antibody and HRP rabbit anti-mouse IgG was used as the second antibody. After the Western blot analysis, anti-his-CaENO1 IgY polyclonal antibodies specifically binding to His-CaENO1 were produced after immunization three times and its binding ability increased with each round of immunization.
Example 3 Binding Activity of Chicken Anti-CaENO1 IgY, Anti-CaENO1 Library Construction and Panning
[0110] The humoral immune response of chicken anti-CaENO1 IgY was identified by ELISA and Western blot (
[0111] Two libraries with short linker and long linker were constructed as shown in Table 1. The sizes for short and long linker libraries were estimated to be 2.410.sup.6 and 1.3610.sup.7, respectively. The elution titer after each panning were shown (Table 1). After four rounds of panning, the CaENO1 binding phage variants were greatly enriched. These results suggested the non-specific binding phage was removed throughout the panning process and the clones with specific binding affinity were enriched. The sequences were confirmed to belong to chicken immunoglobulin germline gene. The short linker with highest binding activity to CaENO1 was identified. This anti-CaENO1 scFv monoclonal antibody was named CaS1.
TABLE-US-00003 TABLE1 Theanti-CaENO1librarysizeandelutedphagetitersaftereachroundofpanning. Linker Elutedphagetitersaftereachroundofpanning Library length* Librarysize 1.sup.st 2.sup.nd 3.sup.rd 4.sup.th CaENO1-S 7aa 2.410.sup.6 9.610.sup.4 9.010.sup.5 7.210.sup.5 3.010.sup.6 CaENO1-L 18aa 1.3610.sup.7 2.7510.sup.5 1.210.sup.6 1.3210.sup.6 1.210.sup.5 *Linker length of 7 aa and 18 aa are GQSSRSS (SEQ ID NO: 17) and GQSSRSSGGGGSSGGGGS (SEQ ID NO: 18), respectively.
Example 3 Gene Sequencing of scFv Antibody
[0112] The antibody purified from the chicken includes framework region (FR) and complementarity determining regions (CDRs). Colonies #151 to #1S12 were isolated and sequenced using ompseq primers (5-AAGACAGCTATCGCGATTGCAGTG-3), and the sequencing results were analyzed by BioEdit software and then the resulting sequences were compared with chicken germline. It was found that the antibodies in the ten clones have the same sequences in light chain and heavy chain (
Example 4 Expression and Purification of CaS1 scFv
[0113] Total phagemid DNA from the last biopanning was transformed into TOP10F E. coli to analyze individual scFv. The colony containing scFv gene fragment was selected and cultured in 10 mL LB (Lauria-Bertani) broth (50 g/mL Ampicillin) with shaking at 37 C. overnight; then, the culture was transferred to another 100 mL LB (with 50 g/mL Ampicillin) until OD.sub.600 reached between 0.4 to 0.8. Thereafter, the resulting culture was incubated with 0.5 mM IPTG for 6-8 hours to express the His-tagged CaS1 scFv protein. Then, the culture was subjected to centrifugation and the supernatant was discarded, and the pellet was resuspended with 1 mL of His-binding buffer (20 mM sodium phosphate, 0.5 M NaCl, 20 mM imidazole, pH 7.4). The E. coli cells were disrupted with sonication; then, the sample was subjected to 3000 g centrifugation for 5 minutes. Next, the CaS1 scFv fusion protein in the supernatant was purified by Ni Sepharose High Performance (GE healthcare Life science, USA) as suggested by the manufacturer. In brief, the sample supernatant was added to the Sepharose, mixed for 1 hour and subjected to 1000 g centrifugation for 5 minutes. The supernatant was discarded. The Sepharose was washed with 1 mL His-binding buffer 2 times to get wash 1 and wash 2. 500 L of His-elution buffer was added to the Sepharose and mixed for 1 hour. The Sepharose was subjected to 1000 g centrifugation for 5 minutes and the supernatant (the elution 1) was collected. The above steps were repeated to get elution 2. Elutions 1 and 2 contain the purified His-CaS1 scFv. Finally, the Sepharose was resuspended in 50 L of His-binding buffer. Fractions of binding supernatant, wash 1, wash 2, elution 1, elution 2 and the Sepharose were analyzed by 12% SDS PAGE (
Example 5 K.SUB.D .Determination of CaS1 scFv by ELISA and Competitive ELISA
[0114] 0.25 g of His-CaENO1 was added to each well of a 96 half area plate, and the plate was incubated at 37 C. for 1 hour to allow the adsorption of the proteins to the bottom of the wells. The proteins were discarded and 5% skimmed milk was added to the wells, and the plate was incubated at 37 C. for 1 hour for blocking. Meanwhile, 1 g/mL CaS1 was incubated with each 2-fold and 10 times serial diluted samples from 50 g/mL free form His-CaENO1 (i.e., 50 g/mL, 25 g/mL, 12.5 g/mL, 6.25 g/mL, 3.13 g/mL, 1.56 g/mL, 0.78 g/mL, 0.39 g/mL, 0.19 g/mL of free form His-CaENO1) at room temperature for 1 hour. Then, these samples were added to the coated and blocked wells described above and incubated at 37 C. for 1 hour for conducting a competition reaction. Thereafter, the wells were washed with PBST 6 times; then, goat anti-chicken light chain (1:3000 diluted) was added thereto and incubated at 37 C. for 1 hour. Thereafter, the wells were washed with PBST 6 times; then donkey anti-goat HRP antibody (1:5000 diluted) was added thereto and incubated at 37 C. for 1 hour. Thereafter, the wells were washed with PBST 6 times; then, the color reaction was initiated by adding 3,3,5,5-Tetramethylbenzidine (TMB), and the reaction was terminated by iN HCl. The absorbance at 450 nm wavelength was detected to get OD.sub.450. To determine the binding activity of CaS1 to CaENO1, ELISA (
Example 6 CaS1 scFv Binding to Cell Lysate of C. albicans and C. tropicalis
[0115] This CaS1 scFv was evaluated for its binding activity to different species of Candida. Five common strains of Candida were obtained, total lysate of five species Candida were analyzed on SDS-PAGE (
[0116] Furthermore, we exame the CaS1 scFv binding activity to fluconazole resistance and susceptible stains of Candida spp. from clinic. The Candida spp. and their MIC were listed in Table 2. As shown in
[0117] In addition, we also observed that CaS1 scFv can bind to different species of ENO1 as seen in
TABLE-US-00004 TABLE 2 Clinical fluconazole resistance and susceptible Candida spp. and their MIC. MIC Specimen organism drug (g/ml) Interpretation* CA6-17 C. albicans fluconazole 16 R CA7-26 C. albicans fluconazole 8 R CA7-3 C. albicans fluconazole 2 S CA10-50 C. albicans fluconazole 2 S CA7-30 C. albicans fluconazole 1 S CA10-65 C. albicans fluconazole 1 S CT6-29 C. tropicalis fluconazole 32 R CT11-52 C. tropicalis fluconazole 32 R CT6-50 C. tropicalis fluconazole 8 R CT12-54 C. tropicalis fluconazole 8 R CG5-8 C. glabrate fluconazole 64 R CG8-11 C. glabrate fluconazole 64 R CG7-37 C. glabrate fluconazole 32 S CG5-66 C. glabrate fluconazole 16 S CP8-20 C. parapsilosis fluconazole 256 R CP12-37 C. parapsilosis fluconazole 256 R CP6-20 C. parapsilosis fluconazole 16 R CP7-17 C. parapsilosis fluconazole 8 S CP8-48 C. parapsilosis fluconazole 4 S
*R for resistance; S for susceptible.
Example 7 Flow Cytometry Assay for Identification of CaS1 Antibody to Alpha-Enolase on Cell Surface of C. Albicans
[0118] Anti-CaENO1 IgY, scFv CaS1 and control scFv were contacted with C. albicans and then subjected to flow cytometry assay. Anti-CaENO1 IgY, scFv CaS1 and control scFv show 89.7+/2.8%, 46.64+/3.1% and 23+/2.3% FITC fluorescence reaction (
Example 8 Immunofluorescence Assay for Identification of CaS1 Antibody to Alpha-Enolase on Cell Surface of C. Albicans
[0119] Anti-CaENO1 IgY, scFv CaS1 and control scFv were used in immunofluorescence assay for identification of CaS1 antibody to alpha-enolase on cell surface of C. albicans. As shown in
Example 9 Attenuation of C. albicans Growth and Hyphal Formation by CaS1 scFv
[0120] We evaluated the influence of CaS1 on growth of C. albicans, we pre-incubated CaS1 scFv with C. albicans and plated on the agar. As seen in
[0121] Hyphal formation has also been shown to play a critical role in the virulence of the C. albicans. So we further investigated whether CaS1 scFv affects the hyphal formation. We pre-incubated CaS1 scFv with C. albicans and the colony morphology was examined. As seen in Figure. 9B, along the edge of the control colony, hyphae were clearly visible, whereas very little or none were observed for the CaS1 scFv treated colonies. The attenuation effect for hyphae formation is obvious when CaS1 scFv were pre-incubated with C. albicans.
Example 10 Inhibition of Binding of C. Albicans to Human Oral Keratinocyte OECM-1 Cells
[0122] C. albicans cells (110.sup.6) were treated with 50 g and 100 g of scFv CaS1, respectively, and the resulting mixtures were added to human oral keratinocyte OECM-1 cells to test the binding ability of C. albicans cells to OECM-1 cells. In comparison with the PBS control, the 50 g and 100 g of scFv CaS1 significantly reduced the binding of C. albicans cells to OECM-1 cells (
Example 11 Effect of CaS1 scFv on the Binding of ENO1 to Plasminogen
[0123] It is well known that surface ENO1 act as a plasminogen receptor 32, binding to plasminogen will activate it to plasmin and leading to the degradation of the fibrinogen (extracellular matrix) containing in the gel. We performed matrix-gel studies to test the possible biological significance of CaENO1-plasminogen association and the effect of CaS1 scFv on this binding was observed.
[0124] A representative plate was seen in
Example 12 Neutralization of C. Albicans Toxicity by ScFv CaS1 to Extend Survival Rate of Infected Mice
[0125] 110.sup.6 cells of C. albicans solutions were mixed with 100 g of each of the anti-CaENO1 IgY, scFv CaS1 and control scFv and then injected into ICR mice (5 mice for each group). After 10 days, the survival rates of the anti-CaENO1 IgY, scFv CaS1 and control scFv groups were 100%, 80% and 0%, respectively. It was found that the anti-CaENO1 IgY and scFv CaS1 can neutralize the toxicity of C. albicans and thus can extend the life of mice or protect the mice from death.
Example 13 Humanization of CaS1 scFv by CDR Grafting
[0126] Two humanized CaS1 scFv (V1 and V3) were designed. Humanized CaS1 scFv V1 was grafted onto human framework (Protein Data Bank: 2JIX-L, 2ZKH-H), this most suitable length sequence was analyzed by Discovery Studio software. Humanized CaS1 scFv V3 was grafted onto human framework that the sequence of Avastin (Protein Data Bank: 2FJG). These humanized CaS1 scFv (V1 and V3) were synthesized by Gemonics BioSci & Tech (New Taipei City, Taiwan), cloned into pComb3X vector, and transferred into Top 10 E. coli for protein expression. The expressed V1 and V3 proteins were purified by Ni.sup.+ sepharose and analyzed by SDS-PAGE and Western blot.
[0127] As the results shown in
Example 14 Determination Binding Ability of CaENO1 with hzCaS1 V1 and V3
[0128] The hzCaS1 V1, V3 and CaS1 scFv were used to recognize recombinant CaENO1 protein. As shown in
Example 15 K.SUB.D .Determination of hzCaS1 V1 and V3 scFv by ELISA
[0129] Purified hzCaS1 V1 and V3 scFv were used to recognize recombinant CaENO1 protein. The hzCaS1 V1 and V3 scFv were used as primary antibody with series dilution. The goat anti-chicken light chain IgG was used as secondary antibody. The HRP conjugated donkey anti-goat IgG was used to decet (see
Example 16 CaS1, hzCaS1 V1 and V3 scFv Inhibits CaENO1 Binding to Plasminogen
[0130] CaENO1 on Ni.sup.+ sepharose was treated with 100 ug hzCaS1 V1, V3 and CaS1 scFv for 1 hour, following incubating with plasminogen (20 ug) for 1 hour. Each experimental group of CaENO1 with CaS1 scFv were dropped onto gel and incubated at room temperature for 2 days to observe gel degrade result an the results are shown in
Example 17 Epitope Mapping of CaENO1 Using CaS1 scFv
[0131] Nine PCR-amplified fragments were obtained using full-length CaENO1 (1323 bp) as template, ligated into PET-21a vector and transformed into BL-21 E. coli. The identity of inserted fragments was confirmed by sequencing (Genomics BioSci & Tech, New Taipei City, Taiwan). Protein expression was carried out by IPTG induction. SDS-PAGE and Western blot were used to characterize the expressed recombinant proteins.
[0132] For epitope mapping of CaENO1, the purified CaS1 scFv was used to recognize recombinant CaENO1 protein on Western blot and ELISA. The epitope region was mapped to contain 198 bp nucleotides, which deduced amino acid sequences (residues 235 to 300) are DKAGYKGKVGIAMDVASSEFYKDGKYDLDFKNPESDPSKWLSGPQLADLYEQLISEYPIVS IEDPF (SEQ ID NO:19) (66 amino acids).
[0133] To further determine the epitopic location, site directed mutagenesis (Kunkel method) was used to construct nine peptide-expressing phages according to the nucleotide sequences of 198 bp of mapped antigenic fragment above mentioned with minor modification (Chapter 2, Constructing phage display libraries by oligonucleotide-directed mutagenesis on Phage Display-A Practical Approach, edited by Tim Clackson and Henry B. Lowman, OXFORD University Press 2004). The modified pCANTAB 5E DNAs carrying nucleotide sequences coding the antigenic epitopes were transformed into ER2738 E. coli. The phagemid DNAs were extracted from E. coli and analyzed for insertion with EcoRI enzyme restriction. Each resulting phage expressing 10 amino acids on viral particle surface was examined for their reactivity against CaS1 scFv antibody on ELISA. The combined results showed CaS1 scFv recognized the amino acid residues on antigenic epitopes located among .sub.240KGKVGIAMDV.sub.249 (SEQ ID NO:3) and .sub.278PQLADLYEQLISEYP.sub.292 (SEQ ID NO:4).
[0134] Nine recombinant CaENO1 proteins as above were used to recognize the purified plasminogen on dot blot. The results showed CaS1 scFv antibody binds to a fragment of plasminogen spanning amino acid residues 301 to 437, which sequences are AEDDWDAWVHFFERVGDKIQIVGDDLTVTNPTRIKTAIEKKAANALLLKVNQIGTLTESIQ AANDSYAAGWGVMVSHRSGETEDTFIADLSVGLRSGQIKTGAPARSERLAKLNQILRIEEEL GSEAIYAGKDFQKA (SEQ ID NO:20). The above results are shown in
Example 18 CaS1 scFv Prolongs the Survival Rate of ICR Mice Infected with C. albicans
[0135] We evaluated the survival rate of the CaS1 on animal model. Initially ICR mice were tail-vein injected with 110.sup.6 cells of C. albicans with PBS alone or cells pre-incubated with CaS1 (10 and 100 g) for one hour at 37 C. As seen in
Example 19 Candida albicans Biofilm Formation Inhibition Assay
[0136] Candida albicans cells were cultured in YPD medium and then collected. The cells were washed with PBS and resuspended in YPD medium containing 100 mM glucose at a cell density of 10.sup.7 cells/ml. A 96-well plate was treated with CaS1 scFv or fluconazole and then inoculated with 1 ml of the cell suspension. After a two-hour adhesion period, the inoculum was removed by washing with PBS, and YPD medium containing 100 mM glucose was applied to the plate. The plate was treated with CaS1 scFv or fluconazole and biofilms were grown for 72 hours at 37 C. The plate was washed with PBS, and then biofilm formation was observed by microscopy (