Langerin+ Cell Targeting
20210047620 ยท 2021-02-18
Inventors
- Christoph Rademacher (Potsdam, DE)
- Eike-Christian Wamhoff (Roxbury, MA, US)
- Jessica Schulze (Potsdam, DE)
- Robert Carsten Willi Wawrzinek (Berlin, DE)
- Oliver Seitz (Berlin, DE)
- Gunnar Bachem (Berlin, DE)
Cpc classification
A61K35/15
HUMAN NECESSITIES
A61K47/549
HUMAN NECESSITIES
C12N5/0639
CHEMISTRY; METALLURGY
G01N33/54353
PHYSICS
International classification
A61K35/15
HUMAN NECESSITIES
A61K35/36
HUMAN NECESSITIES
Abstract
The present invention relates to the use of a vehicle for specific molecular targeting of Langerin+ cells, wherein the vehicle is capable of specifically binding to a Langerin+ cell, said vehicle comprising (a) at least one carrier and (b) at least one saccharide moiety-based conjugate for a targeted cargo delivery into a Langerin+ cell, as well as pharmaceutical compositions and uses comprising the inventive vehicle.
Claims
1. A method of specifically targeting and delivering a cargo to Langerin.sup.+ cells, comprising: contacting a Langerin.sup.+ cell with a composition comprising: a vehicle capable of specifically binding to a Langerin.sup.+ cell, said vehicle comprising (a) at least one carrier and (b) at least one conjugate of the general formula (I) ##STR00026## wherein (i) R is independently selected from the group consisting of substituted or non-substituted alkyl, alkenyl, alkynyl, cycloalkyl, C.sub.1-C.sub.8 alkyl cycloalkyl, aryl, C.sub.1-C.sub.8 alkyl aryl, heteroaryl, C.sub.1-C.sub.8 alkyl heteroaryl, biaryl and C.sub.1-C.sub.8 alkyl biaryl, wherein, when substituted, the substituents are independently selected from the group consisting of N(R.sup.a)(R.sup.b), OR.sup.a, SR.sup.a, C(O)R.sup.a, C(O)OR.sup.a, C(O)N(R.sup.a)(R.sup.b), N(R.sup.a)C(O)R.sup.b, N(R.sup.a)S(O).sub.2R.sup.b, OS(O).sub.2R.sup.a, halogen, NO.sub.2, CN, NC, N.sub.3, NCO, OCN, NCS, SCN, substituted or non-substituted alkyl, alkenyl, alkynyl, aryl and heteroaryl, wherein R.sup.a and R.sup.b are independently selected from the group consisting of hydrogen, substituted or non-substituted C.sub.1-8 alkyl, C.sub.2-8 alkenyl, C.sub.2-8 alkynyl, C.sub.3-6 cycloalkyl, aryl-C.sub.1-5 alkyl, heteroaryl-C.sub.1-5 alkyl, aryl, heteroaryl; (ii) R is independently selected from the group consisting of OR.sup.a, and NHS(O).sub.2R.sup.a, wherein R.sup.a is defined as above; (iii) A-D-B-L is a linker group binding the glucose derivative of formula (I) covalently to the carrier or to a part of the carrier; and a cargo, thereby delivering the cargo to the Langerin.sup.+ cell.
2-8. (canceled)
9. The method of claim 1, wherein R is a substituted or non-substituted phenyl.
10-11. (canceled)
12. The method of claim 9, wherein the substituted or non-substituted phenyl is a substituted phenyl that is mono-, di- or trisubstituted, and substituents of the phenyl are independently selected from the group consisting of: NH.sub.2, OH, OCH.sub.3, C(O)CH.sub.3, C(O)NH.sub.2, C(O)NHCH.sub.3, CH.sub.2OH NHC(O)CH.sub.3, F, Cl, Br, NO.sub.2, CN, C.sub.1-C.sub.4 alkyl, naphtyl and phenyl-.
13. (canceled)
14. The method of claim 12, wherein said conjugate is a conjugate of one of the following formulas (I-1) to (I-15): ##STR00027## ##STR00028## ##STR00029## ##STR00030##
15-20. (canceled)
21. The method of claim 1, wherein said A-D-B-L linker group is a group consisting of a spacer A-D-B and a linker L, and wherein said linker L is a linker of the following general formula (L-1) ##STR00031## wherein U.sup.1 is a group connected via B with the spacer D, wherein U.sup.1 is selected from the group consisting of, CH.sub.2, CHCH, or CC; Z.sup.1 is a moiety binding the linker to the carrier selected from the group consisting of O, S, N(R.sup.d), C(R.sup.d)(R.sup.e), R.sup.dCCR.sup.e, C(O), C(O)O, OC(O), C(O)S, C(O)N(R.sup.d), N(R.sup.d)C(O), N(R.sup.d)C(O)N(R.sup.e), N(R.sup.d)C(S)N(R.sup.e), N(R.sup.d)C(O)O, OC(O)N(R.sup.d), -cyclohexene-, -triazoles-, NHS(O).sub.2, S(O).sub.2, OP(O)(H)O, or OP(O)(OH)O; wherein R.sup.d and R.sup.e are independently selected from the group consisting of hydrogen, substituted or non-substituted C.sub.1-32 alkyl, C.sub.2-32 alkenyl, C.sub.3-8 cycloalkyl, aryl, C.sub.1-C.sub.8 alkyl aryl, heteroaryl, C.sub.1-C.sub.8 alkyl heteroaryl; and d1 to d5 is each an integer from 0 to 50, d6 an integer from 1 to 50.
22-24. (canceled)
25. The method of claim 1, wherein said at least one carrier is a soft particle selected from the group consisting of a liposome, a niosome, a micelle, a Sequessome and a transferosome and wherein the conjugate is directly bound via Z.sup.1 to one part of the soft particle, wherein said one part of the soft particle is a lipid, a modified lipid such as a sequessome or a tranferosome, a phospholipid, 1,2-Distearoyl-sn-glycero-3-phosphoethanolamine (DSPE), a membrane lipid, modified phosphatidylcholine.
26. (canceled)
27. The method of claim 25, wherein the conjugate is bound to one part of a soft particle carrier resulting in the following structure (II): ##STR00032## wherein n is an integer from 0 to 150.
28-32. (canceled)
33. The method of claim 1, wherein said carrier comprises, or is associated to the cargo.
34. The method of claim 33, wherein said cargo is located within the carrier, is linked to the outside of the carrier, and/or is integrated into a mono- or bilayer structure of the carrier.
35-38. (canceled)
39. The method of claim 1, wherein the composition comprising the vehicle also comprises an additive.
40. The method of claim 39, wherein said additive is a divalent ion, preferably Ca.sup.2+ or Zn.sup.2+, an adjuvant, or a factor which promotes the binding to C-type lectin receptor (CLR) Langerin.
41-43. (canceled)
44. The method of claim 1, wherein said cargo is a small molecule, a peptide, a protein, a cytotoxic substance, a nucleic acid, a pigment, a dye, a metal, a radionuclide, a virus, a modified virus, a viral vector, an inoculant, a plasmid, and/or a multicomponent system, such as a system for genomic editing comprising different components, such as a CRISPR/Cas system; or is a pharmaceutically active compound or an immunologically active compound, preferably an inhibitor of cellular function, such as an inhibitor of apoptosis: or wherein said cargo comprises, essentially consists of or consists of (i) a cancer antigen or epitope or comprises a cancer antigen or epitope, (ii) an autoimmune disease antigen or epitope or comprises an autoimmune disease antigen or epitope, (iii) a bacterial antigen or comprises a bacterial antigen or epitope, (iv) a viral antigen or comprises a viral antigen or epitope, (v) a parasitic antigen or comprises a parasitic antigen or epitope, or (vi) an allergen, or an epitope of an allergen, or comprises an allergen or an epitope of an allergen.
45-48. (canceled)
49. A pharmaceutical composition comprising: a vehicle comprising (a) at least one carrier and (b) at least one conjugate of the general formula (I) ##STR00033## wherein (i) R is independently selected from the group consisting of substituted or non-substituted alkyl, alkenyl, alkynyl, cycloalkyl, C.sub.1-C.sub.8 alkyl cycloalkyl, aryl, C.sub.1-C.sub.8 alkyl aryl, heteroaryl, C.sub.1-C.sub.8 alkyl heteroaryl, biaryl and C.sub.1-C.sub.8 alkyl biaryl, wherein, when substituted, the substituents are independently selected from the group consisting of N(R.sup.a)(R.sup.b), OR.sup.a, SR.sup.a, C(O)R.sup.a, C(O)OR.sup.a, C(O)N(R.sup.a)(R.sup.b), N(R.sup.a)C(O)R.sup.b, N(R.sup.a)S(O).sub.2R.sup.b, OS(O).sub.2R.sup.a, halogen, NO.sub.2, CN, NC, N.sub.3, NCO, OCN, NCS, SCN, substituted or non-substituted alkyl, alkenyl, alkynyl, aryl and heteroaryl, wherein R.sup.a and R.sup.b are independently selected from the group consisting of hydrogen, substituted or non-substituted C.sub.1-8 alkyl, C.sub.2-8 alkenyl, C.sub.2-8 alkynyl, C.sub.3-6 cycloalkyl, aryl-C.sub.1-5 alkyl, heteroaryl-C.sub.1-5 alkyl, aryl, heteroaryl; ii) R is independently selected from the group consisting of OR.sup.a, and NHS(O).sub.2R.sup.a, wherein R.sup.a is defined as above; (iii) A-D-B-L is a linker group binding the glucose derivative of formula (I) covalently to the carrier or to a part of the carrier; a cargo, wherein the carrier comprises or is associated to a pharmaceutically active cargo, and a pharmaceutically acceptable carrier substance or a pharmaceutical adjuvant.
50-52. (canceled)
53. The method of claim 1, for use in the treatment or prevention of cancer, of an autoimmune disease, of a bacterial infection, of a viral infection, of a parasitic infection or of a graft-vs. host disease, of a local or systemic inflammation, of allergy, or for hyposensitization.
54. The pharmaceutical composition of claim 49, wherein the carrier comprises or is associated to a pharmaceutically active cargo.
55. (canceled)
56. A method of identifying a suitable dose for a Langerin.sup.+ dendritic cell-targeting therapy of a disease comprising: (a) contacting a population of Langerin.sup.+ cells with a compound capable of being introduced into the cells (b) determining the number of cells which incorporated said compound; (c) determining a suitable dose of the compound by comparing the number of cells with incorporated compound and the starting population, preferably after a period of 1-3 days, optionally by additionally correlating the number of cells with incorporated compound or their status with observed literature results.
57. A medical kit comprising the pharmaceutical composition of claim 49, wherein the carrier comprises or is associated to a pharmaceutically active cargo and optionally a leaflet with instructions.
58. The pharmaceutical composition of claim 49, wherein the carrier comprises or is associated to an inoculant cargo.
59-62. (canceled)
63. The pharmaceutical composition of claim 49, further comprising a pharmaceutical adjuvant.
64. The pharmaceutical composition of claim 49, wherein the cargo comprises: an immunogen; a cancer antigen or epitope; an autoimmune disease antigen or epitope; a bacterial antigen or epitope; a viral antigen or epitope; a parasitic antigen or epitope, an allergen or an epitope of an allergen; a DNA; an RNA; a gene-editing tool (e.g. CRISPR/Cas9); an adjuvant; a TLR agonist; an immunostimulant; a toxin; a lipid; or a small molecule drug.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0107]
[0108]
[0109]
[0110]
[0111]
[0112]
[0113]
[0114]
[0115]
[0116]
[0117]
[0118]
[0119]
[0120]
[0121]
[0122]
[0123]
[0124]
[0125]
[0126]
[0127]
[0128]
[0129]
[0130]
[0131]
[0132]
[0133]
[0134]
[0135]
[0136]
[0137]
[0138]
[0139]
[0140]
[0141]
[0142]
[0143]
[0144]
[0145]
DETAILED DESCRIPTION OF THE EMBODIMENTS
[0146] Although the present invention will be described with respect to particular embodiments, this description is not to be construed in a limiting sense. In the following definitions important for understanding the present invention are given.
[0147] As used in this specification and in the appended claims, the singular forms of a and an also include the respective plurals unless the context clearly dictates otherwise.
[0148] In the context of the present invention, the terms about and approximately denote an interval of accuracy that a person skilled in the art will understand to still ensure the technical effect of the feature in question. The term typically indicates a deviation from the indicated numerical value of 20%, preferably 15%, more preferably 10%, and even more preferably 5%.
[0149] It is to be understood that the term comprising is not limiting. For the purposes of the present invention, the term consisting of or essentially consisting of is considered to be a preferred embodiment of the term comprising of. If hereinafter a group is defined to comprise at least a certain number of embodiments, this is meant to also encompass a group, which preferably consists of these embodiments only.
[0150] Furthermore, the terms (i), (ii), (iii) or (a), (b), (c), (d), or first, second, third etc. and the like in the description or in the claims, are used for distinguishing between similar elements and not necessarily for describing a sequential or chronological order. It is to be understood that the terms so used are interchangeable under appropriate circumstances and that the embodiments of the invention described herein are capable of operation in other sequences than described or illustrated herein. In case the terms relate to steps of a method or use there is no time or time interval coherence between the steps, i.e. the steps may be carried out simultaneously or there may be time intervals of seconds, minutes, hours, days, weeks etc. between such steps, unless otherwise indicated.
[0151] It is to be understood that this invention is not limited to the particular methodology, protocols, reagents etc. described herein as these may vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to limit the scope of the present invention that will be limited only by the appended claims. Unless defined otherwise, all technical and scientific terms used herein have the same meanings as commonly understood by one of ordinary skill in the art.
[0152] As has been set out above, the present invention concerns in one aspect the use of a vehicle for specific molecular targeting of Langerin.sup.+ cells, wherein the vehicle is capable of specifically binding to a Langerin.sup.+ cell, said vehicle comprising (a) at least one carrier and (b) at least one conjugate of the general formula (I)
##STR00009## [0153] wherein [0154] (i) R is independently selected from the group consisting of [0155] substituted or non-substituted alkyl, alkenyl, alkynyl, cycloalkyl, C.sub.1-C.sub.8 alkyl cycloalkyl, aryl, C.sub.1-C.sub.8 alkyl aryl, heteroaryl, C.sub.1-C.sub.8 alkyl heteroaryl, biaryl, and C.sub.1-C.sub.8 alkyl biaryl; [0156] wherein the substituents are independently selected from the group consisting of N(R.sup.a)(R.sup.b), OR.sup.a, SR.sup.a, C(O)R.sup.a, C(O)OR.sup.a, C(O)N(R.sup.a)(R.sup.b), N(R.sup.a)C(O)R.sup.b, N(R.sup.a)S(O).sub.2R.sup.b, OS(O).sub.2R.sup.a, halogen, NO.sub.2, CN, NC, N.sub.3, NCO, OCN, NCS, SCN, substituted or non-substituted alkyl, alkenyl, alkynyl, aryl and heteroaryl; [0157] wherein R.sup.a and R.sup.b are independently selected from the group consisting of hydrogen, substituted or non-substituted C.sub.1-8 alkyl, C.sub.2-8 alkenyl, C.sub.2-8 alkynyl, C.sub.3-6 cycloalkyl, aryl-C.sub.1-5 alkyl, heteroaryl-C.sub.1-5 alkyl, aryl, heteroaryl; [0158] (ii) R is independently selected from the group consisting of [0159] OR.sup.a, and NHS(O).sub.2R.sup.a, [0160] wherein R.sup.a is defined as above; and wherein [0161] (iii) A-D-B-L is a linker group binding the glucose derivative of formula (I) covalently to the carrier or to a part of the carrier, [0162] for a targeted cargo delivery into a Langerin.sup.+ cell.
[0163] The use of a vehicle for specific molecular targeting of Langerin.sup.+ cells as described herein for a targeted cargo delivery into a Langerin.sup.+ cell may be either an in vivo use, e.g. in a therapeutic or diagnostic context, or an in vitro or ex vivo use.
[0164] The term conjugate as used herein relates to the combination of a glucose derivative as indicated in formula (I) which operates as a ligand for Langerin and a linker group of the form A-D-B-L wherein the elements A, D and B relate to or comprise a spacer functionality, as will be detailed further below, and wherein element L relates to a linker element, as will also be explained in more detail herein below.
[0165] Accordingly, a conjugate of the present invention is a part of a vehicle comprising the glucose derivative of formula (I)-ligand, the A-B-D-L linker group and a carrier, wherein said carrier is capable of carrying or transporting a cargo.
[0166] The term ligand as used herein refers to a molecule, peptide or protein that binds to a receptor protein, which alters the chemical conformation by affecting its three-dimensional shape orientation. The binding occurs by intermolecular forces, such as ionic bonds, hydrogen bonds and Van der Waals forces. The ligand as comprised in the vehicle of the invention is a ligand for Langerin also called glucose derivative, wherein Langerin is a homotrimeric type II transmembrane receptor and a subtype of C-type lectin receptors located on the surfaces of Langerhans cells, which may also be called CD207. The sequence of Langerin as used herein is represented by the wildtype version with the amino acid sequence of SEQ ID NO: 1, or being encoded by the nucleic acid having the nucleotide sequence of SEQ ID NO: 2. The present invention further envisages homologous variants thereof, e.g. amino acid sequence or nucleotide sequence variants having 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% or 99.5% homology with the sequence of SEQ ID NO: 1 or 2. Further envisaged are natural occurring SNP forms of of Langerin, for example, the SNP form V278A (rs741326, NCBI SNP database) with the amino acid sequence represented by SEQ ID NO: 3, encoded by the nucleic acid having the nucleotide sequence of SEQ ID NO: 4. Langerin containing the V278A SNP has a prevalence of 49.9% and has shown similar sugar binding as A278 (Ward et al., 2006. J Biol Chem, 281: 15450-6). Further information can be derived from the NCBI SNP database or a suitable literature source such as Feinberg et al., 2013, J. Biol Chem. 27, 288, 52, 36762-71. The present invention further envisages homologous variants thereof, e.g. amino acid sequence or nucleotide sequence variants having 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% or 99.5% homology with the sequence of SEQ ID NO: 3 or 4. Also envisaged are additional SNP variants such as N288D (rs13383830, NCBI SNP database) with the amino acid sequence represented by SEQ ID NO: 5, encoded by the nucleic acid having the nucleotide sequence of SEQ ID NO: 6; K313I (rs57302492, NCBI SNP database) with the amino acid sequence represented by SEQ ID NO: 7, encoded by the nucleic acid having the nucleotide sequence of SEQ ID NO: 8; and N288D/K313I with the amino acid sequence represented by SEQ ID NO: 9, encoded by the nucleic acid having the nucleotide sequence of SEQ ID NO: 10. The present invention further envisages homologous variants thereof, e.g. amino acid sequence or nucleotide sequence variants having 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% or 99.5% homology with the sequence of any one of SEQ ID NOs: 5 to 10. Further encompassed are codon optimized variants of Langerin. These variants may be adapted to the expression context envisaged, e.g. the codon optimization may be provided for bacterial strains, e.g. E. coli strains, for mammalian cells etc., as would be known to the skilled person. In a specific embodiment, a codon optimized sequence for Langerin containing a StreptagII and TEV site at the C-terminus, which can be used for expression in E. coli, is represented by the nucleotide sequence of SEQ ID NO: 29.
[0167] In specific embodiments, the Langerin may also be a molecule derived from non-human mammals, e.g. mice, monkeys, cows, pigs etc. In a particular embodiment, the present invention thus envisages the use of a mouse Langerin variant with the amino acid sequence represented by SEQ ID NO: 13, encoded by the nucleic acid having the nucleotide sequence of SEQ ID NO: 14. The present invention further envisages homologous variants thereof, e.g. amino acid sequence or nucleotide sequence variants having 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% or 99.5% homology with the sequence of SEQ ID NO: 13 or 14.
[0168] Thus, if reference is made to Langerin.sup.+, the presence of a Langerin receptor as defined herein above is contemplated. The term Langerin.sup.+ cell as used herein refers to a cell, preferably a dendritic cell (DC), e.g. a Langerhans cell, which displays at its surface the specific CLR Langerin. In certain embodiments, the cell may also be a cell of a different background.
[0169] Glycan-Langerin interactions as defined above have been found to be predominantly confined to a single monosaccharide and dominated by the coordination of the Ca.sup.2+ ion by two vicinal, equatorial hydroxyl groups. These hydroxyl groups are part of an extended hydrogen bond network formed between the monosaccharide, the Ca.sup.2+ ion and receptor residues including E285, E293, N297 and N307. Moreover, the equatorial acetamido group of N-acetyl glucosamine (GlcNAc) have been found to interact with the K299 via a structural H.sub.2O molecule and a weak hydrophobic contact of the methyl group with P310. Moreover, detailed analysis of glucosamine-2-sulfate (GlcNS) analogs via SAR have been conducted, which indicates that the introduction of the phenyl ring results in the aromatic interactions with K299, P310 or F315 resulting in increased affinities. Further design approaches showed favorable interactions, as is in detail described in the Examples section, herein. The introduction of a linker in C1 of the Glc scaffold via the formation of a beta-glucoside achieved potent targeting ligands. Due to these results, the vehicle may comprise a GlcNS-Structure, containing a linker structure in position C1, several substituent of the sulfate at position C2, equatorial hydroxyl groups in position C3 and C4 as well as a hydroxyl group or, a sulfonic acid or an uronic acid in position C6 of the GlcNS. Also envisaged are further functional groups.
[0170] The term specific molecular targeting as used herein comprises an interaction between the ligand as defined herein above, being part of a conjugate as defined herein, and the Langerin receptor present on a Langerin.sup.+ cell as defined herein. In a preferred embodiment the specific molecular targeting comprises an interaction between the ligand as defined herein above, being part of a vehicle as defined herein, and the Langerin receptor present on a Langerin.sup.+ cell as defined herein. In a further embodiment, the specific molecular targeting comprises interaction between said conjugate or vehicle and a receptor present on a Langerin.sup.+ cell.
[0171] The term vehicle for specific molecular targeting of Langerin.sup.+ cells as used herein thus relates to a vehicle, which is capable of a specific molecular targeting of Langerin.sup.+ cells.
[0172] This specific targeting as mentioned above is a specific binding of the vehicle as defined herein to a dendritic cell, in particular to a dendritic cell expressing Langerin. The specific binding takes place between the vehicle, namely the ligand part of the vehicle and the Langerin receptor on the surface of the cell. In specific embodiments, this binding shows a specificity which is at least 2-fold higher than a control in a cell-based assay comprising the introduction of liposomes under identical conditions into Raji B cells presenting recombinant Langerin, Raji B cells presenting recombinant DC-SIGN (control 1) and Raji wildtype B cells presenting no C-type lectin receptor (WT, control 2). In further, more preferred embodiments, the specificity is 4-, 5-, 6-, 7-, 8-, 9-, 10-, 11- or 12-fold higher than a control in a cell-based assay comprising the introduction of liposomes under identical conditions into Raji B cells presenting recombinant Langerin, Raji B cells presenting recombinant DC-SIGN (control 1) and Raji wildtype B cells presenting no C-type lectin receptor (WT, control 2). In particularly preferred embodiments, the specificity is 16-fold higher than a control in a cell-based assay comprising the introduction of liposomes under identical conditions into Raji B cells presenting recombinant Langerin, Raji B cells presenting recombinant DC-SIGN (control 1) and Raji wildtype B cells presenting no C-type lectin receptor (WT, control 2). The term DC-SIGN relates to a further dendritic cell-expressed receptor, which has the amino acid sequence of SEQ ID NO: 11 or is encoded by the nucleic acid having the nucleotide sequence of SEQ ID NO: 12. The present invention further envisages homologous variants thereof, e.g. amino acid sequence or nucleotide sequence variants having 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% or 99.5% homology with the sequence of SEQ ID NO: 11 or 12. Further encompassed are codon optimized variants of DC-SIGN. These variants may be adapted to the expression context envisaged, e.g. the codon optimization may be provided for bacterial strains, e.g. E. coli strains, for for mammalian cells etc., as would be known to the skilled person. In a specific embodiment, a codon optimized sequence for DC-SIGN containing a StreptagII and TEV site at the C-terminus, which can be used for expression in E. coli, is represented by the nucleotide sequence of SEQ ID NO: 52. In specific embodiments, the DC-SIGN may also be a molecule derived from non-human mammals, e.g. mice, monkeys, cows, pigs etc.
[0173] The assay to be performed in order to determine the specificity as mentioned above preferably comprises the steps as mentioned in Example 10.
[0174] Within the context of the present invention, a further Langerin related protein may be employed, e.g. for an assay format as described for DC-SIGN (see above). A preferred example of such a Langerin related protein is Dectin. It is particularly preferred that the Dection is mouse Dectin variant, or mDectin. The term mDectin relates to a C-type lectin domain family 7 member A, which has the amino acid sequence of SEQ ID NO: 15 or is encoded by the nucleic acid having the nucleotide sequence of SEQ ID NO: 16. The present invention further envisages homologous variants thereof, e.g. amino acid sequence or nucleotide sequence variants having 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% or 99.5% homology with the sequence of SEQ ID NO: 15 or 16. In specific embodiments, the Dectin may also be a molecule derived from humans, or other non-human mammals, e.g. monkeys, cows, pigs etc.
[0175] The term targeted cargo delivery as used herein relates to the transportation of a cargo, e.g. as defined herein below, to a targeted cell, e.g. a Langerin.sup.+ cell as defined herein, preferably a cell displaying Langerin at its surface. The transportation may include the introduction of the cargo into the cell, or may include an unloading of the cargo in the vicinity, e.g. at the surface of the cell. The cargo delivery may in any case involve an interaction of the ligand as defined herein with its cognate receptor, i.e. the Langerin as mentioned herein. The cargo delivery may depend and/or be adjusted in accordance with the carrier used, in particular the carrier as defined herein below. Certain carriers may require an introduction of the cargo into the cell, whereas other carrier may be used to unload the cargo at the surface of the cell or in the vicinity of the cell. The term delivery may include an unloading process of the cargo, but may also include a linkage of the carrier and cargo even after the ligand has bound to its target, i.e. the Langerin. In certain embodiments, delivery may include release of the carrier in the early endosomal compartment or the late endosomal compartment or the lysosome for further processing of the cargo. This release may, for example, be triggered by acidification of the endosomal compartment, by enrichment or depletion of co-factors of the receptor/ligand interaction such as Ca.sup.+, enzymatic digestion of the receptor, the targeting-ligand or the carrier. Further envisaged is a photoinduced drug release, which may, for example, be from thermosensitive AuNPs-liposome using an AuNPs-switch. In an alternative embodiment, the delivery may be based on thermos-sensitive liposomes or thermo-responsive magnetic liposomes. These liposomes may, for example, be designed to combine features of magnetic targeting and thermo-responsive control release for hyperthermia-triggered local drug delivery. Further details may, for example, be derived from Dai et al., 2017, J Microencapsul. 34(4): 408-415 or from Kneidl et al., 2014, Int J Nanomedicine, 9: 4387-4398.
[0176] As used herein, the term alkyl refers to a straight-chained or branched hydrocarbon group. The hydrocarbon having the indicated number of carbon atoms (e.g., C1-C8 alkyl refer to an alkyl group having from 1 to 8 carbon atoms). When the number of carbon atoms is not indicated, the alkyl group has from 1 to 100 carbon atoms. Examples of alkyl groups include methyl, ethyl, n-propyl, isopropyl, tert-butyl, and n-pentyl. Alkyl groups may be optionally substituted with one or more substituents.
[0177] The term alkenyl refers to an unsaturated hydrocarbon chain that may be a straight chain or branched chain, containing 2 to 100 carbon atoms and at least one carbon-carbon double bond. Alkenyl groups may be optionally substituted with one or more substituents.
[0178] The term alkynyl refers to an unsaturated hydrocarbon chain that may be a straight chain or branched chain, containing the 2 to 100 carbon atoms and at least one carbon-carbon triple bond. Alkynyl groups may be optionally substituted with one or more substituents.
[0179] A substituted group refers to any substitution of any pattern of that group. This group may be optionally substituted with one or more substituents, wherein the substituents may be of either the same type or different types. Substituents may be selected from the group comprising N(R.sup.a)(R.sup.b), OR.sup.a, SR.sup.a, C(O)R.sup.a, C(O)OR.sup.a, C(O)N(R.sup.a)(R.sup.b), N(R.sup.a)C(O)R.sup.b, N(R.sup.a)S(O).sub.2R.sup.b, OS(O).sub.2R.sup.a, halogen, NO.sub.2, CN, NC, N.sub.3, NCO, OCN, NCS, SCN, substituted or non-substituted alkyl, alkenyl, alkynyl, aryl and heteroaryl. Whereas the term non-substituted group refers to group, which is a hydrocarbon group.
[0180] As used herein, the term halogen, hal or halo means F, Cl, Br or I.
[0181] The term arylalkyl as used herein refers to a saturated or unsaturated hydrocarbon chain that may be a straight chain or branched chain, containing 1 to 100 carbon atoms and may contain carbon-carbon triple bond and/or sp2 hybridized carbons of double bonds. The aryl and/or the alkyl groups may be optionally substituted with one or more substituents. The sp2 or sp carbons of an alkenyl group and an alkynyl group, respectively, may optionally be the point of attachment of the alkenyl or alkynyl groups.
[0182] The term cycloalkyl refers to a hydrocarbon 3-8 membered monocyclic or 7-14 membered bicyclic ring system or a larger ring system of more than 15 ring members having at least one saturated ring or having at least one non-aromatic ring, wherein the non-aromatic ring may have some degree of unsaturation. Cycloalkyl groups may be optionally substituted with one or more substituents. In one embodiment, 0, 1, 2, 3, or 4 atoms of each ring of a cycloalkyl group may be substituted by a substituent. Representative examples of cycloalkyl group include cyclopropyl, cyclopentyl, cyclohexyl, cyclobutyl, cycloheptyl, cyclopentenyl, cyclopentadienyl, cyclohexenyl, cyclohexadienyl, and the like.
[0183] The term aryl refers to a hydrocarbon monocyclic, bicyclic or tricyclic aromatic ring system. Aryl groups may be optionally substituted with one or more substituents. In one embodiment, 0, 1, 2, 3, 4, 5 or 6 atoms of each ring of an aryl group may be substituted by a substituent. Examples of aryl groups include phenyl, naphthyl, anthracenyl, fluorenyl, indenyl, azulenyl, and the like.
[0184] The term biaryl refers to an aromatic ring system containing a substructure that is an assembly of two aromatic rings or aryl groups, if joined by a single bond. The aryl groups may be optionally substituted with one or more substituents. Examples of biaryl groups include biphenyl, binaphthyl and the like.
[0185] The term heteroaryl refers to a monocyclic, bicyclic or tricyclic aromatic ring system containing at least one heteroatom having carbon atoms (also referred to as ring members) and heteroatom ring members independently selected from N, O, P or S, and derived by removal of one carbon atom from a ring atom of a parent ring system. Examples of heteroaryl groups include furan, thiophene, pyrrole, thiazole, oxazole, pyridine, pyrazine, and the like.
[0186] The terms alkyl cycloalkyl, alkyl aryl, alkyl biaryl, and alkyl heteroaryl as used herein refer to a an saturated or unsaturated hydrocarbon chain that may be a straight chain or branched chain, containing 1 to 8 carbon atoms and may contain carbon-carbon triple bond and/or sp2 hybridized carbons of double bonds bound to cycloalkyl, aryl, biaryl or heteroaryl. The different cyclic structures are defined as above. The cycloalkyl, aryl, biaryl or heteroaryl and/or the alkyl groups may be optionally substituted with one or more substituents. The sp2 or sp carbons of an alkenyl group and an alkynyl group, respectively, may optionally be the point of attachment of the alkenyl or alkynyl groups.
[0187] In preferred embodiments, the residue R is independently selected from the group consisting of substituted or non-substituted alkyl, alkenyl, alkynyl, cycloalkyl, C.sub.1-C.sub.8 alkyl cycloalkyl, aryl, C.sub.1-C.sub.8 alkyl aryl, heteroaryl, C.sub.1-C.sub.8 alkyl heteroaryl, biaryl and C.sub.1-C.sub.8 alkyl biaryl. In another embodiment, the residue R is independently selected from the group consisting of substituted or non-substituted alkyl, cycloalkyl, C.sub.1-C.sub.8 alkyl cycloalkyl, aryl, C.sub.1-C.sub.8 alkyl aryl, heteroaryl, C.sub.1-C.sub.8 alkyl heteroaryl, biaryl and C.sub.1-C.sub.8 alkyl biaryl. In a more preferred embodiment, the residue R is independently selected from the group consisting of substituted or non-substituted C.sub.1-C.sub.6 alkyl, C.sub.3-C.sub.6 cycloalkyl, C.sub.1-C.sub.3 alkyl C.sub.3-C.sub.6 cycloalkyl, C.sub.6-C.sub.14 aryl, C.sub.1-C.sub.3 alkyl C.sub.6-C.sub.14 aryl, heteroaryl, C.sub.1-C.sub.3 alkyl heteroaryl, biaryl and C.sub.1-C.sub.3 alkyl biaryl. In a more preferred embodiment, the residue R is independently selected from the group consisting of substituted or non-substituted cyclohexyl, phenyl, benzyl, biphenyl, pyridyl, or oxazolyl. In another preferred embodiment, the residue R is a substituted or non-substituted phenyl.
[0188] The substituents of the residue R may be any suitable substituent, which is not hindering the ligand in binding to Langerin. Moreover, the substituents can be one or more substituents of either the same type or different types. The substituents of R may have any substitution pattern. In one embodiment, the substituents of the residue R are independently selected from the group consisting of N(R.sup.a)(R.sup.b), OR.sup.a, SR.sup.a, C(O)R.sup.a, C(O)OR.sup.a, C(O)N(R.sup.a)(R.sup.b), N(R.sup.a)C(O)R.sup.b, N(R.sup.a)S(O).sub.2R.sup.b, OS(O).sub.2R.sup.a, halogen, NO.sub.2, CN, NC, N.sub.3, NCO, OCN, NCS, SCN, substituted or non-substituted alkyl, alkenyl, alkynyl, aryl and heteroaryl. R.sup.a and R.sup.b may be independently selected from the group consisting of hydrogen, substituted or non-substituted C.sub.1-8 alkyl, C.sub.2-8 alkenyl, C.sub.2-8 alkynyl, C.sub.3-6 cycloalkyl, aryl-C.sub.1-5 alkyl, heteroaryl-C.sub.1-5 alkyl, aryl, heteroaryl. In a preferred embodiment, R.sup.a and R.sup.b may be independently selected from the group consisting of hydrogen, methyl and ethyl.
[0189] More preferably, the substituents of the residue R are independently selected from the group consisting of NH.sub.2, OH, OCH.sub.3, C(O)CH.sub.3, NHC(O)CH.sub.3, F, Cl, Br, NO.sub.2, CN, C.sub.1-C.sub.4 alkyl and phenyl, biphenyl, and naphthyl. In a preferred embodiment, the residue R is a substituted phenyl residue. This phenyl residue may be substituted with 5 substituents. More preferably, the phenyl residue may be mono-, di- or trisubstituted. In a most preferred embodiment, the residue R is a monosubstituted phenyl residue, wherein the substituents are selected from the group consisting of NH.sub.2, OH, OCH.sub.3, C(O)CH.sub.3, C(O)NH.sub.2, C(O)NHCH.sub.3, CH.sub.2OH NHC(O)CH.sub.3, F, Cl, Br, NO.sub.2, CN, C.sub.1-C.sub.4 alkyl, naphthyl and phenyl. In a further preferred embodiment, the substituents are in para position to the ligand. In a further preferred embodiment, the substituents in para position and the substituents of the phenyl are independently selected from the group consisting of NHC(O)CH.sub.3, CN, CH.sub.3, F, C(O)NH.sub.2, NH.sub.2, C(O)NHCH.sub.3, CH.sub.2OH and phenyl. In a further preferred embodiment, the substituents are in meta position to the ligand.
[0190] In another embodiment, R may be independently selected from the group consisting of OR.sup.a, and NHS(O).sub.2R.sup.a, wherein R.sup.a is defined as above. In a preferred embodiment, R may be selected from the group consisting of OH, OCH.sub.3, OCH.sub.2CH.sub.3, or NHS(O).sub.2R.sup.a, wherein R.sup.a is defined as above. In a more preferred embodiment, OH or NHS(O).sub.2R.sup.a, wherein R.sup.a is defined as above. In a more preferred embodiment, R is OH, NHS(O).sub.2CH.sub.3 or N-tosyl. In the most preferred embodiment, R is OH.
[0191] In yet another preferred embodiment, the conjugate as mentioned above is a conjugate of the following formula (I-1) or (I-2):
##STR00010##
[0192] In a still further preferred embodiment, the conjugate as mentioned above is a conjugate of any one the following formulas (I-3) to (I-15):
##STR00011## ##STR00012## ##STR00013## ##STR00014##
[0193] The wordings A-D-B-L linker group, A-D-B-L, or linker group refer to a group consisting of a spacer A-D-B and a linker L. The group connects the glucose derivative-ligand with the carrier. In a typical embodiment, on the one end the linker L of the general formula (I), as described above, is bound via a spacer A-D-B to the Langerin ligand structure as defined above, which comprises the glucose derivative of formula (I). The spacer A-D-B is covalently bound to position C1 of the mentioned glucose derivative. Also envisaged is that the spacer A-D-B is covalently bound to position C6 of the mentioned glucose derivative.
[0194] In certain embodiments, the A-D-B-L linker group between the ligand and the carrier is a molecular chain. In a preferred embodiment, said main chain may have a total number of carbon atoms, nitrogen atoms and oxygen atoms contained in the main chain of at least 4, preferably of between 4 atoms to 600 atom, more preferably of between 15 atoms to 400 atoms, and still more preferably of between 25 atoms to 200 atoms, e.g. 25, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190 and 200 atoms. In another embodiment, the length of main chain of the linker may be about 0.4 nm to about 400 nm, and more preferably about between 0.6 nm and 100 nm, e.g. 0.6, 0.8, 1, 2, 4, 8, 10, 20, 30, 40, 50, 60, 70, 80, 90 and 100 nm. The size or the length of the linker may be measured via analytical centrifugation measurements or SAXS measurements, e.g. as described in Fuji et al., ACS Symposium Series, 2017, 1271, Control of Amphiphile Self-Assembling at the Molecular Level: Supra-Molecular Assemblies with Tuned Physicochemical Properties for Delivery Applications, Chapter 5, pages 115-129. An average chain length may be measured via suitable measurement techniques, e.g. as discussed in Needham and Kim, 2000, Colloids and Surfaces B: Biointerfaces, 18, 3-4, 183-195 or in Stepniwieski et al., 2011, Langmuir, 27(12), 7788-7798.
[0195] The term linker L or L as used herein further refer to a compound, which can be used to link the Langerin ligand of the invention as defined herein above and a carrier, either directly, or indirectly, e.g. via the spacer A-D-B. The provided linkage may be conveyed by any suitable chemical connection, preferably via covalent bonds.
[0196] In a preferred embodiment, said linker L may comprise one or more of synthetic polymers or natural polymers or one or more single units of those polymers or a combination thereof. The linker of the present invention is preferably biocompatible and/or biodegradable. The linker may, in certain embodiments, be a synthetic water-soluble polymer that dissolves, disperses or swells in water and, thus, modify the physical properties of aqueous systems in the form of gelation, thickening or emulsification/stabilization. In a preferred embodiment, the synthetic polymer may be a saturated or unsaturated hydrocarbon polymer; a polyamine; a polyamide; a polyester; a polyether, such as polyethylene glycol, polypropylene glycol; a block copolymer or a poloxamer. In particularly preferred embodiments, the linker is a polyethylene glycol. In corresponding, specific embodiments, the polyethylene glycol linker may have a length of about 0 to 150, more preferably 1 to 100, still more preferably 3 to 50 of the (CH2-CH2-O) repeating units. Further examples of suitable polymers are polyvinyl pyrrolidone, polyvinyl pyrrolidone-vinyl acetate copolymer, polyvinyl alcohol, polystyrene, polyacrylic acid, polyacylamides, N-(2-hydroxypropyl) methacrylamide and polyoxazoline.
[0197] In a preferred embodiment, natural polymers, which may be suitable linkers, are selected from a group consisting of carbohydrates, modified carbohydrates, peptides, modified peptides, lipids and modified lipids.
[0198] The term carbohydrate as used herein relates to any natural or synthetic carbohydrate. The term may further comprise trioses, tetroses, pentoses, hexoses and heptoses. Carbohydrates may be aldoses or ketoses. Carbohydrates may be in D- or in L-form. Carbohydrates may comprise one or more monosaccharides or disaccharides. The carbohydrate may form an oligosaccharide including 3 to 9 monosaccharides. The carbohydrate may also be a polysaccharide, which contains more than 9 monosaccharides. The term monosaccharide comprises, but is not limited to threose, ribulose, glucose, fructose, galactose, xylose, ribose, arabinose and mannose. Monosaccharides contained in disaccharides, oligosaccharides and polysaccharides may be linked to each other in any configuration. The term disaccharide comprises, but is not limited to sucrose, lactose, and maltose. The term oligosaccharide comprises, but is not limited to maltodextrins and cellodextrins. The term polysaccharide comprises, but is not limited to starch, cellulose, and chitin. Natural carbohydrates comprise natural monosaccharides. Synthetic carbohydrates may comprise D- and L-, modified, synthetic, unusual monosaccharides and monosaccharides derivatives. A monosaccharide derivative also called modified carbohydrates includes monosaccharides having substitutions or modifications by covalent attachment of a parent monosaccharides, such as, e.g., by alkylation, acetylation, phosphorylation, and the like. Further included within the definition of monosaccharides derivative are, for example, one or more analogs of a monosaccharide with substituted linkages, as well as other modifications known in the art. Preferred carbohydrates are mannose, glucose, fucose or xylose. In certain embodiments also inositols may be used.
[0199] The term lipid as used herein relates to any natural or synthetic lipid. It may accordingly comprise fatty acids and their derivatives including tri-, di-, monoglycerides, and phospholipids, glycerolipids, glycerophospholipids, sphingolipids, saccharolipids, polyketides, sterol lipids and prenol lipids, including DSPE (1,2-distearoyl-sn-glycero-3-phosphoethanolamine), DPPC (1,2-Dipalmitoyl-sn-glyceroyl-3-phosphocholine), DPPE (1,2-Dipalmitoyl-sn-glyceroyl-3-phosphoethanolamine), DMPC (1,2-Dimyristoyl-sn-glyceroyl-3-phosphocholine), DSPC (1,2-Distearoyl-sn-glyceroyl-3-phosphocholine), membrane lipids, and phosphatidylcholine as well as modified versions thereof. Preferred lipids are DPPC (1,2-Dipalmitoyl-sn-glyceroyl-3-phosphocholine), DPPE (1,2-Dipalmitoyl-sn-glyceroyl-3-phosphoethanolamine), DMPC (1,2-Dimyristoyl-sn-glyceroyl-3-phosphocholine), DSPC (1,2-Distearoyl-sn-glyceroyl-3-phosphocholine) or DSPE (1,2-distearoyl-sn-glycero-3-phosphoethanolamine). The term modified lipids is a lipid having one or more modifications. A modification of such a lipid may comprise an acetylation, glycosylation, alkylation, combination with a chelator or a further functionalization such as provision of pH sensitivity, addition of carbon acids, biotin, amines, thioethanol, azide groups etc. The lipids may further be combined with flexibility, elasticity and/or permeability enhancers. Further details are known to the skilled person or can be derived from suitable literature sources such as Benson, 2017, Methods Mol. Biol., 1522: 107-117, Sala et al., 2018, Int J. Pharm. 535 Molecular Cell Biology, 201(1-2), 1-17 or Harayama and Riezman, Nature Reviews, 2018 8, 19, 281-296.
[0200] The term peptide as used herein relates to any type of amino acid sequence comprising more than 2 amino acids or functional derivatives thereof. Furthermore, the peptide may be combined with further chemical moieties or functionalities, or may be a synthetic peptide. Natural peptides typically comprise natural amino acids. Synthetic peptides may comprise D- and L-, modified, synthetic, or not naturally occurring amino acids and amino acids derivatives. Natural peptides comprise natural amino acids. Synthetic peptides may comprise D- and L-, modified, synthetic, unusual amino acids and amino acids derivatives. An amino acid derivative includes an amino acid having substitutions or modifications by covalent attachment of a parent amino acid, such as, e.g., by alkylation, glycosylation, acetylation, phosphorylation, and the like. Further included within the definition of amino acid derivative is, for example, one or more analogs of an amino acid with substituted linkages, as well as other modifications known in the art. A natural amino acid refers to arginine, glutamine, phenylalanine, tyrosine, tryptophan, lysine, glycine, alanine, histidine, serine, proline, glutamic acid, aspartic acid, threonine, cysteine, methionine, leucine, asparagine, isoleucine, and valine, unless otherwise indicated by context. A preferred peptide according to the present invention may be oligo-L-glutamic acid or oligo-L-lysine. Other preferred peptides may be amphipathic peptides connecting to lipid-based carriers by insertion, e.g. of the sequence VLTTGLPALISWIKRKRQQ (SEQ ID NO: 81), with a short N-terminal di-L-glycine linker. Peptides may be distinguished from polypeptides. A polypeptide may, for example, have a length of more than 20 to 50 amino acids. In certain embodiments, the linker may also be a polypeptide linker. The term protein as used herein relates to an arrangement of one or more polypeptides. Accordingly, a protein may comprise or consist of one polypeptide and thus by synonymous to polypeptide. In other embodiments, a protein may comprise 2 or more polypeptides which may be organized in units or subunits of a higher order structure in the form of a protein.
[0201] Further examples of natural polymers, which are water soluble and may be suitably used as linkers in the context of the present invention are pectin, chitosan derivatives, xanthan gums, chitosan derivatives, dextran, cellulose ethers, hyaluronic acid, casein, carrageenan, starch and starch derivatives and the like.
[0202] In certain embodiments, the linker may merely be a covalent bond. In such a scenario, a carrier structure may be directly bound to the spacer A-D-B.
[0203] In a preferred embodiment, said linker L is a linker of the following general formula (L-1)
##STR00015##
[0204] wherein [0205] U.sup.1 is a group connected via B with the spacer D, wherein U.sup.1 is selected from the group consisting of, CH.sub.2, CHCH, or CC; U.sup.1 may also be a single bond; preferably U1 is CH2- or a covalent bond [0206] Z.sup.1 is a moiety binding the linker to the carrier selected from the group consisting of O, S, N(R.sup.d), C(R.sup.d)(R.sup.e), R.sup.dCCR.sup.e, C(O), C(O)O, OC(O), C(O)S, C(O)N(R.sup.d), N(R.sup.d)C(O), N(R.sup.d)C(O)N(R.sup.e), N(R.sup.d)C(S)N(R.sup.e), N(R.sup.d)C(O)O, OC(O)N(R.sup.d), -cyclohexene-, -triazoles-, NHS(O).sub.2, S(O).sub.2, OP(O)(H)O, or OP(O)(OH)O; Z.sup.1 may also be a single bond; preferably the Z.sup.1 is a covalent bond, an amide or a carbonyl group; [0207] wherein R.sup.d and R.sup.e are independently selected from the group consisting of hydrogen, substituted or non-substituted C.sub.1-32 alkyl, C.sub.2-32 alkenyl, C.sub.3-8 cycloalkyl, aryl, C.sub.1-C.sub.5 alkyl aryl, heteroaryl, C.sub.1-C.sub.5 alkyl heteroaryl; and [0208] d1 to d5 is each an integer from 0 to 100, preferably an integer from 0 to 50, such as 0, 1, 2, 3, 4, 6, 8, 10, 12, 15, 20, 25, 30, 35, 40, 45, or 50; d6 an integer from 1 to 100, preferably an integer from 1 to 50, such as 1, 2, 3, 4, 6, 8, 10, 12, 15, 20, 25, 30, 35, 40, 45 or 50.
[0209] As described in more detail below the carrier or ligand can be prepared using a section of the linker L unit having a reactive site for binding to the ligand. To synthesize the conjugate, the linker may be provided as a bifunctional ligand or bifunctional unit. The linker L unit may accordingly have a reactive site, which has a nucleophilic group that is reactive with an electrophilic group present on a ligand unit or a carrier unit. Alternatively, the ligand unit or a carrier unit may accordingly have a reactive site, which has a nucleophilic group that is reactive with an electrophilic group present on the linker L unit. The electrophilic group on a ligand unit or a carrier unit provides a convenient site for attachment to a linker unit, or alternatively, the electrophilic group on the linker L unit provides a convenient site for attachment to a ligand unit or a carrier unit. Useful electrophilic groups on a ligand or linker unit include, but are not limited to, aldehyde and ketone carbonyl groups. The heteroatom of a nucleophilic group of a linker unit can react with an electrophilic group on a ligand and form a covalent bond to the ligand. Alternatively, the heteroatom of a nucleophilic group of a ligand unit can react with an electrophilic group on a linker and form a covalent bond to the linker. Useful nucleophilic groups on a linker unit or ligand unit include, but are not limited to, hydrazide, oxime, amino, hydrazine, thiosemicarbazone, hydrazine carboxylate, and acylhydrazide. In certain embodiments, a bifunctional linker may be used, which carries one OH group or which may, for example, be a general nucleophile, and an additional functional group. The second functional group can be any nucleophile carrying an orthogonal protecting group or a functional group compatible with glycosylation reactions and global deprotection methods. The bifunctional element may subsequently be reacted with the anomeric center of the monosaccharide via the OH group. Subsequently the monosaccharide and the second functional group are deprotected. The product may then be conjugated to a corresponding PEGylated lipid.
[0210] The term spacer as used herein refers to any structure covalently connecting the linker with the glucose derivative-ligand of the invention as defined herein above. In a preferred embodiment, said spacer group A-D-B comprises D as a spacer connected with A and B of the general formula (D-1)
A-(CH.sub.2).sub.c(CH.sub.2O).sub.c1(CH.sub.2CH.sub.2O).sub.c2(CH.sub.2).sub.c3B(D-1),
wherein [0211] D is connected to the linker L via B, wherein B is selected from the group consisting of [0212] O, S, C(R.sup.c1)(R.sup.c2), SS, N(R.sup.c1), C(O), C(R.sup.c1)N, NN, OC(O), C(O)O, C(O)N(R.sup.c1), N(R.sup.c1)C(O), N(R.sup.c1)C(O)N(R.sup.c2), N(R.sup.c1)C(S)N(R.sup.c2), N(R.sup.c1)C(O)O, OC(O)N(R.sup.c1), -cyclohexene- and -triazoles-; B may also be a single bond; preferably B is a covalent bond, an amide or a carbonyl group; [0213] wherein R.sup.c1 and R.sup.c2 are independently selected from the group consisting of hydrogen, substituted or non-substituted alkyl, alkenyl, cycloalkyl, C.sub.1-C.sub.8 alkyl cycloalkyl, aryl, C.sub.1-C.sub.8 alkyl aryl, heteroaryl, and C.sub.1-C.sub.8 alkyl heteroaryl; preferably R.sup.c1 and R.sup.c2 are independently selected from the group consisting of hydrogen and methyl; [0214] D is connected to the glucose derivative via A, wherein A is selected from the group consisting of O, CH.sub.2, S, NH, NHC(O), OC(O), -cyclohexene- and -triazoles-; A may also be a single bond; preferably A is a covalent bond, an amide or a carbonyl group; [0215] c is an integer selected from 0 to 20, preferably c is 0, 1, 2, or 3; c1 is an integer selected from 0 to 20, preferably c1 is 0, 1, 2, or 3; and c2 is an integer selected from 0 to 20, preferably c2 is 0, 1, 2, or 3; c3 is an integer selected from 1 to 20, preferably c3 is 1, 2, or 3; if A is CH.sub.2 c3 is an integer selected from 0 to 20. The spacer group D may be a single bond, one or more methylene glycol groups, one or more ethylene glycol groups or an hydrocarbon or a mixture thereof. The spacer is more preferably a group selected of a single bond, CH.sub.2, CH.sub.2CH.sub.2, or CH.sub.2CH.sub.2O. A and B may be therefore connected via a single bond.
[0216] The term carrier as used herein refers to any structure, which may be able to carry a cargo to a cell or group of cells. The cargo may accordingly be associated, i.e. bound to the carrier, or may be comprised, embraced or encompassed by the carrier. The carrier may, in particularly preferred embodiments, also be advantageously capable of introducingupon previous interaction of the associated ligand, i.e. in the context of the above defined conjugate or vehicle, with the targeted cellthe transported cargo into said cell. The carrier may, in specific embodiments, comprise one or more types of cargo. These cargos may be connected to the carrier in an identical or different manner. For example, one cargo type may be bound to the carrier, e.g. at the outside, and a different cargo type may be embraced or encompassed by the carrier.
[0217] According to certain embodiments of the present invention, the carrier may be linked or associated to the conjugate as defined herein in a 1:1 ratio, i.e. one carrier is bound to one conjugate. In a further embodiment, the carrier may be bound to more than one conjugate. In a particular embodiment, the carrier is bound to less than 10 conjugates. In a more preferred embodiment, the carrier may be bound to less than 100 conjugates. In another preferred embodiment, the carrier may be bound to less than 200 conjugates. In further embodiments, the ratio between carrier and conjugate may be variable, e.g. adjusted to the carrier form, intended cargo, secondary binding intentions etc. For example, a ratio of 1:2, 1:3, 1:4, 1:5, 1:10, 1:15, 1:20, 1:25, 1:30, 1:35, 1:40, 1:50, 1:60, 1:70, 1:80, 1:90, 1:100 or 1:200 or more or any ratio (integer values) in between the mentioned ratios between the carrier and the conjugate may be provided. In further, alternative embodiments, also a ratio of one conjugate to more than one carrier may be provided. Accordingly, a ratio of 2:1, 3:1, 4:1, 5:1, 10:1, 15:1, 20:1, 25:1, 30:1 or more or any ratio in between the mentioned ratios between the carrier and the conjugate may be provided.
[0218] In specific embodiments, the carrier may be a soft particle. The term soft particle as used herein relates to particles, which are elastic, deformable and typically biodegradable or non-biopersistent. Preferred examples of soft particles are liposomes, niosomes, micelles, Sequessome and transfersomes. A soft particle as defined above may comprise or be composed of different types of constituents, e.g. lipids. A soft particle may, for example, comprise one or more types of phospholipids; in addition, a soft particle may comprise additional component which may, for example, have an influence on the stability, rigidity, binding capabilities, penetration capabilities for cells, secondary targeting capabilities etc. An example of components is cholesterol, which typically reduces the fluidity of a bilayer structure and increases the stability of a liposome. In a particularly preferred embodiment, the soft particle is a liposome. It is particularly preferred that the particle comprises 57% DSPC, 38% cholesterol and 5% DSPE-PEG.
[0219] A liposome is a spherical vesicle having at least one bilayer of lipids, e.g. as defined herein above. The liposomes may comprise phospholipids, e.g. phosphatidylcholine, or include other lipids such as phosphatidylethanolamine. The liposome may be provided in the form of a multilamellar vesicle (MLV), i.e. comprising several lamellar phase lipid bilayers, as a small unilamellar liposome vesicle (SUV), i.e. comprising one lipid bilayer, or a large unilamellar vesicle (LUV). The liposome typically has an aqueous solution core surrounded by a hydrophobic membrane. Accordingly, hydrophobic compounds dissolved in the core cannot pass through the bilayer, unless said bilayer is opened, e.g. by the introduction of a pore, or unless the bilayer fuses with a further bilayer structure, e.g. a cell membrane, and thereby delivers the liposome content to the core of the second bilayer, e.g. the cell. In turn, hydrophobic compounds typically associate with the lipid bilayer and may thus be loaded to said compartment of the liposome. Alternatively, the liposome may be delivered to a cell by the elicitation of an endocytosis or phagocytosis event. Liposomes may have different sizes, largely depending on the nature of the lipid, the lamellar structure and the presence of additional factors in the lipid bilayer, e.g. cholesterol. For example, the size of the liposome may range between a few nanometers and up to 2000 nm. The size of the liposomes may be measured with any suitable assay known to the skilled person, preferably with dynamic light scattering (DLS).
[0220] In a particularly preferred embodiment, the liposome is a bilayer phospholipid liposome. It is envisaged by the present invention that the size of said bilayer phospholipid liposome is between 10 to 500 nm. The size of the liposome may, for example, be 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 120, 140, 150, 160, 180, 200, 220, 240, 250, 260, 280, 300, 350, 400, 450 or 500 nm. Preferably, the size is between 30 and 250 nm, e.g. 40, 50, 60, 70, 80, 90, 100, 120, 140, 150, 160, 180, 200, 220, 240, or 250 nm. Also envisaged are further sized in between the mentioned sizes.
[0221] The preferred size of approximately 140 nm of liposomes was found to give a reproducible liposome stability over several months.
[0222] Liposomes including the bilayer phospholipid liposome may contain one or more additional components. One example of these additional components is cholesterol. In a preferred embodiment, cholesterol may be comprised in the liposome preferably in an amount of about 20 to 50 mol %, e.g. in an amount of about 20 mol %, 25 mol %, 30 mol %, 35 mol %, 40 mol %, 45 mol % or 50 mol %, or any suitable value in between the mentioned values. More preferably, it may be present in an amount of about 40%.
[0223] Liposomes may further preferably be composed of phospholipids, more preferably of phosphatidylcholines, but may also include other lipids, such as egg phosphatidylethanolamine, as long as they are compatible with lipid bilayer structure. Particularly envisaged examples of phospholipids include POPC (1-Palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine), DPPG (1,2-Dipalmitoyl-sn-glycero-3[Phospho-rac-(1-glycerol), DSPC (1,2-Distearoyl-sn-glycero-3-phosphocholine), DOPC (1,2-Dioleoyl-sn-glycero-3-phosphocholine), DSPE (1,2-Distearoyl-sn-glycero-3-phosphoethanolamine), DMPC (1,2-Dimyristoyl-sn-glycero-3-phosphocholine), DPPC (1,2-Dipalmitoyl-sn-glycero-3-phosphocholine), DMPE (1,2-Dimyristoyl-sn-glycero-3-phosphoethanolamine), DPPE (1,2-Dipalmitoyl-sn-glycero-3-phosphoethanolamine), DMPA.Na (1,2-Dimyristoyl-sn-glycero-3-phosphate (sodium salt)), DPPA.Na (1,2-Dipalmitoyl-sn-glycero-3-phosphate (sodium salt)), DOPA.Na (1,2-Dioleoyl-sn-glycero-3[Phospho-rac-(1-glycerol) (sodium salt),) DMPG.Na (1,2-Dimyristoyl-sn-glycero-3[Phospho-rac-(1-glycerol) (sodium salt)), DPPG.Na (1,2-Dipalmitoyl-sn-glycero-3[Phospho-rac-(1-glycerol) (sodium salt)), DMPS.Na (1,2-Dimyristoyl-sn-glycero-3-phosphoserine (sodium salt)), DPPS.Na (1,2-Dipalmitoyl-sn-glycero-3-phosphoserine (sodium salt)), and DOPS.Na (1,2-Dioleoyl-sn-glycero-3-phosphoserine (sodium salt)).
[0224] The term niosome as used herein refers to a non-ionic surfactant-based vesicle. Typically, a noisome is formed by non-ionic surfactant of the alkyl or dialkyl polyglycerol ether class and cholesterol with subsequent hydration in aqueous media. Niosomes are structurally similar to liposomes in having a bilayer, but are more stable due to their composition. These are small unilamellar vesicles (SUV, size=0.025-0.05 m), multilamellar vesicles (MLV, size=>0.05 m), and large unilamellar vesicles (LUV, size=>0.10 m). Examples of surfactants used for the preparation of niosomes include sorbitan monostearate (Span-60), polyoxyethylene alkyl ether, and Span 40 (C16 G2).
[0225] A micelle as used in the context of the present invention means an aggregate of surfactant molecules, e.g. phospholipids, block copolymers or triblock copolymers, dispersed in a liquid. A typical micelle in aqueous solution forms an aggregate with the hydrophilic head regions in contact with surrounding solvent, sequestering the hydrophobic single-tail regions in the micelle centre. The micelle has hence a monolayer structure. Micelles form beyond the critical micelle concentration and typically display a diameter between 1 and 100 nm. Polymeric micelles are generally more stable and typically monodisperse with diameters between 20 and 50 nm. Further details may be derived from suitable literature sources such as Soussan et al., 2009, Angew Chem Int Ed Engl. 48(2), 274-88. Besides these normal-phase micelles, there is a further group of differently shaped inverse micelles where the hydrophilic head groups are at the centre of the micelle with the tails extending out. The shape and size of a micelle are a function of the molecular geometry of its surfactant molecules and solution conditions such as surfactant or polymer concentration, temperature, pH, and ionic strength. Examples of envisaged surfactants include cationic surfactants such as DeTAB, DTAB, TTAB, or CTAB; anionic surfactants such as SDS or SDC; Zwitter-ionic surfactants such as SB-14 or CHAPS; or non-ionic surfactants such as NOG, Tween 20, Tween 80 or Triton X. Due to their increased stability, polymeric micelles are a preferred embodiment of the present invention. According to particularly preferred embodiments, these polymeric micelles comprise polyethyleneoxide- or biodegradable carbohydrate- and glycerol-base polymers, which may be used for the hydrophilic moiety. The hydrophobic moiety may preferably be composed of biodegradable lactate-based polymers. In another preferred embodiment micelles composed of pH-sensitive block copolymers are provided. Such micelles may be generated by inclusion of basic or acidic functional groups, which advantageously may change the solubility of the polymers and therefore the stability of the micelles at varying pH values.
[0226] The term sequessomes as used herein relates to ultra-deformable, hydrophilic spheres made from phospholipid and surfactant molecules arranged as a bilayer. The inclusion of surfactants softens the bilayer membrane making sequessome vesicles flexible, but also stable, allowing them to pass through the skin intact and penetrate deep into the body without requiring injection or skin permeation enhancers. Further details may be derived, for example, from Benson, 2017, Methods Mol. Biol., 1522: 107-117, or Sala et al., 2018, Int J. Pharm. 535 (1-2), 1-17.
[0227] The term transferosome as used herein relates to a carrier aggregate composed of at least one amphipath, which in aqueous solvents self-assembles into a lipid bilayer that closes into a simple lipid vesicle. Typically, the amphipath is phosphatidylcholine. By addition of at least one bilayer softening component, e.g. a biocompatible surfactant or an amphiphile drug, the lipid bilayer flexibility and permeability may be increased. The resulting transfersome is optimized for flexibility and permeability, and can therefore adapt its shape to ambient conditions easily and rapidly by adjusting local concentration of each bilayer component to the local stress experienced at the bilayer. The transferosome typically differs from more conventional vesicles or liposomes primarily by its softer, more deformable, and better adjustable artificial membrane. The transferosome further typically has an increased affinity to bind and retain water. Without wishing to be bound by theory, it is assumed that ultradeformable and highly hydrophilic vesicles, such as transferosomes, tend to avoid dehydration, which may involve a transport process related to forward osmosis. Advantageously, a transfersome applied on an open biological surface, in particular skin, tends to penetrate its barrier and migrate into the water-rich deeper strata to secure adequate hydration. Barrier penetration may involve reversible bilayer deformation, but must not compromise either vesicle integrity or barrier properties for the underlying hydration affinity and gradient to remain unimpaired. Further details may be derived, for example, from Benson, 2017, Methods Mol. Biol., 1522: 107-117, or Sala et al., 2018, Int J. Pharm. 535 (1-2), 1-17.
[0228] In certain embodiments of the present invention, a part of the soft particle, e.g. an interacting moiety or compound, is bound directly via a covalent bond or via [0229] a moiety selected from the group consisting of O, S, N(R.sup.d), C(R.sup.d)(R.sup.e), R.sup.dCCR.sup.e, C(O), C(O)O, OC(O), C(O)S, C(O)N(R.sup.d), N(R.sup.d)C(O), N(R.sup.d)C(O)N(R.sup.e), N(R.sup.d)C(S)N(R.sup.e), N(R.sup.d)C(O)O, OC(O)N(R.sup.d), -cyclohexene-, -triazoles-, NHS(O).sub.2, S(O).sub.2, OP(O)(H)O, or OP(O)(OH)O; [0230] wherein R.sup.d and R.sup.e are independently selected from the group consisting of hydrogen, substituted or non-substituted C.sub.1-32 alkyl, C.sub.2-32 alkenyl, C.sub.3-8 cycloalkyl, aryl, C.sub.1-C.sub.8 alkyl aryl, heteroaryl, C.sub.1-C.sub.8 alkyl heteroaryl, [0231] e.g. via Z.sup.1, as defined herein above, to the linker group A-D-B-L of the conjugate as defined herein above.
[0232] The term one part of the soft particle refers to a typical constituent of a soft particle, e.g. of a liposome, such as a lipid, a modified lipid, a phospholipid, 1,2-distearoyl-sn-glycero-3-phosphoethanolamine (DSPE), a membrane lipid, or a modified phosphatidylcholine, or cholesterol, which is covalently connected to the Langerin ligand as defined herein via the A-D-B-L linker group. In certain embodiments, the conjugate comprising the Langerin ligand and the A-D-B-L linker group may comprise a hydrophobic region, which is named herein also a tail region, as well as a hydrophilic region, which also comprises the Langerin ligand, also termed head region. In specific embodiments, the tail region of the conjugate may be embedded in a lipid bilayer structure, whereas the head region is placed outside of the carrier and thus capable of interacting with receptors. An example of this embedding is schematically depicted in
[0233] In a preferred embodiment, the conjugate is bound to one part of a soft particle carrier resulting in the following formula (II-a):
##STR00016## [0234] wherein p and q are each independently integers between 6 and 30; more preferably p and q are each independently integers between 8 and 28, still more preferably p and q are each independently 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27 and 28; n is an integer from 0 to 150, preferably an integer from 10 to 100 and more preferably an integer from 20 to 75. In a more preferred embodiment, n is 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 75. In the most preferred embodiment, n is 45.
[0235] In a more preferred embodiment, the conjugate is bound to one part of a soft particle carrier resulting in the following formula (II):
##STR00017## [0236] wherein the average number of ethylene glycol units n is an integer from 0 to 150, preferably an integer from about 20 to 110 and more preferably an integer from about 40 to 70.
[0237] In a more preferred embodiment, n is about 40, 50, 55, 60, or 70. In the most preferred embodiment, n is about 59. In specific embodiments a PEG linker is used. Particularly preferred is 3-(N-succinimidyloxyglutaryl)aminopropyl, polyethyleneglycol-carbamyl distearoylphosphatidyl-ethanolamine. The PEG linker may have any suitable weight. For example, the weight may be between about 1500 to 10 000 Da, e.g. 1500, 2000, 2500, 3000, 3200, 3500, 4000, 4500, 5000, 6000, 7000, 8000, 9000 or 10 000 Da or any value in between the mentioned values. Also envisaged is range of about 2000 to 5000 Da. It is particularly preferred to use a PEG linker having a molecular weight of 2000 Da.
[0238] In further preferred embodiments, the carrier may have a solid structure, be a nanoparticle, peptide, protein, toxin, dendrimer, fullerene or a carbon nanotube. The conjugate may be directly bound via a covalent bond to the carrier, or via [0239] a moiety selected from the group consisting of O, S, N(R.sup.d), C(R.sup.d)(R.sup.e), R.sup.dCCR.sup.e, C(O), C(O)O, OC(O), C(O)S, C(O)N(R.sup.d), N(R.sup.d)C(O), N(R.sup.d)C(O)N(R.sup.e), N(R.sup.d)C(S)N(R.sup.e), N(R.sup.d)C(O)O, OC(O)N(R.sup.d), -cyclohexene-, -triazoles-, NHS(O).sub.2, S(O).sub.2, OP(O)(H)O, or OP(O)(OH)O; [0240] wherein R.sup.d and R.sup.e are independently selected from the group consisting of hydrogen, substituted or non-substituted C.sub.1-32 alkyl, C.sub.2-32 alkenyl, C.sub.3-8 cycloalkyl, aryl, C.sub.1-C.sub.8 alkyl aryl, heteroaryl, C.sub.1-C.sub.8 alkyl heteroaryl; [0241] e.g. via Z.sup.1, as defined herein above to the carrier. In a further embodiment, the conjugate may additionally be bound via an additional spacing element to the carrier.
[0242] The term spacing element as used herein, refers to any suitable group or a natural or synthetic polymer. It is particularly preferred that said natural or synthetic polymer is a natural or synthetic polymer as defined above.
[0243] The term nanoparticle as used herein relates to particles between 1 and 1000 nm, preferably between 5 nm and 1000 nm, in size, typically with a surrounding interfacial layer. A nanoparticle essentially behaves as a whole unit in terms of its transport and properties. Particles and hence their surfaces may accordingly be of a symmetrical, globular, essentially globular or spherical shape, or be of an irregular, asymmetric shape or form. The particle size (and hence the dimension of the surface) may vary. Preferred are particles and particle surfaces in the nanometer range up to several hundred nanometer. Particularly preferred are nanoparticles of about 1 to 700 nm. Particularly preferred are nanoparticles which may have a diameter of about 10 to 600 nm, e.g. 10 nm, 15 nm, 20 nm, 25 nm, 30 nm, 35 nm, 40 nm, 45 nm, 50 nm, 60 nm, 70 nm, 80 nm, 90 nm, 100 nm, 120 nm, 150 nm, 170 nm, 200 nm, 220 nm, 250 nm, 270 nm, 300 nm, 320 nm, 350 nm, 370 nm, 400 nm, 420 nm, 450 nm, 470 nm, 500 nm, 520 nm, 550 nm, 570 nm, 600 nm, 620 nm or any value in between. Even more preferred are nanoparticles having a diameter of about 500 nm. Nanoparticles may be constituted of any suitable material known to the person skilled in the art, e.g. they may comprise or consist of or essentially consist of inorganic or organic material. Typically, they may comprise or consist of or essentially consist of metal or an alloy of metals, or an organic material, or comprise or consist of or essentially consist of carbohydrate elements, or a mixture of the before mentioned materials. Examples of envisaged material further include agarose, polystyrene, latex, polyvinyl alcohol, silica and ferromagnetic metals, alloys or composition materials. Further envisaged examples of nanoparticle materials include gold, silver, silicon, cerium oxide, iron, titanium dioxide, zinc oxide, clay, aluminium oxide, copper oxide, metal carbides, metal nitrides, e.g. aluminium nitride or silicon nitride, aluminium or copper.
[0244] Typically, the ionic charge of the surface or the surface coating of nanoparticles determines many of their physical and chemical properties, including stability, solubility, and targeting. For biological applications as currently foreseen, the coating is envisaged to give high aqueous solubility and to prevent nanoparticle aggregation. On the cell surface, highly charged coatings typically promote non-specific binding, whereas polyethylene glycol linked to terminal hydroxyl or methoxy groups may repel non-specific interactions.
[0245] In certain embodiments, the nanoparticle may comprise one or more surface layers. It is, for example, envisaged that a first layer or shell structure is present. Also envisaged are multi-layer or mesh structures. Such structures may, for example, comprise PEG, biotin and streptavidin as structural components. The shell structure may comprise a conjugate according to the present invention, or, in addition, further affinity molecules, e.g. antibodies, ligands for a variety of receptors, protein interactors, lectins etc. In further specific embodiments, the multivalency of streptavidin typically leads to a mesh of non-affine spacer molecules on the surface of the nanoparticle. Such mesh structure around an interacting or targeting molecule, e.g. the conjugate according to the present invention, or an additional affinity molecule as mentioned above, the unspecific binding of molecules or entities to the interacting or targeting molecule or the affinity molecule or to molecules in its vicinity may be reduced, or completely abrogated or avoided.
[0246] In further embodiments, the nanoparticle may be composed of or have a biodegradable structure. The term biodegradable as used herein means that the nanoparticle can be disassembled or disintegrated by natural processes occurring in a cell or in the surrounding of a cell, i.e. outside of a cell. The biodegradable nanoparticles may accordingly have an enhanced biocompatibility, good encapsulation capability for cargos such as nucleic acids, proteins or small-molecule drugs. Biodegradable nanoparticles can be prepared from a variety of materials such as proteins, polysaccharides and synthetic biodegradable polymers. The selection of the base polymer is based on various designs and end application criteria. It depends on many factors such as size of the desired nanoparticles, properties of the cargo (aqueous solubility, stability, etc.) to be encapsulated in the polymer, surface characteristics and functionality, degree of biodegradability and biocompatibility, and cargo release profile of the final product. Depending upon selection of desired criteria for the preparation of the nanoparticles, the methods to be used for the production of biogradable nanoparticles may include dispersion of preformed polymers, polymerization of monomers and ionic gelation method for hydrophilic polymers. Particularly preferred is the employment of poly-lactic acid (PLA), poly-D-L-glycolide (PLG), poly--caprolactone (PCL), poly-D-L-lactide-co-glycolide (PLGA) and poly-cyanoacrylate (PCA), chitosan, gelatin, Poly-alkyl-cyano-acrylates (PAC). The most preferred variant of the biodegradable nanoparticles are PLGA nanoparticles. For example, the nanoparticle or polymeric structures present on the surface of the nanoparticle may be degradable by enzymes such as lipases, esterases, alcalases, hydroxylases, dioxygenases etc.
[0247] In further specific embodiments of the present invention, the nanoparticle carrier may be associated with or provide a cell-penetrating agent. Such an agent may, for example, be the polyArg peptide TAT, the penetratin peptide, a polyarginine or polynliysine peptide, a peptide comprising cationic nuclear localization signal sequences, cationic moieties linked to scaffolds, e.g. peptides, oliogocarbamates, oligomers or PNA oligomers. Further details may be derived from suitable literature sources such as Fillon et al., 2005 J. Am. Chem. Soc, 127, 11798-11803.
[0248] In specific embodiments, nanoparticles may further be linked to biological molecules that direct the nanoparticles to specific sites within the body, specific organelles within the cell, or to follow specifically the movement of individual protein or RNA molecules in living cells. Such affinity molecules may include, besides the conjugates as defined herein, aptamers or peptides. These affinity molecules are typically covalently linked to the nanoparticle or to the layers on their surface. It is preferred that said conjugates or affinity molecules are present in a controlled number per nanoparticle. Multivalent nanoparticles, comprising more than one conjugate according to the present invention, bearing multiple targeting groups, can cluster receptors, which may activate certain cellular signalling pathways, and give stronger anchoring. Monovalent nanoparticles, bearing a single binding site or a single conjugate, tend to avoid clustering. In preferred embodiments, multivalent nanoparticles are provided. The amount of conjugates per nanoparticle may be adjusted to the size of the nanoparticle. For example, a ratio of 2:100 or 5:100 conjugates per nanoparticles may be used within the context of the present invention.
[0249] The linkage between the conjugate according to the present invention and the nanoparticle may be provided in any suitable form. For example, the linkage may be achieved through intermolecular attractions between the nanoparticle and biomolecule such as covalent bonding, adsorption, such as chemisorption, and noncovalent interactions. The linkage may, in certain embodiments, be an integration of liposomes into a bilayer structure, e.g. of a cell. In further embodiments the linkage may be implemented via a ligand which is covalently linked to a receptor structure on a cell. Further envisaged are nanoparticles which penetrate a cell or which are adsorbed to a cell. It is particularly preferred to make use of an uptake of liposomes via an endosomal pathway. Without wishing to be bound by theory, it is assumed that delivered liposomes will be released in the endosomal compartment. The release of the cargo itself from the bilayer of the liposome may subsequently be provided by lipases that are assumed to destroy the liposome in the late endosome or lysosomal compartment. It is preferred that the release of the cargo be performed in early endosomes. Additional factors, which may have an influence on the cargo release are the pH, which may, in certain embodiments, be influenced or changed to control said cargo release. The present invention further envisages an adaptation of the endosome form via the concentration and/or composition of the lipid bilayer of the liposomes.
[0250] The nanoparticle as envisaged by the present invention is to be used as carrier for cargo transport. Accordingly, the nanoparticle is linked to one or more cargo molecules as described herein, which are typically provided on the surface of the particle. These cargo molecules may also be linked to the nanoparticle in any suitable form, e.g. via intermolecular attraction, covalent bonding, adsorption, such as chemisorption, and noncovalent interactions. The amount of cargo per nanoparticle may be adjusted in view of the size of the nanoparticle, its material, its form and the size and/or form of the cargo. Typically, a ratio of 1 nanoparticle: 1-1000 cargo entities may be given.
[0251] In further embodiments, the nanoparticle may be provided as a magnetic nanoparticle, e.g. as superparamagnetic particle. Accordingly, preferred materials are magnetic or ferromagnetic metals, alloys or compositions. Such particles may particularly be used in the context of magnetic resonance imaging techniques. It is particularly preferred that the nanoparticle is a gold, silver or iron nanoparticle.
[0252] The nanoparticles may be provided as colloid or comprised within a colloid. The term colloid as used herein relates to a colloidal system, wherein polymolecular particles are dispersed in a medium, having at least one dimension of between 1 nm and 1 m. Alternatively, in the systems discontinuities may be found at distances between 1 nm and 1 m. Typically, a colloid is a mixture which has solid particles, e.g. nanoparticles as defined herein, dispersed in a liquid medium. The term typically applies if the particles are larger than atomic dimensions but small enough to exhibit Brownian motion, with the particle diameter typically ranging from nanometers to micrometers.
[0253] The term peptide carrier or protein carrier as used herein relates to peptide or protein structures as defined herein above, which fulfil a role as carrier. As such, the peptide or protein may itself be connected to one or more different molecules. Such a connection is, for example, a covalent binding to a further molecule via a side chain of an amino acid. Alternatively, the peptide or protein may be connected to further elements via non-covalent binding, e.g. intermolecular attractions, chemisorption, electrostatic attractions etc. In further, specific embodiments, the peptide or protein carrier may itself have one or more additional functions. Typically, the peptide or protein carrier may have the function of an antigen or have a vaccine function, e.g. representing an exposed or surface protein of a pathogen such as a bacterium, a virus, a eukaryotic parasite, or a cancer antigen or allergen.
[0254] The term toxin carrier or toxin as used herein in the context of carriers relates to a toxic compound which provides at least two functionalities (a) to poison, disturb, kill or damage a biological element, e.g. a cell or tissue and (b) to transport a cargo, e.g. as defined herein. To work as a cargo, the toxin may be linked, e.g. by covalent or non-covalent binding, to said cargo, e.g. an antigen, small molecule etc. The binding is optimized so that the domain leading to the killing, damaging or poisoning functionality is not impeded or negatively influenced. Examples of toxins to be used in the context of the present invention are small molecules, peptides, or proteins. These compounds may interact with biological macromolecules such as enzymes or cellular receptors. Toxins may vary greatly in their toxicity, ranging from usually minor toxicity such as a bee toxin to severe toxicity in the case of botulinum toxin. Preferred toxin carriers according to the present invention are cholera toxin, E. coli enterotoxin, pertussis toxin, botulinum toxin, Clostridium botulinum C2 toxin, Clostridium perfringens iota toxin, or streptolysin O.
[0255] The carrier may further be a dendrimer. The term dendrimer as used herein relates to repetitively branched molecules, which have tree-like structure. The dendrimers are typically characterized by structural perfection, and are comprised of monodisperse and symmetric spherical compounds. Dendrimers are typically considered to have three major portions: a core, an inner shell, and an outer shell. A dendrimer may, for example, be designed to have different functionality in each of these portions to control properties such as solubility, thermal stability, and attachment of compounds for particular applications. Dendrimers may be composed of a polymethylmethacrylate (PMMA), polystyrene, polyacetylene, polyphenylene, polythiophene, polyfluorene, poly(phenylene vinylene), poly(phenylene acetylene), polysiloxane, polyoxanorbornene, oligospiroketal, polyglycerol or poly(ethylene imine) (PEI) backbone, whose methyl group is replaced by a dendron structure. Particularly preferred are PMMA dendrimers. The resulting polymers may differ in thickness and charge, as well as the weight, ranging from low molecular weight to high molecular weight structure. The dendrimers may be linked to or comprise a cargo element to be transported. For example, the cargo may be linked by covalent or non-covalent binding to said cargo, e.g. an antigen, small molecule etc. The binding may be based on the formation of an ester, amide, triazole, amine or ether.
[0256] In further embodiments, the carrier may be a fullerene. The term fullerene as used herein relates to a molecule of carbon in the form of a hollow sphere, ellipsoid or tube or any other suitable hollow shape. A subtype of fullerenes is the Buckminsterfullerene or buckyball, which resembles a football and comprises pentagonal and hexagonal rings. Fullerenes may, in specific embodiments, comprise C69, C79, C76, C82, C84, C86, C88, C90, C92, C94, C96, C98 or C100 structures. A further alternative, which is also envisaged by the present invention is a boron based fulleren, e.g. with a B80 structure. Also envisaged are heterofullerenes comprising, for example, hetero atoms at some positions such as boron, nitrogen, oxygen or phosphor atoms. In further embodiments, the fullerenes may be provided as metal fullerenes, e.g. as graphite rods doped with metals or metal oxides typically of the Sc, Y, La, lanthanide series or actinide elements. Also envisaged are trimetallic nitride templated metallofullerenes, clusterfullerenes or trimetaspheres which contain a central nitrogen atom (nitride) bonded to three metal ions. In typical embodiments, the fullerenes may be functionalized or derivatized to increase the solubility of the fullerenes in organic media or aqueous media, e.g. by cycloproponation, polyhydroxylation, or cycloaddition of azmethine ylides. In a specific embodiment, the fullerene may be detivatized with free radicals, which allows to scavenge for reactive oxygen species and renders the fullerene a highly active antioxidant. In another embodiment, the fullerene may transport cargos in a non-covalent association. One possibility is that the cargo, e.g. a protein, antibody, nucleic acid etc. is associated to the fullerene's surface via supramolecular interactions, or hydrophobic interactions, electrostatic interactions etc. In case of nucleic acid cargo transport, the carrier may preferably be a n-tetra(piperazino) fullerene epoxide derivative, or a cyclopropanated C60 fullerene, e.g. with neutral, cationic or anionic functional groups. In further embodiments, fullerene-immunoconjugates may be provided, where, for example, a disulfide bond is present between the fullerene and, e.g. an antibody. In this context, it is preferred to use a C60 malonodiserinolamide fullerene derivate, which may allow for non-covalent, spontaneous binding between the antibody or protein and the fullerene. In further preferred embodiments, fullerenes may be used in a configuration and derivatization, which allows for an aggregation into fullerene-based micelle, vesicle or liposome-like structures. These structures may encompass any suitable drug molecule in their hydrophobic core. In yet another group of embodiments, there may be a covalent attachment of cargos to the fullerene carrier. This may typically be provided with an additional linker element between the fullerene and the cargo molecule which is present on the surface of the fullerene. This allows, inter alia, for delayed cargo release. Further envisaged are glycofullerenes which may be connected to further entities via the formation of triazole linkages. Further details would be known to the skilled person or can be derived from suitable literature sources such as Bolskar, 2016, Encyclopedia of Nanotechnology, Springer, or Muoz et al., 2016, Nature Chemistry, 8, 50-57.
[0257] In further embodiments, the carrier may have the form of a carbon nanotube. The term carbon nanotube as used herein relates to allotropes of carbon with a cylindrical nanostructure. These cylindrical carbon molecules typically have unusual properties, which may be used for cargo transportation and delivery activities. Carbon nanotubes typically show a vey high strength and stiffness. They are typically constructed with length-to-diameter ratio of up to 132,000,000:1. Carbon nanotubes further typically have a high thermal conductivity. They typically have a long, hollow structure with walls formed, e.g. by one-atom-thick sheets of carbon, which are typically called graphene. These sheets are typically rolled at specific and discrete angles, and the combination of the rolling angle and radius may decide the nanotube properties with respect to strength, stiffness etc. Nanotubes are typically categorized as single-walled nanotubes (SWNTs) and multi-walled nanotubes (MWNTs), which are both envisaged by the present invention. Nanotubes may further align into rope-like structures, which are assumed to be held together by van der Waals forces.
[0258] Carbon nanotubes are generally considered to belong to the fullerene structural family. In certain embodiments of the present invention the carbon nanotubes may be modified as described herein above in the context of fullerenes. Particularly preferred are linkages between carbon nanotubes and nucleic acids, proteins and peptides. Further envisaged are modifications via free carboxylic acids, which may be connected to further entities via the formation of ester or amine linkages.
[0259] In certain embodiments, the carrier as defined herein above may be used with or without cargo. In case the carrier is used without cargo, it may itself provide a functionality as described herein. In further embodiments, the carrier comprises or is associated to a cargo. The form in which the cargo is connected to the carrier may depend on the carrier form/nature as well as on the cargo form/nature. In some cases a covalent linkage may be envisaged, whereas in other cases a electrostatic linkage may be used. In some other embodiments, the association may be based on an embedding of cargo elements in a liposome or similar structure. For example, the cargo may be located within the carrier and/or be linked to the outside of the carrier and/or be integrated into a mono- or bilayer structure of the carrier, e.g. a liposome as mentioned herein above.
[0260] The term cargo as used herein refers to any suitable substance, compound or element, which is located within the carrier as defined above and/or is linked or associated to the outside, e.g. surface, of the carrier and/or is integrated into a mono- or bilayer structure of the carrier, e.g. in case the carrier is an entity comprising a membrane or bilayer such as a liposome and should be transported to the interior of a cell, a specific cell compartment, e.g. an endosome, or to the surface or surrounding of a cell. It is preferred that the cargo is unloaded into the interior of a cell. It is preferred that the cargo provides or mediates a beneficial effect to cell, the tissue comprising the cell, or the organism comprising the cell in a medical context. Examples of such beneficial effects are therapeutic activity/capabilities, diagnostic activity/capabilities, following delivery to or into a cell. This may be performed in vivo, but also, in certain embodiments ex vivo, e.g. in an in vitro environment, typically with an option of reintroduction into the organism afterwards, for instance via re-implantation of cells. A therapeutic activity may include treatment, amelioration and/or prophylaxis/avoidance of a disease or medical condition. The term diagnostic activity may include visualizing, detecting, distinguishing and/or identifying a pathological/medical condition and attributing the deviation to a clinical picture.
[0261] Preferably, a cargo relates, but is not limited, to a small molecule, a peptide, a protein, a cytotoxic substance, a nucleic acid, a colorant, a pigment, a dye, a metal, a radionuclide, a virus, a modified virus, a viral vector, an inoculant, a plasmid and/or a multicomponent system.
[0262] A peptide or protein as used herein in the context of the cargo is a peptide as defined herein above or a protein as defined herein above. It is preferred that such a peptide or protein fulfils a function for the cell to which the cargo is transported, or the organism which comprises said cell. Such function could be a therapeutic or diagnostic function. The peptide or protein may be derived from any suitable category. For example, it may be an antigenic element, an antibody, an enzyme, an allergen, a toxin, a catalysing entity, a receptor etc. In specific embodiments, the protein as part of the cargo according to the present invention may be selected from the group comprising: therapeutic proteins, suicide proteins, tumor suppressor proteins, transcription factors, kinase inhibitors, kinases, regulatory proteins, apoptotic proteins, anti-apoptotic proteins, microbial antigens, viral antigens, bacterial antigens, parasitic antigens, cellular antigens, cancer antigens, differentiation factors, immortalisation factors, protein/peptide toxin, enzymes, peptide/protein hormones, peptide/protein adhesion-molecules, receptor-molecules, peptide inhibitors or peptide/protein antiaging agents.
[0263] The term therapeutic protein as used herein in the context of the cargo relates to any protein, which has a therapeutic effect on the animal body, in particular on the human body as known to a person skilled in the art. Typically, the term relates to a therapeutic enzyme. Examples of such enzymes are alglucerase, which may be used in treating lysosomal glucocerebrosidase deficiency (Gaucher's disease), alpha-L-iduronidase, which may be used in treating mucopolysaccharidosis I or adenosine deaminase, which may be used in treating severe combined immunodeficiency syndrome.
[0264] The term suicide protein as used herein in the context of the cargo relates to any protein, which leads to the destruction of a cell due to the action of the protein, typically due to an enzymatic reaction in the presence of a corresponding substrate. Examples of such proteins are nucleoside kinases, such as the HSV-1 TK or multisubstrate deoxyribonucleoside kinase of Dm-dNK.
[0265] The term tumor suppressor protein as used herein in the context of the cargo relates to any protein, which protects a cell from one step on the path to cancer. Preferably, the term relates to any such protein known to the person skilled in the art. More preferably, the term relates to Rb protein, the p53 tumor suppressor, APC and CD95.
[0266] The term transcription factor as used herein in the context of the cargo relates to any protein, which binds to specific parts of DNA using DNA binding domains and is part of the system that controls the transcription of genetic information from DNA to RNA as known to the person skilled in the art. Preferably, the term relates to TFIIA, TFIIB, TFIID, TFIIE, TFIIF, TFIIH and TATA binding protein (TBP).
[0267] The term kinase inhibitors as used herein in the context of the cargo relates to any protein, which is a type of enzyme inhibitor that specifically blocks the action of protein kinase. Preferably, the term relates to Erbitux (cetuximab), and herceptin. The present invention of course also envisages the use of non-protein kinase inhibitors, which may, for example, be small organic molecules as defined herein.
[0268] The term kinase as used herein in the context of the cargo relates to any protein, which transfers phosphate groups from high-energy donor molecules, such as ATP, to specific target molecules. Preferably, the term relates to tyrosine kinase or MAP kinase, MEK1, or MEK2.
[0269] The term apoptotic protein as used herein in the context of the cargo relates to any protein, which leads to programmed cell death in multicellular organisms. More preferably, the term relates to the pro-apoptotic protein BAX, BID, BAK, or BAD.
[0270] The term anti-apoptotic protein as used herein in the context of the cargo relates to any protein, which impedes programmed cell death in multicellular organisms. Preferably, the term relates to the anti-apoptotic protein like Bcl-XI, Bcl-2, and further members of the Bcl-2 family.
[0271] The terms microbial antigens, viral antigens, bacterial antigens, parasitic antigens, and cellular antigens in the context of the cargo molecules relate to immunogens, which are able to stimulate an immune response derived from microbes, viruses, bacteria, parasites, or cells, respectively, in particular as defined herein below.
[0272] A differentiation factor as used as used herein in the context of the cargo relates to any factor, which functions predominantly in development and leads to the differentiation of tissues, cell groups of specific cells. Preferably, the term relates to growth differentiation factors (GDFs) like GDF1, GDF2, GDF3, GDF5, GDF6, GDF8, GDF9, GDF10, GDF11, and GDF15.
[0273] The term immortalisation factors as used herein in the context of the cargo relates to any factor, which provokes an absence of a sustained increase in the rate of mortality of a cell as a function of chronological age. Preferably, the term relates to any such factor known to the person skilled in the art. More preferably, the term relates to telomerase or large T-antigen.
[0274] The term peptide/protein hormone as used herein in the context of the cargo relates to any compound, which carriers as a messenger a signal from one cell (or group of cells) to another via the blood. More preferably, the term relates to prostaglandine, serotonine, histamine, bradykinin, kallidin, and gastrointestinal hormones, releasing hormones, pituitary hormones, insulin, vasopressin (ADH), glucagon, enkephalin, calcitonin, corticosteroids, corticotropin-releasing Hormone (CGRI), substance P, GRP, MSH, and neuromediators.
[0275] The term peptide/protein adhesion-molecule as used herein in the context of the cargo relates to peptides or proteins on the cell surface involved with the binding with other cells or with the extracellular matrix (ECM) in a cell adhesion process. Preferably, the term relates to any such molecule known to the person skilled in the art. More preferably, the term relates to IgSF CAMs like NCAM, ICAM-1, VCAM-1, PECAM-1, L1, CHL1, MAG, integrins, or selectins.
[0276] The term receptor-molecules as used herein in the context of the cargo relates to protein on the cell membrane or within the cytoplasm or cell nucleus that binds to a ligand and typically transduces a signal. Preferably, the term relates to metabotropic receptors, G protein-coupled receptors, muscarinic acetylcholine receptors, adenosine receptors, adrenoceptors, GABA receptors, angiotensin receptors, cannabinoid receptors, cholecystokinin receptors, dopamine receptors, glucagon receptors, metabotropic glutamate receptors, histamine receptors, olfactory receptors, opioid receptors, chemokine receptors, calcium-sensing receptor, somatostatin receptors, serotonin receptors or secretin receptors.
[0277] The term peptide inhibitors as used herein in the context of the cargo relates to peptides which have an inhibitory effect on physiological functions, preferably on protein function like enzymatic functions.
[0278] The term protein/peptide anti-aging agent as used herein in the context of the cargo relates to any compound that prevents, slows, or reverses the effects of aging. Preferably, the term relates to Human Growth Hormone (HGH).
[0279] The term cytotoxic substance as used herein relates in general to any compound which is toxic to a living cell, in particular to a cell of higher eukaryonts, more specifically, to a mammalian or human cell. As a result of the action of a cytotoxic substance, the cell my undergo necrosis, the cell can stop to grow activity or the divide, or the cell may undergo a program of apoptosis. Typically, cells undergoing necrosis exhibit rapid swelling, lose membrane integrity, decrease their metabolism and release contents into the environment. In contrast, apoptosis is characterized by certain cytological and molecular events including a change in the refractive index of the cell, cytoplasmic shrinkage, nuclear condensation and cleavage of DNA into regularly sized fragments. Cytotoxicity may be measured in accordance with suitable assays, e.g. by measuring the cell membrane integrity. The cytotoxic substance may, in case of cancer treatment be a chemotherapeutic compound. Alternatively, the cytotoxic substance may also be an antibody which conveys antibody-dependent cell-mediated cytotoxicity (ADCC), wherein cells are killed by lymphocytes which have been bound by an antibody. Examples of cytotoxic lymphocytes include cytotoxic T cells and natural killer cells.
[0280] The term chemotherapeutic compound as used herein in the context of the cargo relates to compounds of several different functional classes, which are used for the therapeutic treatment of cancerous cells. The compounds may, for example, be alkylating agents, anthracyclines, cytoskeletal disruptors (taxanes), epothilones, histone deacetylase inhibitors, inhibitors of topoisomerase I and II, kinase inhibitors, nucleotide analogs or precursor analogs, peptide antibiotics, platinum-based agents, retinoids, vinca alkaloids and derivatives thereof. A herein envisaged example of an alkylating agent is cyclophosphamide, which is a phosphoramide mustard metabolite formed in cells containing low level of ALDH (aldehyde dehydrogenase), e.g. in liver, intestine, bone marrow stem cells. The metabolite typically crosslinks DNA at guanine N-7 position, which is assumed to lead to cell apoptosis. A further example is mechlorethamine, which typically crosslinks DNA at guanine N-7 position and thus prevents cell duplication, leading to cell apoptosis. Another example is chlorambucil, which promotes nucleic acid alkylation and cross-links DNA, leading to cell-cycle arrest. This compound can be detoxified by human glutathione transferase Pi (GST P1-1), often over-expressed in cancer tissue. Further examples are nitrosoureas which are lipophilic DNA alkylating agents and can thus cross the blood brain barrier. Also envisaged is temozolomid which promotes alkylation/methylation of DNA of guanine at O-6/n-7 position. It may further be used as prodrug in the form of an imidazotetrazine derivative. An O-6-alkylguanine DNA alkyltransferase encoded as O-6-methylguanin-DNA methyltransferase may prevent cell damage. Herein envisaged examples of anthracyclines include daunorubicin, doxorubicin, epirubicin, idarubicin, mitoxantrone, pixantrone, losoxantrone, sabarubicin (which is a disaccharide analog of doxorubicin) and valrubicin (which is a semisynthetic analog of doxorubicin). These compounds typically work as DNA intercalators and thus inhibit, for example, topoisomerase II. Herein envisaged examples of cytoskeletal disruptors (taxanes) include paclitaxel, docetaxel, abraxane, and taxotere. These compounds typically targets tubulin, in particular by -tubulin heterodimer subunit binding, which leads to defects in mitotic spindle assembly, chromosome segregation and cell division. Herein envisaged examples of epothilones include epothilone A to F. Further examples are ixabepilone, patupilone and utidelone. These compounds lead to tubulin interference. They have a better water-solubility than paclitaxel-like compounds which may lead to an increased efficacy. Herein envisaged examples of histone deacetylase inhibitors include vorinostat and romidepsin. These compounds typically bind to zink-dependent active sites and function as chelators for zinc ions, leading to the accumulation of acetylated proteins, in particular histones. Herein envisaged examples of inhibitors of topoisomerase I include irinotecan. Irinotecan binds to topoisomerase I and forms a ternary DNA complex, which prevents DNA re-ligation and causes DNA damage. Further examples include topotecan. Silatecan, cositecan, exatecan, lurtotecan, gimatecan, belotecan and rubitecan, which are semi-synthetic derivatives of campothecin. Herein envisaged examples of inhibitors of topoisomerase II include etoposide, which forms a ternary complex with DNA and the topoisomerase II enzyme, preventing DNA re-ligation. Also envisaged is teniposide, which stabilizes topoisomerase II-DNA intermediates and induces double-stranded DNA breaks. A further example is tafluposide. Herein envisaged examples of kinase inhibitors include bortezomib, which is a proteasome inhibitor, wherein its boron atom binds catalytic site of 26S proteasome. Further examples include erlotinib and gefitinib which inhibit EGFR tyrosine kinase by binding reversibly to an ATP binding site, and thereby prevent a signal cascade. Further envisaged is vemurafenib, which leads to the interruption of the B-Raf/MEK/ERK pathway if B-Raf has a V600E mutation. Also contemplated is imatinib, which is an inhibitor of a number of tyrosine kinase enzymes. It typically occupies TK active sites to decrease bcr-abl activity, e.g. in chronic myelogenous leukemia where fusion of abl with bcr occurs. Further envisaged is vismodegib, which is a cyclopamine-competitive antagonist of smoothened receptor (SMO, a part of the hedgehog signalling pathway). It may specifically be used for basal-cell carcinoma. Herein envisaged examples of nucleotide analogs or precursor analogs include azacitidine (which is an analogue of nucleoside cytidine, and causes hypomethylation at low concentrations and may lead to cytotoxicity at high concentrations), azathioprine (which inhibits purine synthesis), capecitabine, cytarabine (which combines cytosine base with arabinose sugar and is an antimetabolic agent; it works via incorporation into DNA by human cytosine deoxyribose and typically induces cell death), doxifluridine (which is a metabolite of capecitabine), fluorouracil (which is a-thymidylate synthase inhibitor, blocking pyrimidine thymidine synthesis), gemcitabine (which is typically integrated as cytidine in DNA strand leading to irreparable errors and cell death), hydroxyurea (which is an inhibitor of ribonucleotide reductase by scavenging tyrosyl free radicals and typically decreases production of deoxyribonucleotides), mercaptopurine (which inhibits xanthine oxidase), methotrexate (which inhibits synthesis of DNA, RNA, thymidylates and proteins) and thioguanine (which is an analogue of guanine and leads to inhibition of guanine nucleotide synthesis). Herein envisaged examples of peptide antibiotics include bleomycin (which leads to the induction of DNA strand breaks) and actinomycin (which binds DNA at the transcription initiation complex, and thus prevents elongation of RNA). Herein envisaged examples of platinum-based agents include carboplatin, cisplatin (which interferes with DNA replication by binding and crosslinking DNA) and oxaliplatin (which interferes with DNA replication by binding and crosslinking DNA). Herein envisaged examples of retinoids include tretinoin (which has been shown to force acute promyelocytic leukemia cell differentiation and stops proliferation), alitretinoin (which is assumed to be an endogenous ligand of retinoid X receptor) and bexarotene (which activates retinoid X receptors and induces cell differentiation and apoptosis). Herein envisaged examples of vinca alkaloids and derivatives include vinblastine, vincristine, vindesine and vinorelbine, which are assumed to work as microtubule inhibitors.
[0281] The present invention, in a further embodiment, particularly envisages the employment of alpha amantin and analogs or derivatives thereof as toxic substance. These compounds typically inhibit RNA polymerase II and III. In specific embodiments, the alpha amanitin or its analogs or derivatives may be linked to a protein or peptide and be transported in this form as cargo to a desired destination, i.e. cell or tissue.
[0282] According to their mode of action, the above characterized toxic substances may be employed for intracellular or extracellular administration. Accordingly, they may be provided in carrier systems which deliver the cargo intracellularly, as defined herein, or which deliver the cargo extracellularly, as defined herein.
[0283] The term small molecule as used herein in the context of the cargo relates to molecules, e.g. organic molecules, which are therapeutically useful and preferably include drugs or other biologically, therapeutically or diagnostically active agents, which act to ensure proper functioning of a cell, or molecules which may induce, for instance, apoptosis or cell lysis, where death of a cell, such as a cancerous cell or aberrant cell, is desired, or which induce immunologic reactions, or which marker functionalities. The small molecule typically has a low molecule weight of less than 900 Da. Typically small molecules having a molecule weight of about 900 Da or less are assumed to be capable of rapidly diffusing across cell membranes. Accordingly, small molecules may be provided as cargos to be delivered intracellularly and/or extracellularly. A small molecule may, in certain embodiments, have poor solubilities in aqueous liquids, such as serum and aqueous saline. Thus, compounds whose therapeutic efficacies are limited by their low solubilities, can be administered in greater dosages according to the present invention, and can be more efficacious on a molar basis due to higher uptake levels by cells. Likewise, the compounds may be effective already in low or very low concentrations. Thus, by specifically targeting these compounds as cargos in accordance with the present invention to specific cells, avoids a systemic and rather unspecific administration and thereby allows to reduce the overall amount of compound to be administered. Examples of envisaged small molecules to be transported as cargos according to the present invention are, for example, antibacterial agents, antifungal agents, antiviral agents, antiproliferative agents, cytostatics, immunosuppressive agents, histamine receptor antagonists, vitamins, analgesic agents, anti-neoplastic agents, antiinflammatory agents, therapeutic organic molecules, inhibitors, e.g. enzyme inhibitor such as kinase inhibitors and the like. Herein envisaged examples of antibacterial agents include aminoglycosides such as neomycin or gentamicin, polymyxin, chloramphenicol, bacitracin, framycetin, enrofloxacin, marbofloxacin, miconazole, silver sulfadiazine, povidone-iodine, chlorhexidine and acetic acid. Herein envisaged examples of antifungal agents include polyene antifungals s such as amphotericin B, candicidin, or hamycin etc.; imidazoles such as bifonazole, butoconazole, or clotrimazole etc.: triazoles such as albaconazole, efinaconazole, or epoxiconazole etc.); thiazoles such as abafungin; allylamines, and echinocandins. Herein envisaged examples of antiviral agents include amantadine, rimantadine, pleconaril, aciclovier, zidovudine, lamivudine (which is a reverse transcriptation inhibitor) and rifampicin (which is an assembly inhibitor). Herein envisaged examples of cytostatics include alkylating agent, e.g. as defined herein above; antimetabolites such as methotrexate, azothioprine, mercaptopurine, or fluorouracil, as defined herein above. Herein envisaged examples of immunosuppressive agents include glucocorticoids such as prednisone, dexamethasone, hydrocortisone; cytostatics; antibodies; drugs acting on immunophilins such as ciclosporin, tacrolimus, sirolimus, or everolimus; as well as interferons, opioids, TNF alpha binding proteins, mycophenolate, fingolimod and myriocin. Herein envisaged examples of histamine receptor antagonists include cimetidine, ranitidine, famotidine and zizatidine. Herein envisaged examples of analgesic agents include paracetamol, phenacetin, aspirin, ibuprofen, naproxen and opioids such as morphine. Herein envisaged examples of anti-neoplastic agents include nucleoside analogues, antifolates, topoisomerase I inhibitors, anthracyclines, podophyllotoxins, taxanes, vinca alkaloids, alkylating agents, platinum compounds, tyrosine kinase inhibitors, mTOR inhibitors, retinoids, immunomodulatory agents and histone deacetylase inhibitors, e.g. as defined herein above. Herein envisaged examples of antiinflammatory agents include anti-interleukin antibodies, resolvins, glucocorticoids, protease inhibitors, statins, histone deacetylase inhibitors, prostaglandin agonists, phosphodiesterase-4 inhibitors, agonists of peroxisome proliferator-activator receptor, inhibitors of the complement system, anticoagulants and thrombolytics.
[0284] The term nucleic acid as used herein in the context of the cargo refers to any nucleic acid known to the person skilled in the art, e.g. a polynucleotide like DNA, RNA, single stranded DNA, cDNA, or derivatives thereof. Preferably, the term refers to oligonucleotides and polynucleotides formed of DNA and RNA, and analogs thereof, which have selected sequences designed for hybridisation to complementary targets, such as antisense sequences for single- or double-stranded targets, or for expressing nucleic acid transcripts or proteins encoded by the sequences. The DNA may be provided in the form of, e.g. A-DNA, B-DNA or Z-DNA. Analogs include charged and preferably uncharged backbone analogs, such as phosphonates, methyl phosphonates, phosphoramidates, preferably N-3 or N-5, thiophosphates, uncharged morpholino-based polymers, PNAs, or CNAs, HNAs, LNAs or ANAs. Such molecules can be used in a variety of therapeutic regimens, including, for example, enzyme replacement therapy, gene therapy, or antisense therapy. The RNA may be in the form of, e.g. p-RNA, i.e. pyranosysl-RNA or structurally modified forms like hairpin RNA or a stem-loop RNA. Furthermore, the term refers to antisense RNA. The protein, RNA or ribosome encoded by the nucleic acid may, for example, be under-represented, defunct or nonexistent in the cell and the antisense RNA encoded by the nucleic acid may allow for the elimination of an undesired function of a molecule. The term PNA relates to a peptide nucleic acid, i.e. an artificially synthesized polymer similar to DNA or RNA, which is used in biological research and medical treatments, but which is not known to occur naturally. The PNA backbone is typically composed of repeating N-(2-aminoethyl)-glycine units linked by peptide bonds. The various purine and pyrimidine bases are linked to the backbone by methylene carbonyl bonds. PNAs are generally depicted like peptides, with the N-terminus at the first (left) position and the C-terminus at the right. The term CNA relates to an aminocyclohexylethane acid nucleic acid. Furthermore, the term relates to a cyclopentane nucleic acid, i.e. a nucleic acid molecule comprising for example 2-deoxycarbaguanosine. The term HNA relates to hexitol nucleic acids, i.e. DNA analogues which are built up from standard nucleobases and a phosphorylated 1,5-anhydrohexitol backbone. The term LNA relates to locked nucleic acids. Typically, a locked nucleic acid is a modified and thus inaccessible RNA nucleotide. The ribose moiety of an LNA nucleotide may be modified with an extra bridge connecting the 2 and 4 carbons. Such a bridge locks the ribose in a 3-endo structural conformation. The locked ribose conformation enhances base stacking and backbone pre-organization. This may significantly increase the thermal stability, i.e. melting temperature of the oligonucleotide. The term ANA relates to arabinoic nucleic acids or derivatives thereof. A preferred ANA derivative in the context of the present invention is a 2-deoxy-2-fluoro-beta-D-arabinonucleoside (2F-ANA). In a further preferred embodiment nucleic acid molecules may comprise a combination of any one of single stranded DNA, RNA, PNA, CNA, HNA, LNA and ANA. In specific embodiments of the present invention the nucleic acid as defined above codes for a protein or peptide of interest, e.g. a therapeutic protein or an immunological active protein, or a diagnostically detectable protein, e.g. a bioluminescent protein, i.e. a protein or peptide which is intended to be delivered to the target cell, i.e. the Langerin.sup.+ cell. Such proteins may, in preferred embodiments, be cancer antigens or toxic proteins etc. as defined herein below. Accordingly, the nucleic acid provides elements allowing for the expression of the encoded proteins in a cellular context such as a promoter, a terminator, both operably linked to the gene, or elements allowing an integration into the genome of a cells, or elements allowing for the permanent or transient presence in the nucleus, e.g. as extrachromosomal entity. For example, the nucleic acid may be provided in the form of a plasmid as defined herein below.
[0285] The term colorant as used herein in the context of the cargo relates to any suitable molecular coloring agent which provides at least the functionality to color or stain a biological element, e.g. a cell or tissue. The colorant may be connected to a carrier structure as defined herein, e.g. a nanoparticle. The colorant may, for example, be linked, e.g. by covalent or non-covalent binding, to said carrier or be transported as cargo, e.g. in liposome carriers, or be connected to a further cargo such as an antigen, small molecule etc. The binding may be optimized so that the chromophore leading to the coloring or staining functionality is not impeded or negatively influenced. Typically, a colorant can act as either a pigment or a dye depending on the vehicle involved. It is preferred that the colorant is a dye.
[0286] The term pigment as used herein in the context of the cargo relates to any material that changes the color of reflected or transmitted light as the result of wavelength-selective absorption. This physical process differs from fluorescence, phosphorescence, and other forms of luminescence, in which a material emits light. Pigments are typically not soluble in water. In one example, the pigment may be an inorganic substance. Alternatively, the pigment may also be of organic nature. Typically, the pigment may be insoluble in aqueous liquids. In specific embodiments, the pigment may have a size of more than 1 m. Examples of suitable pigments are heme or porphyrin-based such as chlorophyll, bilirubin, hemocyanin, hemoglobin, myoglobin, carotenoids, hematochromes, Carotenes such as alpha and beta carotene, lycopene, or rhodopsin, xanthophylls such as canthaxanthin, zeaxanthin, or lutein, phytochrome, phycobiliproteins, polyene enolates, melanin, urochrome, flavonoids.
[0287] The term dye as used herein in the context of the cargo relates to a colored substance which absorbs some specific wavelengths of the visible light, which is typically applied in an aqueous solution. In a typical example, the dye is a water insoluble small molecule. Examples of suitable dyes are acridine dyes, anthraquinone dyes, arylmethane dyes such as diarylmethane dyes, triarylmethane dyes, azo dyers, diazonium dyes, nitro dyes based on the nitro functional group, nitroso dyes base on the nitroso functional group, phtalocyanine dyes, quinone-imine dyes such as eurhodin dyes or safranin dyes, indamins, indophenol dyes, oxazone dyes, thiazine dyes, thiazole dyes, xanthene dyes, fluorene dyes, pyronin dyes, fluorone dyes, or rhodamine dyes. Particularly preferred are fluorescein, rhodamine, phycoerythrin, fluorescamine and rhodopsin.
[0288] In certain embodiments, the present invention also envisages the employment of further color providing compounds (e.g. as cargo to be transported to a cell/into a cell) such as chemiluminescent compounds, e.g. luminal, imidazole, bioluminescent proteins, e.g. luciferin, luciferase, green fluorescence protein (GFP), mCherry, mOrange, TagBFP, Cerulean, Citrine, mTurquoise, red fluorescene protein (RFP), yellow fluorescence protein (YFP) and derivatives thereof such as EGFP, ECFP, BFP, EBFP, EBFP2, or BFP. Further color providing compounds which may be used within the context of the present invention include 6-FAM, HEX, TET, ROX, Cy2, Cy3, Cy5, Cy7, Texas Red or Rhodamine, PerCP, Pacific Blue, APC, Alexa 405, 430, 488, 546, 559, 594, 633, 660, 674, 680, 700, Cascade Blue, TAMRA, Dabcyl, Black Hole Quencher, BHQ-1 or BHQ-2.
[0289] In certain embodiments, the term also extends to imaging agents. Examples of such imaging agents are diagnostic imaging or contrast agents. Envisaged are, for example, near infra red and photoaccustic agents, e.g. for in vivo applications.
[0290] The term metal as used herein in the context of the cargo refers to any metal known to the person skilled in the art. Preferably, the term relates to gold, platinum, osmium, silver, iron, lanthanide metals or actinides metals. In a further embodiment the term also relates to a radioactive metal.
[0291] The term radionuclide as used herein in the context of the cargo refers to a radioactive nuclide or radioactive isotope, which as excess nuclear energy which renders it unstable. The radionuclides may either be alpha emitting radionuclides, beta emitting radionuclides or Auger electron emitting radionuclides. Examples of suitable radionuclides are 3H, 14C, 32P, 33P, 35S, 125I, 11C, 13N, 15O, 18F, 64Cu, 67Cu, 89Sr, 99Tc, 99mTc, 153Sm, 123I, 125I, 129I, 131I, 77Br, 82Rb, 68Ga or 18F, 90Y, 177Lu, 166Ho, 186R.sup.e, 188R.sup.e, 149Pm, 199Au, and 105Rh. The radionuclides may further be formulated in suitable compositions or be linked to additional molecules or carriers.
[0292] The term virus as used herein in the context of the cargo relates to any type of virus known to the person skilled in the art. Preferably, a virus is selected from the group consisting of adenoviruses, adeno-associated viruses, herpes viruses, simplex virus, lentiviruses and retroviruses. The term, in particularly preferred embodiments, relates to a virus which is capable of eliciting an immunologic response, e.g. in the form of a vaccine.
[0293] The term modified virus as used herein in the context of the cargo relates to a virus molecule, which has been altered in comparison to a wildtype virus. Such a modification may preferably lead to a decreased vitality or have influence on binding or interaction capabilities of the virus, as the person skilled in the art would know. A typical example of a modified virus is an attenuated virus as provided in a vaccine.
[0294] The term viral vector as used herein in the context of the cargo refers to genetic elements derived from viruses, which are modified in such a way as to minimize the risk of handling them. Preferably, the term relates to any such element known to the person skilled in the art. Typically, in viral vectors a part of the viral genome critical for viral replication has been deleted. Preferably, such a virus can efficiently infect cells but, once the infection has taken place, requires a helper virus to provide the missing proteins for production of new virions. Furthermore, viral vectors typically show a low toxicity and are genetically stable and do not rearrange their genomes. More preferably, the term relates to viral genetic elements in accordance with the above definition derived from adenoviruses, adeno-associated viruses, or retroviruses. In particularly preferred embodiments, the viral vector is viral vector for vaccines. Such vectors are generally considered to be safe and typically show attenuation and removal of relevant functionalities. Suitable examples of such viral vectors are vaccinia, fowlpox, measles virus, adenovirus, ALVAC, MVA, poxvirus. Particularly preferred is MVA (Modified vaccinia Ankara).
[0295] The term inoculant as used herein in the context of the cargo refers to a compound or composition which provides acquired immunity to a specific disease. The inoculant may be, for example, an agent which resembles disease-causing element but is attenuated or provided in a killed or non-infectious form. Also comprised are toxins of microorganisms or parts thereof, surface elements such as proteins or glycoproteins or sugar molecules presented on the surface of a disease-causing element. Furthermore, the inoculant may comprise or be an antigen or an epitope of an antigen of a causes-causing element such as a cancer antigen as defined herein, a bacterial antigen as defined herein, a viral antigen as defined herein, an autoimmune disease antigen as defined herein, or an allergen as defined herein. The inoculant may further be provided in the form of a protein or peptide, or as expression competent nucleic acid, or as any other suitable compound known to the skilled person. Also envisaged is the use of suitable combinations of more than one inoculant, the combination of more than one type of inoculant, e.g. a protein and a nucleic acid. The inoculant may further be combined with suitable additional factors, e.g. in the form of adjuvants or formulated with suitable carriers.
[0296] The term plasmid as used herein in the context of the cargo refers to any extrachromosomal DNA molecule separate from the chromosomal DNA and capable of autonomous replication. Preferably, the term relates to any such molecule known to the person skilled in the art. More preferably, the term relates to a DNA molecule which is capable of autonomous replication in eukaryotic cells and which encodes a polypeptide of interest, e.g. a therapeutic protein or an immunological active protein, or a diagnostically detectable protein, e.g. a bioluminescent proteins such as GFP or a similar fluorescent protein, e.g. as mentioned herein.
[0297] The multicomponent system as used herein may refer to any system or kit of components which comprises more than one component. Such 2, 3, 4, 5 or more components may be different cargo types, such as different proteins, different nucleic acids etc., or mixtures of such different cargo types, e.g. a protein and a nucleic acid etc. In further, particularly preferred embodiments, the system comprises components which typically operate together or a required for a certain method to be functional or to achieve a certain goal. Examples of such components are components necessary for genomic editing including specific proteins such as nucleases, RNA elements, DNA inserts or other types of nucleic acids. Such genomic editing approaches may, for example, be the CRISPR/Cas system, a TALEN-based system, a zinc finger nuclease (ZFN)-based system, a meganuclease-based system, a system based on Cre or FLP recombinase and lox r FRT sites. The multicomponent system may, for example, be provided in the form of already expressed or ready to use components. Alternatively, the system may be provided in the form of encoded components, e.g. provided on a plasmid or transcript, requiring a cellular machinery to express and thus provide the elements necessary for its operation. The present invention specifically envisages the use of a DRACO based system, i.e. a system based on double-stranded RNA activated caspase oligomerizers. Particularly preferred is the use of the CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats)/Cas system. CRISPR/Cas can be utilized to reduce expression of specific genes (or groups or similar genes) or to edit genomic sequences. This is typically achieved through the expression of single stranded RNA in addition to a CRISPR gene or nuclease. The technique typically relies on the expression of a CRISPR gene such as Cas9, or other similar genes in addition to an RNA guide sequences (see, for example, Cong et al. 2013, Science, 339, 6121, 819-823). Double stranded cleavage may accordingly be targeted to specific sequences using the expression of appropriate flanking RNA guide sequences, which may be provide as one component of the multicomponent system, e.g. together with Cas9 or a similar functionality. Alternatively, the CRISPR/Cas system may be used to cleave mRNA, thereby reducing expression. In a preferred embodiment RNA guide sequences and CRISPR gene expression (e.g. Cas9) may be included as part of an expression construct. The CRIPR/Cas system may accordingly comprise the necessary nucleic acids and enzymatic components to be provided as cargo.
[0298] The term TALEN-based system relates to the use of TALEN, i.e. the Transcription Activator-Like Effector Nuclease, which is an artificial restriction enzyme, generated by fusing the TAL effector DNA binding domain to a DNA cleavage domain. TAL effectors are proteins which are typically secreted by Xanthomonas bacteria or related species, or which are derived therefrom and have been modified. The DNA binding domain of the TAL effector may comprise a highly conserved sequence, e.g. of about 33-34 amino acid sequence with the exception of the 12th and 13th amino acids which are highly variable (Repeat Variable Diresidue or RVD) and typically show a strong correlation with specific nucleotide recognition. The TALEN DNA cleavage domain may be derived from suitable nucleases. For example, the DNA cleavage domain from the FokI endonuclease or from FokI endonuclease variants may be used to construct hybrid nucleases. TALENs may preferably be provided as separate entities due to the peculiarities of the FokI domain, which functions as a dimer. TALENs or TALEN components may preferably be engineered or modified in order to target any desired DNA sequence. Such engineering may be carried out according to suitable methodologies, e.g. Zhang et al., Nature Biotechnology, 1-6 (2011), or Reyon et al., Nature Biotechnology, 30, 460-465 (2012). The TALEN-based system may accordingly comprise the necessary nucleic acids, e.g. as genomic inserts or guiding sequences and enzymatic components to be provided as cargo.
[0299] The term zinc finger nuclease (ZFN)-based system as used herein refers to a system of artificial restriction enzymes, which are typically generated by fusing a zinc finger DNA-binding domain to a DNA-cleavage domain. Zinc finger domains may preferably be engineered or modified in order to target any desired DNA sequence. Such engineering methods would be known to the skilled person or can be derived from suitable literature sources such as Bae et al., 2003, Nat Biotechnol, 21, 275-80; Wright et al., 2006, Nature Protocols, 1, 1637-1652.) Typically, the non-specific cleavage domain from type Ils restriction endonucleases, e.g. from FokI, may be used as the cleavage domain in ZFNs. Since this cleavage domain dimerizes in order to cleave DNA a pair of ZFNs is typically required to target non-palindromic DNA sites. ZFNs envisaged by the present invention may further comprise a fusion of the non-specific cleavage to the C-terminus of each zinc finger domain. For instance, in order to allow two cleavage domains to dimerize and cleave DNA, two individual ZFNs are typically required to bind opposite strands of DNA with C-termini provided in a specific distance. It is to be understood that linker sequences between the zinc finger domain and the cleavage domain may requires the 5 terminus of each binding site to be separated by about 5 to 7 bp. The present invention envisages any suitable ZNF form or variant, e.g. classical FokI fusions, or optimized version of the FokI, as well as enzymes with modified dimerization interfaces, improved binding functionality or variants which are able to provide heterodimeric species. The zinc finger nuclease (ZFN)-based system may accordingly comprise the necessary nucleic acids, e.g. as genomic inserts or guiding sequences, and enzymatic components to be provided as cargo.
[0300] The term meganuclease-based system relates to a system using endodeoxyribonucleases, which typically have a recognition site in the form of a double-stranded DNA sequences of about 12 to 40 nucleotides. Meganucleases typically work as molecular DNA scissors, which provide the possibility of eliminating or modifying sequences in a sequence specific manner. Examples of suitable meganucleases include intron endonucleases and intein endonucleases. The recognition sequence of a meganuclease may be modified by genetic or protein engineering in order to target any desired DNA sequence. In order to provide a sequence specificity, the specificity of existing meganucleases may be modified by introducing a variation to the amino acid sequence, followed by the selection of functional proteins. Alternatively, protein domains from different enzymes may be fused to the nucleases, resulting in chimeric meganucleases. Such chimeric meganucleases may have, for example, a new recognition site composed of a half-site of a meganuclease and a half-site of a protein. In further embodiments, both approaches may be combined, i.e. the modification of the binding sequence of the meganuclease and the fusion to a protein domain from a different enzyme. Further details, in particular with regard to the possibilities of engineering meganucleases can be derived from suitable literature sources such as Gao et al., 2010, The Plant Journal for Cell and Molecular Biology, 61, 176-87. The meganuclease-based system may accordingly comprise the necessary nucleic acids, e.g. as genomic inserts or guiding sequences, and enzymatic components to be provided as cargo.
[0301] The term Cre-lox system as used herein relates to the combination of Cre recombinase and its respective recognition sites (lox sites). Alternatively, the system may be composed of FLP recombinase and its respective recognition sites (FRT sites). By providing the recognition sites in a direct repeated manner a deletion of sequences between the repeats can be achieved. Similarly, by providing other orientations or more than two recognition sites further rearrangement pattern may become possible, e.g. an inversion of the sequences. Further details may be derived from Ryder et al., 2004, Genetics, 167, 797-813 or Ito et al., 1997, Development, 771, 761-771.
[0302] In further preferred embodiments, the cargo may be a pharmaceutically or immunologically active compound. The term pharmaceutically active compound as used herein relates to any suitable substance, medicament, drug, cellular component, tissue, or active pharmaceutical ingredient (API) known to the skilled person. These compounds may comprise therapeutic proteins as defined above, radionuclides as defined above, cytotoxic substances as defined above, small molecules as defined above, peptide or protein inhibitors as defined above. In a particularly preferred embodiment, the pharmaceutically active compound is an inhibitor of cellular function. The term inhibitor of cellular function as used herein relates to any organic molecule, peptide or polypeptide which has an inhibitory effect on physiological functions, preferably on protein function like enzymatic functions. The inhibition may, for example be a decrease in the activity of an enzyme, as compared to the activity of the enzyme in the absence of the inhibitor. In some embodiments, the term inhibit thus means a decrease in enzyme activity of at least about 5%, at least about 10%, at least about 20%, at least about 25%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or at least about 95%. In other embodiments, inhibit means a decrease in enzyme activity of about 5% to about 25%, about 25% to about 50%, about 50% to about 75%, or about 75% to 100%. Also envisaged is a decrease in enzyme activity of about 95% to 100%, e.g., a decrease in activity of 95%, 96%, 97%, 98%, 99%, or 100%. Such decreases can be measured using any suitable method or assay known to the skilled person would be recognizable by one of skill in the art.
[0303] Examples of such inhibitors are protease inhibitors, e.g. ritonavir, HIV protease inhibitor tipranavir, or sildenafil. Further particularly preferred are inhibitors of apoptosis. Examples of apoptosis inhibitors include proteins of the Bcl-2 family such as Bcl-2, Bcl-XL, or Bcl-w. Further examples include crmA (cytotoxin response modifier A), which may be used to inhibit caspase 1, 6, and 8. Also contemplated is the use of IAPB (inhibitors of apoptosis proteins), including Cp-IAP, Op-IAP, XIAP, clAP1, C-IAP2, NAIP, Livin and Survivin.
[0304] The term immunologically active compound as used herein relates to any compound, which is capable eliciting an immunological reaction in the body. In further embodiments, it may alternatively be capable of immunomodulation. Also envisaged is that the immunologically active compound is an immunological tolerance inducer.
[0305] The term compound capable of eliciting an immunological reaction in the body as used herein relates to any substance or part of a substance which is recognized by elements of an animal's, preferably a mammal's, most preferably the human immune system and which leads to an activation of the innate immune system or the adaptive immune system.
[0306] Typical components of the innate immune system are the complement system or natural killer cells. The complement system comprises a cascade of more than 20 proteins, which are able to destroy pathogens by antibodies. The response is typically activated by complement binding to antibodies that have attached to pathogens or the binding of complement proteins to carbohydrates on the surfaces of foreign elements, e.g. bacteria or viruses. The complement system additionally comprises proteases which are capable of destroying foreign elements such as cells, parasites or part thereof (e.g. eggs), bacteria or viruses. A further consequence of complement activation is the production of signal peptides which attract additional immune cells. Natural killer (NK) cells are lymphocytes which typically destroy compromised host cells, e.g. cancerous cells or virus-infected cells. It is assumed that these cells show no self recognition by the immune system and are hence targetable by the NK cells. Such cells, e.g. cells being infected by viruses, may show a decreased number of MHC I cells at their surface which is apparently detected by the NK cells. The NK cells can be found in all primary and secondary immune compartments, as well as in mucosal tissues. They may additionally produce pro-inflammatory cytokines such as interferon-gamma. NK cells may, in particularly preferred embodiments, be activated in order to destroy cancerous cells. They may advantageously be used to communicate with other immune cells such as DCs, NKT cells or T cells, which may lead to an adaptive immune response in cancer. Without wishing to be bound by theory, it is believed that NK cells and DCs are in close communication. DC-mediated activation of NK cells typically contributes to the development of potent innate immunity, whereas, in turn, activated NK cells provide signals for DC activation, maturation, and cytokine production, promoting adaptive immunity. The provision of DC-derived exosomes (Dex), or the activation of DCs may particularly result in an activation of NK cells, thus allowing to destroy diseased cells, in particular cancer cells. Further details would be known to the skilled person or can be derived from suitable literature sources such as Lion et al., 2012, The Oncologist, 17, 1256-1270. Typically, Langerin.sup.+ cells suppress NK cell fusion. According to specific embodiments of the present invention the activation of Langerin.sup.+ cells, e.g. by delivering suitable cargoes to said cells which allow for such activation, may be used to activate NK cells and/or to contribute to said activation.
[0307] The adaptive immune system, on the other hand, is primarily based on the activity of specialized leukocytes, i.e. lymphocytes, namely B cells and T cells. The B cells are typically involved in humoral immune responses, whereas T cells are involved in cell-mediated immune responses. Both, B- and T cells comprise T-cell receptor (TCR) molecules which recognized specific targets being processed and subsequently presented on MHC molecules, which can be provided or expressed by all host cells. The T cells may be differentiated into cytotoxic T cells (CTLs) also known as CD8.sup.+ T cells or killer T cells and helper T cells, as well as regulatory T cells. Antigens inside a cell are typically bound to class I MHC molecules, and brought to the surface of the cell by the class I MHC molecule, where they can be recognized by the T cell. If the TCR is specific for that antigen, it binds to the complex of the class I MHC molecule and the antigen, and the T cell destroys the presenting cell. MHC I molecules can be found on the surface of all nucleated cells. Class I MHC molecules typically bind peptides generated mainly from degradation of cytosolic proteins by the proteasome. The MHC I:peptide complex is subsequently inserted via endoplasmic reticulum into the external plasma membrane of the cell. The epitope peptide is bound on extracellular parts of the class I MHC molecule. Thus, the function of the class I MHC is believed to be mainly to display intracellular proteins to cytotoxic T cells (CTLs). In addition, class I MHC can also present peptides generated from exogenous proteins via cross-presentation, which is the ability of certain antigen-presenting cells, e.g. DCs, to take up, process and present extracellular antigens with MHC class I molecules to cytotoxic CD8.sup.+ T cells. Cross-priming, the result of this process, describes the stimulation of naive cytotoxic CD8.sup.+ T cells into activated cytotoxic CD8.sup.+ T cells. This process may lead to immunity against tumors and viruses. Cross presentation may also advantageously be for the induction of cytotoxic immunity, e.g. by vaccination with protein antigens, for example, tumour vaccination as described herein. MHC I molecules typically bind peptides that are 8-10 amino acid in length.
[0308] Helper T cells (also known as CD4.sup.+ T cells) and regulatory T cells (also known as Treg cells or suppressor T cells), on the other hand, recognize antigens which are coupled to class II MHC molecules. MHC II molecules are typically only found on antigen presenting cells (APCs), such as dendritic cells, mononuclear phagocytes, thymic epithelial cells or B cells. The loading of MHC class II molecules typically occurs in lysosomal compartments. For example, extracellular proteins may be endocytosed, digested in lysosomes and epitopic peptide fragments can be bound to MHC II molecules. Typically, MHC II molecules present antigens of a length of between about 15 to 24 amino acids.
[0309] In accordance with the present invention, any of the above described activities may be elicited by a suitable compound, e.g. an antigen, or an epitope. The length of the antigen, its cell compartment presence etc. may modulate the presentation on MHC I or MHC II molecules and thus also modulate the activation of certain branches of the immune system. For cancer and viral therapy, it is particularly preferred that a close interaction of the innate and adaptive immune system be elicited, e.g. via activation of the DCs. Further details may be derived from suitable literature sources such as Ortner et al., Oncoimmunology, 2017, 6, 2, e1260215; Watt et al., 2008, J Immunol., 181, 8, 5323-30 or Walzer et al., 2005, Blood, 106, 7, 2252-8.
[0310] The term compound capable of immunomodulation as used herein relates to any substance or part of a substance which conveys a regulatory adjustment of the immune system. Accordingly, immune responses can be induced, amplified, attenuated or prevented according to therapeutic goals. The immunomodulation may, thus, for example be an activation (for instance in the form of an activation immunotherapy), immune response is elicited or amplified, or it may be a suppression (for instance in the form of a suppression immunotherapy).
[0311] Examples of compounds capable of activating immunomodulation include stimulating factors such as granulocyte colony-stimulating factor (G-CSF), cytokines, interleukins, chemokines, Immunomodulatory imide drugs (IMiDs) synthetic cytosine phosphate-guanosine (CpG) oligodeoxynucleotides or glucans or an immune enhancement cream such as imiquimod. Preferred examples of suitable interleukins are IL-2, IL-7 and IL-12. Preferred examples of cytokines ae interferons and G-CSF. Preferred examples of suitable chemokines are CCL3, CCL26 and CXCL7. Preferred examples of suitable IMiDs are thalidomide and analogues thereof such as lenalidomide, pomalidomide and apremilast.
[0312] Examples of compounds capable of suppressive immunomodulation include immunosuppressive drugs such as glucocorticoids, cytostatics, antibodies, compounds acting in immunophilins. Preferred examples of suitable glucocorticoids are prednisone, dexamethasone and hydrocortisone. Glucocorticoids typically suppress cell-mediated immunity, e.g. by inhibiting genes that code for the cytokines IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-8, and TNF-alpha, wherein a reduction of cytokine production leads to decrease in the T cell proliferation. Glucocorticoids may also suppress humoral immunity, e.g. by causing B cells to express smaller amounts of IL-2 and IL-2 receptors, which decreases B cell clone expansion and antibody synthesis. Preferred examples of suitable cytostatics are alkylating agents such as nitrogen mustards, e.g. cyclophosphamide, nitrosoureas, platinum compounds. Other examples include antimetabolites such as folic acid analogues, e.g. methotrexate, purine analogues, e.g. azathriopine or mercaptopurine, pyrimidine analogues such as fluorouracil. In a further group of suitable examples are cytotoxic antibiotics such as dactinomycin, anthracycline, mitomycin C, bleomycin or mithramycin. Preferred examples of suitable antibodies include heterologous polyclonal antibodies, e.g. obtained from serum of animals such as horses immunized with human thymocytes or lymphocytes. Examples of polyclonal antibody preparations envisaged by the present invention include atgam and thymoglobuline. Also envisaged are monoclonal antibodies against CD25 and CD3. Preferred examples of suitable compounds acting on immunophilins are ciclosporin, tacrolimus, sirolimus and everolimus. Further compounds which are capable of suppressive immunomodulation are fingolimod, myriocin, mycophenolate, TNF-alpha binding molecules such as cell penetrating variants of infliximab, etanercept or adalimumab. Particularly envisaged specific examples include ciclosporin (which binds to cytosolic protein cyclophilin of lymphocytes and thereby inhibits calcireurin), tacrolimus (which is an intracellular calcineurin inhibitor), sirolimus and everolismus (which inhibit IL-2 production via mTOR by binding to cytosolic FK-binding protein 12 thereby blocking activation of T and B cells), fingolimod (which causes internalization of sphingosine-1-phosphate receptors and sequesters lymphocytes in lymph nodes), myriocin and mycophenolate (which provides a-selective inhibition of inosinmonophosphat-dehydrogenase and leads to the inhibition of biosynthesis of guanosin, thereby inhibiting proliferation of B- and T-lymphocytes).
[0313] The term immunological tolerance inducer as used herein relates to a compound which is capable of inducing a state of unresponsiveness of the immune system to substances or tissues which typically have the capacity of eliciting an immune response in an organism. Immunological tolerance may either be central tolerance or peripheral tolerance. A central tolerance is typically induced in the thymus or bone marrow, whereas a peripheral tolerance is induced in the lymph nodes. In the context of the present invention, the induction of central tolerance is preferred. Peripheral tolerance is believed to be responsible for the prevention of over-reactivity of the immune system to various environmental entities such as allergens or intestine microbes. Malfunction of the tolerance system typically leads to autoimmune diseases such as systemic lupus erythematosus, rheumatoid arthritis, type 1 diabetes, autoimmune polyendocrine syndrome type 1 (APS-1), immunodysregulation, polyendocrinopathy, or enteropathy and is assumed to contribute to asthma, allergy, and inflammatory bowel disease. The tolerance system is also pivotal to transplantations and allografts. Furthermore, allergy and hypersensitivity reactions are typically considered as misguided or excessive reactions by the immune system, possibly due to broken or underdeveloped mechanisms of peripheral tolerance. Typically, Treg cells, TR1, and Th3 cells at mucosal surfaces suppress type 2 CD4 helper cells, mast cells, and eosinophils, which mediate allergic response. Deficits in Treg cells or their localization to mucosa may play a role in allergic reactions. Dendritic cells (DCs) are assumed to be an important player in peripheral tolerance. DCs are widely present in the peripheral non-lymphatic tissues, e.g. the skin and lymphatic tissues in a variety of subsets of different differentiation lineages and levels of maturity, in particular as Langerin.sup.+ cells. In the steady state, i.e. in a non-inflammatory state, the majority of dendritic cells remain immature, and upon weak antigenic stimulation and antigen presentation that may provide costimulation, immature dendritic cells typically induce clonal deletion and inactivation of naive T cells, while inducing and amplifying various regulatory T cells having immunosuppressive capacity. Accordingly immature dendritic cells are assumed to play a role in the maintenance of immunological homeostasis via induction of immune tolerance associated with regulatory mechanisms controlling T cell function. The employment of cytokines including at least IL-10 and TGF-beta may lead to tolerogenic DCs. Furthermore, the triggering of the surface expression of CD80high, CD86high, CD40high and CD83low may be used to induce tolerance. Also envisaged is the use of an IL-10 production promoting agent such as dexamethasone. In a further embodiment, the induction immunotolerance may be achieved by the use of 5-aminolevulinic acid (ALA) or derivatives thereof, as well as the use of sodium ferrous citrate (SFC). Further details may be derived from suitable literature sources such as U.S. Pat. No. 9,399,029. It is particularly preferred that the immunotolerance inducing compound is used in or for Langerin.sup.+ cells as described herein, as well as in the contex of medical conditions involving Langerin.sup.+ cells.
[0314] In a further preferred embodiment of the present invention cargo as mentioned above comprises, essentially consists of or consists of (i) a cancer antigen or epitope or comprises a cancer antigen or epitope (ii) an autoimmune disease antigen or epitope or comprises an autoimmune disease antigen or epitope, (iii) a bacterial antigen or comprises a bacterial antigen or epitope, (iv) a viral antigen or comprises a viral antigen or epitope, (v) a parasitic antigen or comprises a parasitic antigen or epitope, or (vi) an allergen, or an epitope of an allergen, or comprises an allergen or an epitope of an allergen.
[0315] The term cancer antigen as used herein relates to antigenic substances produced in tumor cells. The term may thus typically also include cellular antigens as mentioned above. These antigenic substances may alternatively also be named tumor antigens. These antigens typically trigger immune responses in the host. Without wishing to be bound by theory, it is currently believed that normal proteins in a body (i.e. proteins produced by the host itself) are not antigenic due to self-tolerance of the immune system, a concept in which autoreactive lymphocytes are deleted before they develop into fully immunocompetent cells. Other proteins which are not exposed to the immune system may trigger an immune response. This may include proteins which are sequestered from the immune system, proteins which are normally produced in very small quantities (but are produced, for example, in a much higher amount in cancerous cells), or proteins which are produced typically only during certain stages of the cellular/organism's development, or proteins whose structure or function is changed due to the presence of a mutation. Accordingly, the cancer antigens may be classified into different groups, e.g. as products of mutated oncogenes and tumor suppressor genes, products of other mutated genes such as (i) overexpressed or aberrantly expressed cellular proteins, (ii) cancer antigens produced by oncogenic viruses, (iii) oncofetal antigens, (iv) altered cell surface glycolipids and glycoproteins, and (v) cell type-specific differentiation antigens. In further specific embodiments, the antigen may be a tumor-specific antigen, which is an antigen that is produced by a mutation to a gene coding for a protein whose abnormal production is the cause of a cancer or tumor. An envisaged example of such tumor-specific antigens is an abnormal form of p53 or ras. Alternatively, if a mutation is unrelated to the tumor development, but lead to the production of an abnormal protein which is associated with the cancerous cells, it is considered as tumor-associated antigen (TAA). Also, this group of antigens is envisaged to be a part of the cargo according to the present invention. The group of TAAs is typically subdivided into the group of shared TAAs and unique TAAs. Among the shared TAAs are antigens which are shared by several classes of cancers, whereas unique TAAs are believed to result from random somatic point mutations included by carcinogens, thus constituting neo-antigens unique expressed by individual tumors. The presence of such unique TAAs may be advantageously be used for the preparation of specific antigen cargos, e.g. in the format of a vaccine, which are based on a personal genomic sequence obtained via next-generation sequencing approaches, providing information on the patient's mutanome and potentially offering information on unique mutated peptides associated with cancer, which can be used for the elicitation of anti-tumor T cells when presented as antigens.
[0316] The present invention preferably envisages the use of one or more of the following cancer antigens: MAGE-A1, NY-ESO-1, SSX-2, Gp-100, MeIan-A/Mart-1, Tyrosinase, PSA, Mammaglobin-A, URLC10, GAA, OFA, cyclin B1/WT-1/CEF, VEGFR1, VEGFR2, TTK, MUC1-KLH, HER2, HPV16 E7, HPV16/18, CEA, KOC1, SL-701, WT1, p53, survivin, telomerase, GSK2302025A, MAGE-3.1, OVA BiP, CO16, DEPDC1, MPHOSPH1, ONT-10, GD2L and GD3L, TF, rsPSMA, MUC-2, PAP; KLH, STF-II, G17DT, ICT-107, LMP2A, NA17-A, NA17.A2, IMA901, hTERT, tyrosinase-related peptide 2 (TRP2), PANVAC, EBNA1/LMP2, TRICOM 5T4, MPHOSPH1 and DEPDC1. Furthermore, the present invention also relates to any combinations of the above-mentioned antigens, as well as derivatives or modified versions thereof or homologous protein/peptide sequences derived therefrom. Also envisaged is the employment of additional cancer antigens which may be discovered and described in the future. Also envisaged is the use of any other suitable antigen as known to the skilled person. Further details may be derived from Tagliamonte et al., 2014, Hum Vaccin Immunother, 10(11), 3332-3346. The term cancer epitope as used herein relates to a specific epitope of the MHC I or MHC II class present in a cancer antigen, e.g. as defined herein above. The employment of cancer epitopes may, in specific embodiments, be combined with the additional characterization of a recipient's HLA allele background.
[0317] Particularly preferred is the employment of the cancer antigens NY-ESO-1, URLC10, G17DT, MART-1; NA17-A; gp100; hTERT, PAP, MPHOSPH1, DEPDC1, HPV16/18 or STF-II, or of epitopes present on these antigens.
[0318] The term autoimmune disease antigen as used herein relates to an antigenic substance which leads to inappropriate immune responses that attack either self-tissues or innocuous environmental components. The autoimmune disease is thus typically, in most cases, a condition arising from abnormal immune responses to a normal body part, wherein almost all body parts may be involved. The disease involves the appearance or presence of a reservoir of self-reactive cells that become functional within the immune system, i.e. in these cases the mechanisms of preventing self-reactive T cells from being created by negative selection process within the thymus as the T cell is developing into a mature immune cell fails. The disease involves the presence of autoantibodies as well as autoreactive lymphocytes, e.g. self-reactive T cells. The disease may be restricted to certain organs or involve a particular tissue in different places. The use of autoimmune disease antigens in the context of the present invention involves the induction of immune tolerance against said antigens, e.g. as described herein above. In specific embodiments of the present invention migratory immature Langerin.sup.+ cells may be used for the induction of immune tolerance. In particular, a presentation as mentioned above may subsequently generate an immunological tolerance effect for said antigen if the DC is not activated. Accordingly, it is envisaged by the present invention, that a treatment of an autoimmune disease antigen comprises the cytosolic delivery of an antigen leading to the subsequent presentation of it to effector immune cells and the explicit absence of a component, which may lead to an activation of DCs such as activation through an adjuvant. Without wishing to be bound by theory, it is believed that the presentation of antigens to DCs, e.g. via cytosolic delivery, will lead to an MHC I based presentation of said antigen. Such a presentation may subsequently generate an immunological tolerance effect for said antigen if the DC is not activated. Accordingly, is is envisaged by the present invention that a treatment of an autoimmune disease antigen comprises the cytosolic prevision of an antigen and the explicit absence of a component which may lead to an activation of DCs such as an adjuvant.
[0319] Autoimmune diseases for which antigens may be provided in the form of cargos include, for example, Antiphospholipid-Syndrome (aPL syndrome), Pemphigus, Multiple Sclerosis (MS), Myasthenia gravis, Grave's disease, Goodpasture's syndrome, Microscopic angiitis, Granulomatosis with polyangiits, Systemic Autoimmune Rheumatic Diseases (SARD), Mixed Connective Tissue Disease, Systemic Lupus Erythematosus, Sjgrens Syndrome, Systemic Sclerosis/CREST Syndrome, Polymyositis/Dermatomyositis, Autoimmune Thyroid Diseases, Celiac Disease, Autoimmune Hepatitis, Primary Biliary Cirrhosis, ANCA Associated Diseases, Antiphospholipid Syndrome/Thromboembolic Syndrome, Anti-GBM Disease, Diabetes Mellitus, Pernicious Anemia, or Crohn's Disease. Suitable antigens would be known to the skilled person or can be derived form literature sources such as Wang et al., Nucleic Acids Research, 2017, 45, D1, D769-D776. In particular embodiments, the present invention envisages the use of corresponding antigens such as beta2-GP1 for aPL syndrome, Dsg3 for Pemphigus, MBP, PLP and/or MOG-1 for Multiple Sclerosis, ACh receptor for Myasthenia gravis, TSH receptor for Grave's disease, Type IV collagen for Goodpasture's syndrome, p-ANCA for Microscopic angiitis, c-ANCA for Granulomatosis with polyangiits, DFS70 or lens epithelium-derived growth factor/transcription coactivator p75 (LEDGF/p75) for Systemic Autoimmune Rheumatic Diseases (SARD), U1-snRNP 68/70, U1-snRNP A, U1-snRNP C or U-snRNP B/BT for Mixed Connective Tissue Disease, Sm, RNP/Sm, SmD, SmD1, SmD2, SmD or ribosomal phosophoprotein PO for Systemic Lupus Erythematosus, Ro/SS-A, or La/SS-B for Sjgrens Syndrome, Centromere Protein B (CENP-B), Centromere Protein A (CENP-A), DNA Topoisomerase I (Scl-70) for Systemic Sclerosis/CREST Syndrome, Histidyl-tRNA synthetase (Jo-1), Threonyl-tRNA synthetase (PL-7), Alanyl-tRNA synthetase (PL-12), Glycyl-tRNA synthetase (EJ) or SRP54 for Polymyositis/Dermatomyositis, thyroid peroxidase (TPO; syn. MSA), thyroglobulin Autoimmune Thyroid Diseases, Tissue transglutaminase (tTG; syn. TGase-2 or Gliadin for Celiac Disease, Cytochrome p450 2D6, formiminotransferase cyclodeamidase (FTCD) for Autoimmune Hepatitis, M2, Branched chain 2-oxo acid dehydrogenase complex (BCOADC), OGDC-E2, or PDC-E2 Primary Biliary Cirrhosis, Myeloperoxidase (MPO) or Proteinase 3 (PR3) for ANCA Associated Diseases, beta2-glycoprotein 1 (beta2-GP1), formerly known as Apolipoprotein H (Apo H) for Antiphospholipid Syndrome/Thromboembolic Syndrome, glomerular basement membrane (GBM) for Anti-GBM Disease, glutamate decarboxylase (GAD65) for Diabetes Mellitus, intrinsic factor for Pernicious Anemia, or Glycoprotein 2 (GP2) for Crohn's Disease. Further envisaged are autoimmune disease epitopes present on an antigen, preferably as defined above. The term autoimmune disease epitope as used herein relates to a specific epitope of the MHC I or MHC II class present in an autoimmune disease antigen as defined herein above. The employment of autoimmune disease epitopes may, in specific embodiments, be combined with the additional characterization of a recipient's HLA allele background.
[0320] The term bacterial antigen as used herein relates to an antigenic substance produced or presented by a bacterium. Bacterial antigens may, for example, be carried by proteins and polysaccharides, or lipids. They may include coats, capsules, cell walls, flagella, fimbriae or toxins of bacteria. Typically, such substances are displayed at the surface of bacteria. In many cases carbohydrates in the form of capsular polysaccharides and/or lipopolysaccharides are major components on the surface of bacterial and may accordingly be seen as antigenic structures. It is also envisaged that such polysaccharides and/or lipopolysaccharides be mimicked by peptides or proteins, which accordingly provide the relevant antigen or epitope. The present invention envisages any suitable bacterial antigen known to the skilled person. It is preferred that the bacterial antigen or the bacterial epitope is, comprises or is derived from tetanus toxoid, diphtheria toxoid, a Neisseria meningitidis polysaccharide or Bordetella pertussis in acellular form. For example, the bacterial antigen or epitope is a T cell epitop derived from an antigen present in CRM, tetanus toxoid, diphtheria toxoid, Neisseria meningitidis outer membrane complex, or Hemophilus influenzae protein D. Further examples and details may be derived from suitable literature sources such as Detmer and Glenting, 2006, Microbial Cell Factories, 5, 23.
[0321] The term viral antigen as used herein relates to antigenic substances produced by viruses. The viral antigen is typically a protein or peptide element, which is usually encoded by the virus genome. It may be presented on the surface of the virus, e.g. as a coat or envelop or part of it, or be an integral part of the virus core or of other viral structures, which may, for example be presented by cells after viral disintegration in the interior of a cell. Examples of viral antigens include viral structural elements such as a capsid protein, a matrix protein, an envelop protein etc., as well as non-structural proteins such as holins, movement proteins, NS proteins, e.g. NS2, NSP1 etc., or enzymatic activites encoded by viruses such as integrase, reverse transcriptase, neuraminidase, esterase etc. Preferred antigens are derived from hepatitis A virus (heat whole virus inactivated), hepatitis B, and human papilloma virus (HPV). Particularly preferred is the HepB-surface antigen. Also envisaged is the use of viral epitops. The term viral epitope as used herein relates to a specific epitope of the MHC I or MHC II class present in a viral antigen as defined herein above. The employment of viral epitopes may, in specific embodiments, be combined with the additional characterization of a recipient's HLA allele background. Further information may be derived from suitable internet resources such as https://www.who.int/immunization/diseases/en/ (last visited on Dec. 4, 2018).
[0322] The term parasitic antigen as used herein, relates to antigenic substances produced by or presented on parasites. The term parasite relates to parasites of mammals, preferably parasites of humans. Parasites typically belong to protozoa or metazoan. The major parasitic groups are parastitic protozoa and parasitic helminths. Protozoa are unicellular eukaryotes. Parasitic protozoa are typically divided into four groups based on their means of locomotion and mode of reproduction: flagellates, amebae, sporozoa, and ciliates. Within the group of flagellates there are intestinal and genitourinary flagellates such as Giardia and Trichomonas, as well as blood and tissue flagellates such as Trypanosoma and Leishmania. Examples of amebae include Entamoeba, Naegleria, and Acanthamoeba. The group of Sporozoa typically undergo a complex life cycle with alternating sexual and asexual reproductive phases and includes Cryptosporidium, Cyclospora, and Toxoplasma and the malarial parasites, i.e. Plasmodium species. This Sporozoa are typically intracellular parasites. Ciliates are complex protozoa bearing cilia. An example of this group is Balantidium coli, an intestinal ciliate of humans and pigs. Parasitic helminths usually belong to the groups of nematode and plathelminthes. Examples of plathelminthes include trematodes, such as Fasciola hepatica, or cestoda such as Taenia. Also envisaged are Schistosoma or Filarial parasites such as Wuchereria bancrofti or Onchocerca volvulus. The present invention envisages antigens of any of the above-mentioned parasites or any other suitable parasite known to the skilled person. In specific embodiments, the antigen may be present in certain life cycle forms, e.g. on eggs. Particularly preferred is the employment of malaria antigens, e.g. protein structures displayed by Plasmodium during one of its life cycle forms such as cysteine-Rich Protective Antigen (CyRPA) which is a crucial component of a ternary complex, including Reticulocyte binding-like Homologous protein 5 (RH5) and the RH5-interacting protein (Ripr). The term parasitic epitope as used herein relates to a specific epitope of the MHC I or MHC II class present in a parasitic antigen as defined herein above. The employment of parasitic epitopes may, in specific embodiments, be combined with the additional characterization of a recipient's HLA allele background. Further information may be derived from suitable literature sources such as Tarleton, 2005, Cellular Microbiology, 7, 10, 1379-1386 or Higashi, 1988, Ann Rev Public Health, 9, 483-501.
[0323] The term allergen as used herein relates to antigenic substances capable of stimulating a type-I hypersensitivity reaction in atopic individuals through Immunoglobulin E (IgE) responses. Accordingly, the allergen is a type of antigen that produces an abnormally vigorous immune response in which the immune system defends the organism against a perceived threat that would otherwise be harmless to the body. Within the context of the present invention, the allergen is mainly understood to comprise a protein or peptide. Allergens can be found in a variety of sources, including dust mite excretion, pollen, or pet dander. They can also be found in food such as peanuts, nuts, seafood or shellfish. A list of allergenic proteins, which is incorporated herein by reference, can be found at the SDAP (structural database of allergenic proteins), which can be found at http://fermi.utmb.edu. All allergens mentioned in said database are envisaged by the present invention. Also envisages are any other allergen known to the skilled person. The term epitope of an allergen as used herein relates to a specific epitope of the MHC I or MHC II class present in an allergen as defined herein above. The employment of epitopes of an allergen may, in specific embodiments, be combined with the additional characterization of a recipient's HLA allele background. Further information would be known the skilled person or can be derived from suitable literature sources such as the Opinion of the Scientific Panel on Dietetic Products, Nutrition and Allergies on a request from the Commission relating to the evaluation of allergenic foods for labelling purposes as published in The EFSA Journal, 2004, 32, 1-197.
[0324] In a further embodiment of the present invention, the vehicle may have an average size from about 1 to 2000 nm, preferably from about 1 to 1000 nm. The size of the vehicle as used herein relates to either the combination of the conjugate as defined herein and an unloaded or empty carrier as defined herein, or to the combination of the conjugate as defined herein and a carrier comprising or associated with a cargo as defined herein. The size of the vehicle largely depends on the nature and form of the carrier, e.g. a liposome or nanoparticle or a protein etc. It may hence be in the range of 1 nm to 100 nm, or in the range of about 100 nm to 250 nm, or in the range of 250 nm to 1000 nm, or in the range of 1000 to 2000 nm. The size of the vehicle is advantageously adapted to the use intended for the vehicle, and/or the form and nature of the carrier included in the vehicle. For example, the vehicle may be used in nanosize range, which allows for efficient uptake by a variety of cell types and selective drug accumulation at target sites. Further information in this respect may be known to the skilled person or can be derived from suitable literature sources such as Desai et al., 1997, Pharm Res. 14, 1568-73 or Panyam and Labhasetwar, 2003, Adv Drug Del Rev. 55:329-347. In further embodiments it is envisaged that the size of the vehicles is adapted to the dimension of bloodstream. Accordingly, the vehicle may have a size of less than 5 m, which allows for the avoidance of aggregation formation and the reduction of risk for developing embolism. The size of the vehicle may, in a preferred embodiment, may preferably be measured in an aqueous solution.
[0325] An average vehicle length may accordingly be measured via Dynamic Light Scattering (DLS). The DLS technique is physical method used to determine the size distribution profile of small particles in suspension or polymers in solution. In the scope of DLS, temporal fluctuations are usually analyzed by means of the intensity or photon auto-correlation function. In the time domain analysis, the autocorrelation function (ACF) usually decays starting from zero delay time, and faster dynamics due to smaller particles lead to faster decorrelation of scattered intensity trace. It has been shown that the intensity ACF is the Fourier transformation of the power spectrum, and therefore the DLS measurements can be equally well performed in the spectral domain. Further details would be known to the skilled person or can be derived from suitable literature sources such as Stetefeld et al., 2016, Biophysical Reviews, 8, 4, 409-427.
[0326] In another aspect, the invention relates to a composition comprising at least one vehicle of the invention for specific molecular targeting of Langerin.sup.+ cells as defined above comprising or associated with a cargo as defined above for a targeted cargo delivery into a Langerin.sup.+ cell. In a preferred embodiment, said composition additionally comprises an additive. The term additive as used herein relates to any substance or compound which facilitates the (i) interaction between the ligand and the target cell as defined herein, (ii) cargo delivery into or to the target cell as defined herein, (iii) stabilizes the vehicle during shelfing, storage and/or use or (iv) helps to promote subsequent steps associated with the induction of activities in the target cell, e.g. endosomal escape or nuclear translocation of vehicle or cargo and more specifically antigen processing and presentation in Langerin.sup.+ cells.
[0327] Examples of suitable envisaged additives include divalent ions. Preferred divalent ions are Ca.sup.2+ or Zn.sup.2+. Langerin is known to be a divalent ion dependent lectin, in particular a Ca.sup.2+ dependent lectin, wherein the presence of the divalent ion has an influence on the interaction between the ligand and its cognate receptor Langerin. It is furtehr assumed that the presence of chelators such as EDTA or EGTA has further will lead to a loss or function of Langerinr, as can, for example, be derived from Valladeau, 2000, Immunity, 12(1), 71-81. Accordingly, the present invention particularly envisages that no chelator such as EDTA be present in the composition of the invention. In specific embodiments the concentration of calcium ions, i.e. Ca.sup.+, may be in the range of 4 M to 1 mM, e.g. 4-40 M, 40 to 500 M, 500 M to 1 mM or any value in between the mentioned values. In further specific embodiments the concentration of zinc ions, i.e. Zn.sup.2+ may be in the range of 4 M to 1 mM, e.g. 4-40 M, 40 to 500 M, 500 M to 1 mM or any value in between the mentioned values. In specific embodiments, the use of additives may be adjusted to the site of application of the composition of the present invention. Accordingly, the use of Ca.sup.2+ ions may be envisaged only in situations in which a natural Ca.sup.2+ provision is not given. Without wishing to the bound by theory, it is believed that the concentration of Ca.sup.2+ in the human epidermis is at about 1-2 mM which is further assumed to saturate all Langerins and rending them functional. It is particularly preferred to use an additive as described above in patients or situations in which the Ca.sup.2+ concentration deviates from the above described typical status.
[0328] A further example of a suitable additive is an adjuvant. The term adjuvant as used in the context of the composition as defined above relates generally to an immunological agent that modifies the effect of other agents, in particular, the effect of the vehicle comprising the cargo or associated to the cargo as mentioned above, more specifically of the cargo entities as mentioned above. The adjuvant may have, for example, a boosting effect with respect to immunologically eliciting cargos. Adjuvants may further have selective effects tailor-made for DCs or Langerin.sup.+ cells. It is particularly preferred that an adjuvant is used which induces the maturation of DCs and/or the emigration of DCs from the skin to the lymph nodes, typically leading to a T cell activation. Examples of preferred adjuvants include immunologically active compounds such as aluminium hydroxide, paraffin oil, MF59, AS03, MPL, QS21, AS04, AS01, AS02, IC31, CpG-Oligonucleotides, ISCOMATRIX or virosomes, incomplete Freund-Adjuvans, KLH or BCG.
[0329] Another example of a suitable additive is a factor which promotes the binding of the ligand on the vehicle to Langerin. Such a promoting factor may, for example, be an allosteric activator of protein function, e.g. a small molecule such as molecules described in Aretz et al., 2018, Am. Chem. Soc., 140, 44, 14915-14925, or an antibody or an aptamer. The promoting factor can also be a metal allowing tighter binding of the carbohydrate binding.
[0330] In preferred embodiments, a composition in accordance with the present invention is provided in the form of a liquid. This may, for example, include a liquid solution, an emulsion or a suspension. In further embodiments, the composition may comprise a solvent such as H.sub.2O, an aqueous sucrose solution, a buffer, e.g. a phosphate buffered saline, a tricine buffer, or HEPES buffer. Further envisaged is the combination of aforementioned aqueous systems and additives, e.g. any of the before mentioned and Dimethylsulfoxide (DMSO). DMSO may be used in any suitable amount or concentration up to about 15 vol %, e.g. in a concentration of about 5 vol %, 7 vol %, 8 vol %, 9 vol %, 10 vol %, 12 vol %, or 15 vol %. Also ten sides such as Tween or TritonX can act as additives and may be used within the context of the present invention.
[0331] In yet another preferred embodiment, the composition according to the present invention comprise the vehicle as defined above, i.e. including the cargo, in any suitable amount. The amount may be adjusted in accordance with the carrier form or type, e.g. liposome, nanoparticle, protein etc. Furthermore, the amount of vehicle may be adjusted in accordance with the number of receptors to be bound, as well as the location of a target cell; e.g. skin or other tissues may require different amounts of vehicle. It is preferred that the vehicle is provided in an amount of about 0.5 to 30 mol %, more preferably in an amount of about 1 to 10 mol %, even more preferably in an amount of about 4 to 6 mol %, most preferably in an amount of about 4.75 to 5 mol %. In a typical embodiment, the about mentioned values apply to liposomes, e.g. as defined herein above. Further alternative carriers the amount may vary and be adapted according to suitable calculations as known to the skilled person.
[0332] In further specific embodiments, the composition according to the present invention comprise the vehicle as defined above, i.e. including the cargo, in any suitable density. The density may be adjusted in accordance with the carrier form or type, e.g. liposome, nanoparticle, protein etc. Furthermore, the density of vehicle may be adjusted in accordance with the number of receptors to be bound, as well as the location of a target cell; e.g. skin or other tissues may require different density of vehicle. It is preferred that the vehicle is provided in a density of about 0.05 to about 0.08 vehicles per nm.sup.2, more preferably in a density of about 0.065 vehicles per nm.sup.2, e.g. about 0.067 vehicles per nm.sup.2 for a carrier of a diameter of about 160 nm. Also envisaged are further suitable density values, which may be determined in view of the size or diameter of the carrier, e.g. liposome. It is further envisaged that the density be adjusted such that the distance between two vehicles is approx. 4.4 nm. According to a specific embodiment, the calculation of suitable vehicle densities may be based on a lipid concentration value of about 26 M and an average liposome concentration of about 75 M. These values may vary and/or be adapted depending on the liposome type, carrier size, diameter or type, vehicle form and size etc. Further details concerning the calculation and adaptation of density of vehicles in a carrier according to the present invention may be derived from suitable literature sources such as Gven et al., 2009, Journal of Liposome Research, 19, 2, 148-154 or Methods of Enzymology, Vol. 391, 2005, Liposomes, Part E, Chapter 13, Use of Liposomes to deliver Bactericides to bacterial biofilms, p. 21.
[0333] In a further aspect, the present invention relates to a method for targeted cargo delivery into a Langerin.sup.+ cell, comprising contacting the vehicle for specific molecular targeting of Langerin.sup.+ cells as defined above, or the composition as above with a dendritic cell. In specific embodiments, the carrier is provided in an unloaded or empty state, or the carrier comprises or is associated with a cargo as defined herein above. The method may, for example, comprise the steps of providing the vehicle in a suitable form or constitution, locating the vehicle in the vicinity of a target cell or facilitating the entirety of the vehicle to the target cell and allowing for a contacting of the ligand with the cognate receptor (Langerin) at the target cell. Factors which may suitably be used to improve or facilitate the targeted cargo delivery are the concentration and presence of Ca.sup.2+ as described herein. Furthermore, the temperature may be set to a suitable range, e.g. any temperature or temperature range which allows for endocytosis of the the cargo such as 4 C. to 37 C. In a preferred embodiment, the method may be performed in accordance with the steps mentioned in Example 7.
[0334] In another aspect, the present invention relates to a pharmaceutical composition comprising the vehicle as defined above or the composition as defined above, wherein the carrier comprises or is associated to a pharmaceutically active cargo, e.g. as defined above. It is particularly preferred that said pharmaceutical composition comprises a vehicle as defined above, wherein the carrier comprises or is associated to a cargo selected from any of the following: a small molecule, a peptide, a protein, a cytotoxic substance, a nucleic acid, a metal, a radionuclide, a virus, a modified virus, a viral vector, an inoculant, a plasmid, a multicomponent system, a pharmaceutically active compound such as inhibitor of cellular function, e.g. an inhibitor of apoptosis, an immunologically active compound including a compound capable of eliciting an immunological reaction in the body, an immunomodulator, and an immunological tolerance inducer, or a cancer antigen or epitope or a compound comprising a cancer antigen or epitope, an autoimmune disease antigen or epitope or a compound comprising an autoimmune disease antigen or epitope, a bacterial antigen or a compound comprising a bacterial antigen or epitope, a viral antigen or a compound comprising a viral antigen or epitope, a parasitic antigen or a compound comprising a parasitic antigen or epitope, or an allergen, or an epitope of an allergen, or a compound comprising an allergen or an epitope of an allergen. Also envisaged are one or more ingredients or components necessary for a gene therapeutic or molecular editing approaches such as, for example, CRISPR/Cas or TALEN components as described herein. It is further preferred that all of the mentioned elements correspond to those defined herein above in the context of the cargo, including additional examples of the mentioned elements. Also envisaged are combinations of the above-mentioned cargos, e.g. a protein and a nucleic acid, or a virus or viral vector and a protein, or a small molecule and a nucleic acid or protein etc. Particularly preferred are combinations of adjuvants and antigens, e.g. as defined herein above, or RNA-protein complexes etc., e.g. for gene therapeutic or molecular editing approaches as defined herein.
[0335] Optionally, i.e. in certain embodiments, the pharmaceutical composition as defined above comprises a pharmaceutically acceptable carrier or a pharmaceutical adjuvant. The term pharmaceutically acceptable means approved by a regulatory agency or other generally recognized pharmacopeia for use in animals, and more particularly in humans. The term carrier refers to a diluent, excipient, or pharmaceutical vehicle with which the cargo or therapeutic is administered. Such a carrier is pharmaceutically acceptable, i.e. is non-toxic to a recipient at the dosage and concentration employed. It is preferably isotonic, hypotonic or weakly hypertonic and has a relatively low ionic strength, such as provided by a sucrose solution. Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers. Suitable pharmaceutical excipients include starch, glucose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium ion, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like. The composition, if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents. These compositions can take the form of, e.g., solutions, suspensions, emulsion, powders, sustained-release formulations and the like. Examples of suitable pharmaceutical carriers are described, for example, in Remington's Pharmaceutical Sciences by E. W. Martin. Some other examples of substances which can serve as pharmaceutical carriers are sugars, such as glucose and sucrose; starches such as corn starch and potato starch; cellulose and its derivatives such as sodium carboxymethycellulose, ethylcellulose and cellulose acetates; powdered tragancanth; malt; gelatin; talc; stearic acids; magnesium stearate; calcium sulfate; calcium carbonate; vegetable oils, such as peanut oils, cotton seed oil, sesame oil, olive oil, corn oil and oil of theobroma; polyols such as propylene glycol, glycerine, sorbitol, mannitol, and polyethylene glycol; agar; alginic acids; pyrogen-free water; isotonic saline; cranberry extracts and phosphate buffer solution; skim milk powder; as well as other non-toxic compatible substances used in pharmaceutical formulations such as Vitamin C, estrogen and echinacea, for example. Wetting agents and lubricants such as sodium lauryl sulfate, as well as coloring agents, flavoring agents, lubricants, excipients, tabletting agents, stabilizers, anti-oxidants and preservatives, can also be present. In certain embodiments, the ingredients of the pharmaceutical composition may be administered in encapsulated form, e.g. as cellulose encapsulation, in gelatine, with polyamides, wax matrices, or with cyclodextrins encapsulated.
[0336] Generally, the ingredients may be supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilised powder or water free concentrate in a hermetically sealed container such as an ampoule or sachette indicating the quantity of active agent.
[0337] In a specific embodiment, the pharmaceutical composition is formulated in accordance with routine procedures as a pharmaceutical composition adapted for intravenous administration to human beings. Typically, compositions for intravenous administration are solutions in sterile isotonic aqueous buffer. Where necessary, the composition may also include a solubilizing agent and a local anesthetic such as lignocaine to ease pain at the site of the injection. Where the composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline. Where the composition is administered by injection, an ampoule of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration.
[0338] The term pharmaceutical adjuvant as used herein relates to additional ingredients such as chloroquine, protic polar compounds, such as propylene glycol, polyethylene glycol, glycerol, EtOH, 1-methyl L-2-pyrrolidone or their derivatives, or aprotic polar compounds such as dimethylsulfoxide (DMSO), diethylsulfoxide, di-n-propylsulfoxide, dimethylsulfone, sulfolane, dimethylformamide, dimethylacetamide, tetramethylurea, acetonitrile or their derivatives. The pharmaceutical adjuvant may further be one or more of a surfactant, wetting agent, dispersing agent, suspending agent, buffer, stabilizer or isotonic agent. Furthermore, an adjuvant may promote the binding of the vehicle/ligand to Langerin. The present invention also envisages any suitable pharmaceutical adjuvant as known to the skilled person. The above-mentioned compounds are added in conditions respecting pH limitations.
[0339] The pharmaceutical composition of the present invention can also comprise a preservative. Preservatives according to certain compositions of the invention include, without limitation: butylparaben; ethylparaben; imidazolidinyl urea; methylparaben; O-phenylphenol; propylparaben; quaternium-14; quaternium-15; sodium dehydroacetate; zinc pyrithione; and the like. The preservatives are used in amounts effective to prevent or retard microbial growth. Generally, the preservatives are used in amounts of about 0.1% to about 1% by weight of the total composition with about 0.1% to about 0.8% being preferred and about 0.1% to about 0.5% being most preferred.
[0340] The composition of the present invention can be administered to a subject or patient. The term subject or patient refers to a mammal. Mammal as used herein is intended to have the same meaning as commonly understood by one of ordinary skill in the art. Preferred mammals are primates, cows, sheep, goats, horses, dogs, cats, rabbits, rats, mice and the like. In particularly preferred embodiments, the subject is a human.
[0341] The term administered means administration of a therapeutically effective dose of the aforementioned pharmaceutical composition by any suitable route. By therapeutically effective amount is meant a dose that produces the effects for which it is administered in a patient. The exact dose will depend on the purpose of the treatment, and will be ascertainable by one skilled in the art using known techniques. As is known in the art and described herein, adjustments for systemic versus localized delivery, age, body weight, general health, sex, diet, time of administration, drug interaction and the severity of the condition may be necessary, and will be ascertainable with routine experimentation by those skilled in the art. It is preferred that the administration is localized, more preferably, that the administration is topical, in particular over or through the skin.
[0342] The pharmaceutical composition may be used in both human therapy and veterinary therapy, preferably in human therapy. The vehicles described herein being associated with cargos having the desired therapeutic activity may be administered in a physiologically acceptable carrier to a patient, as described herein. Depending upon the manner of administration, these elements may be formulated in a variety of ways as discussed below. The concentration of the vehicles described herein being associated with cargos having the desired therapeutic activity in the formulation may vary from about 0.00001-100 wt %. For instance, the formulation may provide the vehicle in an amount of about 0.5 to 30 mol %, more preferably in an amount of about 1 to 10 mol %, even more preferably in an amount of about 4 to 6 mol %, most preferably in an amount of about 4.75 to 5 mol %. In a typical embodiment, the about mentioned values apply to liposomes, e.g. as defined herein above. Further alternative carriers the amount may vary and be adapted according to suitable calculations as known to the skilled person.
[0343] Also envisaged are formulations, which comprise the vehicle in a suitable density. Accordingly, in further specific embodiments, the pharmaceutical composition according to the present invention may comprise the vehicle as defined above, i.e. including the cargo, in any suitable density, which may be adjusted in accordance with the carrier form or type, e.g. liposome, nanoparticle, protein etc. Furthermore, the density of vehicle may be adjusted in accordance with the number of receptors to be bound, as well as the location of a target cell; e.g., skin or other tissues may require different density of vehicle. It is preferred that the vehicle is provided in a density of about 0.05 to about 0.08 vehicles per nm.sup.2, more preferably in a density of about 0.065 vehicles per nm.sup.2, e.g. about 0.067 vehicles per nm.sup.2 for a carrier of a diameter of about 160 nm. Also envisaged are further suitable density values, which may be determined in view of the size or diameter of the carrier, e.g. liposome. It is further envisaged that the density be adjusted such that the distance between two vehicles is approx. 4.4 nm. According to a specific embodiment, the calculation of suitable vehicle densities may be based on a lipid concentration value of about 26 M and an average liposome concentration of about 75 M. These values may vary and/or be adapted de-pending on the liposome type, carrier size, diameter or type, vehicle form and size etc. Further details concerning the calculation and adaptation of density of vehicles in a carrier according to the present invention may be derived from suitable literature sources such as Methods of Enzymology, Vol. 391, 2005, Liposomes, Part E, Chapter 13, Use of Liposomes to deliver Bactericides to bacterial biofilms, p. 21.
[0344] The concentration of the compounds of a pharmaceutical composition according to the present invention may be further adjusted to the intended dosage regimen, the intended usage duration, the exact amount and ratio of all ingredients of the composition and further factors and parameter known to the person skilled in the art.
[0345] The vehicles described herein being associated with cargos having the desired therapeutic activity according to the present invention may be administered alone or in combination with other treatments. Combination treatments are envisioned for cancer immunotherapy, for example via co-administration of checkpoint inhibitors such as anti-CTLA-4 and anti-PD1 antibodies, for chemotherapy, for example by co-administration of alkylating agents or DNA and RNA polymerase inhibitors, for antiviral therapy, for example by co-administration of entry, protease or DNA and RNA polymerase inhibitors and for autoimmune disease therapy, for example by co-administration of glucocorticoids or immunophilin inhibitors.
[0346] The administration of the pharmaceutical composition can be done in a variety of ways. The administration may be, for example, oral, intravenous, topical, corneal, nasal, subcutaneous, intradermal, or transdermal administration. In further embodiments, the administration is for vaccination, or for administration via hair follicles.
[0347] Further, alternative routes of administration include, without limitation, ocular or intra-tumor administration or by intrasternal injection.
[0348] In further embodiments, the administration may be performed with a specific medical device, e.g a needle, a vaccination gun, a plaster/adhesive, or an inhaler, as will be explained in detail below.
[0349] The present invention centrally focuses on vaccination approaches. The term vaccination in general relates to the administration of antigenic material (e.g. as a vaccine) to stimulate an individual's immune system. Accordingly, the pharmaceutical composition as defined herein may be administered as a vaccine. A vaccine may be (i) an inactivated vaccine, (ii) an attenuated vaccine, (iii) a subunit vaccine or (iv) a DNA vaccine. The term inactivated vaccine means a vaccine or composition comprising infectant particles which were grown in culture and subsequently killed or destroyed, preferably by using heat or formaldehyde. Such infectant particles, e.g. viruses, typically cannot replicate, but certain proteins, e.g. capsid proteins, are intact enough to be recognized by the immune system and evoke a response. The term attenuated vaccine means a vaccine or composition comprising live infectant particles with a low virulence. Typically, live attenuated infectant particles may reproduce, but very slowly. These vaccines may be produced by any suitable method known to the skilled person, normally by growing infectants tissue cultures that will select for less virulent strains, or by mutagenesis or targeted deletions in genes required for virulence. The term subunit vaccine means a vaccine or composition comprising an antigen, which is provided to the immune system without the introduction of infectant particles, whole or otherwise. A subunit vaccine may be produced by any suitable method known to the person skilled in the art. Typically the production may involve the isolation of a specific protein or protein portion or of sugar structures and their administration as vaccine or vaccine composition. The subunit strategy may further be used for the presentation of suitable cancer antigens. The term DNA vaccine relates to DNA compositions created from an infectious agent's DNA or encoding corresponding structural components, which is typically inserted into cells, e.g. human or animal cells, and expressed therein. The DNA vaccine may accordingly encode any antigen or epitope as defined herein above.
[0350] Vaccines of the present invention may be administered to a subject or individual by any suitable method, preferably via injection using either a conventional syringe or a gene gun or vaccination gen, such as the Accell gene delivery system. Delivery of DNA into cells of the epidermis is particularly preferred as this mode of administration provides access to skin-associated lymphoid cells and provides for a transient presence of DNA in the recipient. Both, nucleic acids and/or proteins/peptides can be injected either subcutaneously, epidermally, intradermally, intramucosally such as nasally, rectally and vaginally, intraperitoneally, intravenously, orally or intramuscularly. Other modes of administration include oral and pulmonary administration, suppositories, needle-less injection, transcutaneous and transdermal applications. If solids are employed as auxiliary agents for the vaccine formulation, e.g. an adsorbate or a suspended mixture of vaccine ingredient with the auxiliary agent is administered. In special embodiments, the vaccine is administered as a solution, or liquid vaccine, respectively, in an aqueous solvent. It is preferred that the administration is epidermally, intradermally or intramucosally.
[0351] In a particularly preferred embodiment the administration is via hair follicles. The method is based on the finding that the pilosebaceous unit (consisting of the hair follicle and sebaceous gland) can play a role in the passive transport of drugs into the skin. To reach the epidermis and egress from the skin into circulation, the pharmaceutical composition must additionally penetrate the keratinocyte layers surrounding the hair shaft. By using particles such poly(lactic-co-glycolic acid) (PLGA) nanoparticles, the pharmaceutical composition may be kept at the hair follicles, which allow for drug perfusion in the skin. Also, a depot effect may be used. Optionally, the adjuvant bis-(3,5)-cyclic dimeric adenosine monophosphate may be employed.
[0352] Further envisaged administration routes include iontophoresis, microneedles, lasers and jet injectors.
[0353] Microneedles are typically considered as part of a transdermal patch, which is placed on the skin to deliver the pharmaceutical composition or a part of it to and across the skin. The microneedles are typically smaller than a human hair, composed of metals, Si or biodegradable polymers. Typically, the microneedles are provided in the form of an array. The use of the microneedles is advantageously virtually painless. A preferred embodiment of the microneedle approach is the nanopatch.
[0354] The term nanopatch used herein relates to an array of thousands of vaccine-coated microprojections that perforate into the outer layers of the skin when applied with an applicator device. The tips of Nanopatch's microprojections are typically coated with a vaccine material including the composition according to the present invention and release this material directly to the large numbers of immune cells immediately below the skin surface. The central element of this technology is the Nanopatch array itself which typically consists of a 1 cm2 square of silicon with 20,000 microprojections on its surface. The Nanopatch array penetrates through the protective outer skin layer (stratum corneum) and targets immune-activating material to the immune-cell rich layers just beneath the outermost skin layer utilising the microprojections with optimised spacing and length.
[0355] A further preferred route of administering is the topical route. Topical administration of the pharmaceutical composition of the present invention is useful when the desired treatment involves areas or organs readily accessible by topical administration. For a topically application, e.g. to the skin, mucous membrane, the pharmaceutical composition is preferably formulated as hydrogel patch, liquid, cream, ointment, paste, gel, lotion, tape, film, sublingual, buccal, tablet, spray, or suppository.
[0356] The term hydrogel patch as used herein relates to patches which are composed of a breathable non-woven cloth layered with an advanced adhering hydrogel which is typically protected by a transparent film cover. Hydrogel is a network of polymer chains that are water-insoluble, sometimes found as a colloidal gel in which water is the dispersion medium. Hydrogels are superabsorbent, natural or synthetic polymers an possess a degree of flexibility similar to natural tissue, due to their significant water content. According to certain embodiments, the hydropatch comprises the composition according to the present invention in a suitable amount.
[0357] A suitable paste comprises the vehicles described herein being associated with cargos having the desired therapeutic activity according to the present invention suspended in a carrier. Such carriers include, but are not limited to, petroleum, soft white paraffin, yellow petroleum jelly and glycerol.
[0358] The pharmaceutical composition may also be formulated with a suitable ointment comprising the active components suspended or dissolved in a carrier. Such carriers include, but are not limited to, one or more of glycerol, mineral oil, liquid oil, liquid petroleum, white petroleum, yellow petroleum jelly, propylene glycol, alcohols, triglycerides, fatty acid esters such as cetyl ester, polyoxyethylene polyoxypropylene compound, waxes such as white wax and yellow beeswax, fatty acid alcohols such as cetyl alcohol, stearyl alcohol and cetylstearylalcohol, fatty acids such as stearic acid, cetyl stearate, lanolin, magnesium hydroxide, kaolin and water.
[0359] Alternatively, the pharmaceutical composition may also be formulated with a suitable lotion or cream comprising the active components suspended or dissolved in a carrier. Such carriers include, but are not limited to, one or more of mineral oil such as paraffin, vegetable oils such as castor oil, castor seed oil and hydrogenated castor oil, sorbitan monostearat, polysorbat, fatty acid esters such as cetyl ester, wax, fatty acid alcohols such as cetyl alcohol, stearyl alcohol, 2-octyldodecanol, benzyl alcohol, alcohols, triglycerides and water.
[0360] The pharmaceutical composition may also be formulated as a tape or adhesive for transdermal application. The tape typically sticks to the skin as a patch and comprises the active components typically in a delayed release format. It is envisaged that the adhesive is a pressure sensitive adhesive wherein permeation enhancers, namely surfactants, fatty acids, terpenes and solvents, may have been introduced into the transdermal formulation. The pressure-sensitive adhesive typically begins as a highly viscous and sticky liquid and remains in the same form throughout their application life cycle. Alternatively, rubber-based pressure-sensitive adhesives may be employed which comprises of either natural or synthetic rubber, in addition to oils, resins and antioxidants as tackifier and stabiliser. Also envisaged are acrylic-based pressure-sensitive adhesive is prepared from acrylate esters, methacrylic acid, acrylamide, methacrylamide, N-alkoxyalkyl or N-alkyl-acrylamides without or with the addition of tackifier, or silicone-based pressure-sensitive adhesive is prepared mainly from gum and resin. The resin is a resultant product of the reaction of silicic or polysilicic hydrosol with trimethylchlorosilane.
[0361] A sublingual administration relates to pharmacological route of administration by which substances diffuse into the blood through tissues under the tongue. When the substance comes into contact with the mucous membrane beneath the tongue, it is absorbed. Because the connective tissue beneath the epithelium contains a profusion of capillaries, the substance then diffuses into them and enters the venous circulation. Typical administration forms for sublingual administration include sublingual tablets, sublingual strips, sublingual drops, sublingual spray, lozenges etc.
[0362] Similar to the sublingual administration, the buccal administration refers to a topical route of administration by which drugs held or applied in the buccal area (in the cheek) diffuse through the oral mucosa and enter either directly into the bloodstream or being taken up by Langerin-positive antigen presenting cells residing in the tissue. Buccal administration is believed to provide better bioavailability and a more rapid onset of action compared to oral administration because the medication does not pass through the digestive system and thereby avoids first pass metabolism. Modern approaches for buccal administration envisaged for the present invention include composite materials such as nanofiber-based mucoadhesive films. These materials typically consist of a mucoahesive layer, a reservoir layer to enable controlled release of the carrier. It is preferred that the materials comprise lipid-based nanoparticles and a protective backing layer. The further envisaged use of permeation enhancers such as surfactants, fatty acids as well as cationic and anionic amino acids may advantageously increase buccal bioavailability. Further details may be derived from suitable literature sources such as Morales et al., 2017, Curr Opin Pharmacol, 36, 22-28.
[0363] Alternatively, the pharmaceutical composition may also be formulated with a suitable gel comprising the active components suspended or dissolved in a carrier. Such carriers include, but are not limited to, one or more of water, glycerol, propyleneglycole, liquid paraffin, polyethylene, fatty oils, cellulose derivatives, bentonite and colloidal silicon dioxide.
[0364] The preparations according to the invention may generally comprise further auxiliaries as are customarily used in such preparations, e.g. preservatives, perfumes, antifoams, dyes, pigments, thickeners, surface-active substances, emulsifiers, emollients, finishing agents, fats, oils, waxes or other customary constituents, of a cosmetic or dermatological formulation, such as alcohols, polyols, polymers, foam stabilizers, solubility promoters, electrolytes, organic acids, organic solvents, or silicone derivatives.
[0365] The pharmaceutical composition according to the invention may comprise emollients. Emollients may be used in amounts, which are effective to prevent or relieve dryness. Useful emollients include, without limitation: hydrocarbon oils and waxes; silicone oils; triglyceride esters; acetoglyceride esters; ethoxylated glyceride; alkyl esters; alkenyl esters; fatty acids; fatty alcohols; fatty alcohol ethers; etheresters; lanolin and derivatives; polyhydric alcohols (polyols) and polyether derivatives; polyhydric alcohol (polyol) esters; wax esters; beeswax derivatives; vegetable waxes; phospholipids; sterols; and amides.
[0366] Thus, for example, typical emollients include mineral oil, especially mineral oils having a viscosity in the range of 50 to 500 SUS, lanolin oil, mink oil, coconut oil, cocoa butter, olive oil, almond oil, macadamia nut oil, aloa extract, jojoba oil, safflower oil, corn oil, liquid lanolin, cottonseed oil, peanut oil, purcellin oil, perhydrosqualene (squalene), caster oil, polybutene, odorless mineral spirits, sweet almond oil, avocado oil, calophyllum oil, ricin oil, vitamin E acetate, olive oil, mineral spirits, cetearyl alcohol (mixture of fatty alcohols consisting predominantly of cetyl and stearyl alcohols), linolenic alcohol, oleyl alcohol, octyl dodecanol, the oil of cereal germs such as the oil of wheat germ cetearyl octanoate (ester of cetearyl alcohol and 2-ethylhexanoic acid), cetyl palmitate, diisopropyl adipate, isopropyl palmitate, octyl palmitate, isopropyl myristate, butyl myristate, glyceryl stearate, hexadecyl stearate, isocetyl stearate, octyl stearate, octylhydroxy stearate, propylene glycol stearate, butyl stearate, decyl oleate, glyceryl oleate, acetyl glycerides, the octanoates and benzoates of (C12-C15) alcohols, the octanoates and decanoates of alcohols and polyalcohols such as those of glycol and glycerol, and ricin-oleates of alcohols and poly alcohols such as those of isopropyl adipate, hexyl laurate, octyl dodecanoate, dimethicone copolyol, dimethiconol, lanolin, lanolin alcohol, lanolin wax, hydrogenated lanolin, hydroxylated lanolin, acetylated lanolin, petrolatum, isopropyl lanolate, cetyl myristate, glyceryl myristate, myristyl myristate, myristyl lactate, cetyl alcohol, isostearyl alcohol stearyl alcohol, and isocetyl lanolate, and the like.
[0367] Moreover, the pharmaceutical composition according to the invention may also comprise emulsifiers. Emulsifiers (i.e., emulsifying agents) are preferably used in amounts effective to provide uniform blending of ingredients of the composition. Useful emulsifiers include (i) anionics such as fatty acid soaps, e.g., potassium stearate, sodium stearate, ammonium stearate, and triethanolamine stearate; polyol fatty acid monoesters containing fatty acid soaps, e.g., glycerol monostearate containing either potassium or sodium salt; sulfuric esters (sodium salts), e.g., sodium lauryl 5 sulfate, and sodium cetyl sulfate; and polyol fatty acid monoesters containing sulfuric esters, e.g., glyceryl monostearate containing sodium lauryl surfate; (ii) cationics chloride such as N(stearoyl colamino formylmethyl) pyridium; N-soya-N-ethyl morpholinium ethosulfate; alkyl dimethyl benzyl ammonium chloride; diisobutylphenoxytheoxyethyl dimethyl benzyl ammonium chloride; and cetyl pyridium chloride; and (iii) nonionics such as polyoxyethylene fatty alcohol ethers, e.g., monostearate; polyoxyethylene lauryl alcohol; polyoxypropylene fatty alcohol ethers, e.g., propoxylated oleyl alcohol; polyoxyethylene fatty acid esters, e.g., polyoxyethylene stearate; polyoxyethylene sorbitan fatty acid esters, e.g., polyoxyethylene sorbitan monostearate; sorbitan fatty acid esters, e.g., sorbitan; polyoxyethylene glycol fatty acid esters, e.g., polyoxyethylene glycol monostearate; and polyol fatty acid esters, e.g., glyceryl monostearate and propylene glycol monostearate; and ethoxylated lanolin derivatives, e.g., ethoxylated lanolins, ethoxylated lanolin alcohols and ethoxylated cholesterol.
[0368] The pharmaceutical composition according to the invention may also include a surfactant. Suitable surfactants may include, for example, those surfactants generally grouped as cleansing agents, emulsifying agents, foam boosters, hydrotropes, solubilizing agents, suspending agents and nonsurfactants (facilitates the dispersion of solids in liquids).
[0369] The surfactants are usually classified as amphoteric, anionic, cationic and nonionic surfactants. Amphoteric surfactants include acylamino acids and derivatives and N-alkylamino acids. Anionic surfactants include: acylamino acids and salts, such as, acylglutamates, acylpeptides, acylsarcosinates, and acyltaurates; carboxylic acids and salts, such as, alkanoic acids, ester carboxylic acids, and ether carboxylic acids; sulfonic acids and salts, such as, acyl isethionates, alkylaryl sulfonates, alkyl sulfonates, and sulfosuccinates; sulfuric acid esters, such as, alkyl ether sulfates and alkyl sulfates. Cationic surfactants include: alkylamines, alkyl imidazolines, ethoxylated amines, and quaternaries (such as, alkylbenzyldimethylammonium salts, alkyl betaines, heterocyclic ammonium salts, and tetra alkylammonium salts). And nonionic surfactants include: alcohols, such as primary alcohols containing 8 to 18 carbon atoms; alkanolamides such as alkanolamine derived amides and ethoxylated amides; amine oxides; esters such as ethoxylated carboxylic acids, ethoxylated glycerides, glycol esters and derivatives, monoglycerides, polyglyceryl esters, polyhydric alcohol esters and ethers, sorbitan/sorbitol esters, and triesters of phosphoric acid; and ethers such as ethoxylated alcohols, ethoxylated lanolin, ethoxylated polysiloxanes, and propoxylated polyoxyethylene ethers.
[0370] In case of the provision of the pharmaceutical composition as a film it may comprise a film former. Suitable film formers which are used in accord with the invention keep the composition smooth and even and include, without limitation: acrylamide/sodium acrylate copolymer; ammonium acrylates copolymer; Balsam Peru; cellulose gum; ethylene/maleic anhydride copolymer; hydroxyethylcellulose; hydroxypropylcellulose; polyacrylamide; polyethylene; polyvinyl alcohol; pvm/MA copolymer (polyvinyl methylether/maleic anhydride); PVP (polyvinylpyrrolidone); maleic anhydride copolymer such as PA-18 available from Gulf Science and Technology; PVP/hexadecene copolymer such as Ganex V-216 available from GAF Corporation; acryliclacrylate copolymer; and the like.
[0371] Generally, film formers can be used in amounts of about 0.1% to about 10% by weight of the total composition with about 1% to about 8% being preferred and about 0.1 DEG/O to about 5% being most preferred. Humectants can also be used in effective amounts, including: fructose; glucose; glulamic acid; glycerin; honey; maltitol; methyl gluceth-10; methyl gluceth-20; propylene glycol; sodium lactate; sucrose; and the like.
[0372] In a further embodiment of the present invention, the pharmaceutical composition may be administered via inhalation. The pharmaceutical preparations can accordingly be in the form of a spray, e.g. a pump spray or an aerosol. Typically, aerosols according to the present invention comprise the medicament or pharmaceutical composition, one or more chlorofluorocarbon propellants and either a surfactant or a solvent, such as ethanol. For instance, aerosol propellants like propellant 11 and/or propellant 114 and/or propellant 12 may be used. Further suitable propellants for aerosols according to the invention are propane, butane, pentane and others. Additional propellants which may be used and which are believed to have minimal ozone-depleting effects in comparison to conventional chlorofluorocarbons comprise fluorocarbons and hydrogen-containing chlorofluorocarbons. Additional aerosols for medicinal aerosol formulations are disclosed in, for example, EP 0372777. Typically, one or more adjuvants such as alcohols, alkanes, dimethyl ether, surfactants (including fluorinated and non-fluorinated surfactants, carboxylic acids, polyethoxylates etc) and conventional chlorofluorocarbon propellants in small amounts may be added to the formulations.
[0373] Further preferred is the use of 1,1,1,2-tetrafluoroethane in combination with both a cosolvent having greater polarity than 1,1,1,2-tetrafluoroethane (e.g. an alcohol or a lower alkane) and a surfactant in order to achieve a stable formulation of a pharmaceutical composition powder. Additionally, surfactants may be used as important components of aerosol formulations, in order to reduce the aggregation of the pharmaceutical composition and to lubricate, e.g. valves of a dispersing apparatus, if employed according to a further preferred embodiment of the present invention, thereby ensuring consistent reproducibility of valve actuation and accuracy of dose dispensed. Typically, the pharmaceutical composition according to the present invention may be pre-coated with surfactant prior to dispersal in 1,1,1,2-tetrafluoroethane.
[0374] In a further preferred embodiment of the present invention a pharmaceutical aerosol formulation may be dispersed with any suitable apparatus known to the person skilled in the art, preferably through a metered dose inhaler (MDI), a nebulizer, Rotahaler or an autohaler apparatus.
[0375] Oral delivery can be performed by complexing the composition as defined herein carrier capable of withstanding degradation by digestive enzymes in the gut of an animal. Examples of such carriers include plastic capsules or tablets, such as those known in the art.
[0376] A suitable suppository may comprise the composition as defined herein together with colloidal silicon dioxide, and an oleaginous base that includes triglycerides.
[0377] Assays, e.g. as derivable from known and qualified literature sources, may optionally be employed to help identify optimal ratios and/or dosage ranges for ingredients of pharmaceutical compositions of the present invention. The precise dose and the ratio between the ingredients of the pharmaceutical composition as defined herein above to be employed in the formulation will also depend on the route of administration, and the exact type of disease or disorder, and should be decided according to the judgment of the practitioner and each patient's circumstances. Effective doses or ingredient ratios may be extrapolated from dose-response curves derived from in vitro or (animal) model test systems.
[0378] Typically, the attending physician and clinical factors may determine the dosage regimen. As is well known in the medical arts, dosages for any one patient depends upon many factors, including the patient's size, body surface area, age, the particular compound to be administered, sex, time and route of administration, general health, and other drugs being administered concurrently. A typical dose can be, for example, in the range of 0.001 to 1000 mg; however, doses below or above this exemplary range are also envisioned, especially considering the aforementioned factors.
[0379] In a preferred embodiment, the pharmaceutical composition as defined herein above is for use in the treatment or prevention of a disease or pathological condition.
[0380] A disease or pathological condition as used herein is any condition that would benefit from treatment with a pharmaceutical composition as defined above, in particular with a vehicle wherein the carrier comprises or is associated to a cargo, preferably a cargo as defined herein above.
[0381] The terms treat or treatment, unless otherwise indicated by context, refer to therapeutic treatment and/or prophylactic measures to prevent the outbreak or relapse of a disease or pathological condition, wherein the objective is to inhibit or slow down (lessen) an undesired physiological condition. For purposes of this invention, beneficial or desired clinical results include, but are not limited to, alleviation of symptoms, diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and remission (whether partial or total), whether detectable or undetectable. Treatment can also mean prolonging survival as compared to expected survival if not receiving treatment. Those in need of treatment include those already having the condition or disorder as well as those prone to have the condition or disorder. The treatment may further, in specific embodiments, involve a single administration of a pharmaceutical composition as defined above, or multiple administrations. A corresponding administration scheme may be adjusted to the sex or weight of the patient, the disease, the pharmaceutical composition to be used, the general health status of the patient etc. For example, the administration scheme may contemplate an administration every 12 h, 24 h, 28 h, 72 h, 96 h, once a week, once very two weeks, once every 3 weeks, once a month etc. Also envisaged are pauses or breaks between administration phases. These regimens can of course be adjusted or changed by the medical practitioner in accordance with the patient's reaction to the treatment and/or the course of disease or of the pathological condition.
[0382] In a particularly preferred embodiment of the present invention, the pharmaceutical composition as defined herein above is for use in the treatment or prevention of cancer. The term cancer as used herein relates to a pathological process that results in the formation and growth of a cancerous or malignant neoplasm, i.e., abnormal tissue that grows by cellular proliferation, often more rapidly than normal and continues to grow after the stimuli that initiated the new growth cease. Malignant neoplasms typically show partial or complete lack of structural organization and functional coordination with the normal tissue and most invade surrounding tissues, metastasize to several sites, and are likely to recur after attempted removal and to cause the death of the patient unless adequately treated. The tem thus also includes the existence and development of metastases. As used herein, the term neoplasia is used to describe all cancerous disease states and embraces or encompasses the pathological process associated with malignant hematogenous, ascitic and solid tumors.
[0383] Representative cancers include, for example, stomach, colon, rectal, liver, pancreatic, lung, breast, cervix uteri, corpus uteri, ovary, prostate, including metastatic prostate cancer, testis, bladder, renal, brain/CNS, head and neck, throat, Hodgkin's disease, non-Hodgkin's lymphoma, multiple myeloma, leukemia, melanoma skin cancer, non-melanoma skin cancer, acute lymphocytic leukemia, acute myelogenous leukemia, Ewing's sarcoma, small cell lung cancer, choriocarcinoma, rhabdomyosarcoma, Wilms' tumor, neuroblastoma, hairy cell leukemia, mouth/pharynx, oesophagus, larynx, kidney cancer and lymphoma Also envisaged are further cancer forms known to the skilled person or derivable from suitable literature sources such as Pavlopoulou et al., 2015, Oncol Rep., 33, 1, 3-18.
[0384] The cancer may, in certain embodiments, be a refractory cancer. A cancer may be assumed to be residually present if a subject has undergone surgery as treatment for the cancer. Also envisaged are metastasizing cancer forms, e.g. of thee above mentioned cancer forms.
[0385] The cancer forms mentioned above may preferably be treated by using tumor associated antigens or cancer antigens or cancer epitopes as described above, which are provided to Langerin.sup.+ DCs in the form of cargos as described herein above. These antigens or epitopes thereof are subsequently processed and presented by the Langerin.sup.+ cells to further immune cells and activate these immune cells leading to an immune response, e.g. via CTLs or antibodies against entities, e.g. cells, showing said antigen or epitope. The activation of these immune cells, in turn, depends on the maturation and activation of Langerin.sup.+ DCs which may be achieved by co-administration of suitable adjuvants. Non-limiting examples of such adjuvants are TLR or Rig-I-like receptors (RLR) agonists.
[0386] It is also envisaged that different antigens and/or different epitopes, e.g. either derived from different cancer forms, or derived from different proteins or glycoproteins, which may be present on the same cancerous cell or in the same tumor, are provided. These antigens or epitopes may, for example, be provided in a multiantigen fusion protein or a multiepitope protein (e.g. comprising 2, 3, 4, 5, 6, 7, 8 or more epitopes), or as single antigen/epitope units which are packed together in a cargo load. For example, different antigens may be mixed and subsequently be formulated in a carrier, e.g. a liposome as defined herein. Also preferred is the use of different molecular forms of the tumor antigen/epitopes within the cargo load. For example, it may be provided as protein/peptide, or as nucleic acid.
[0387] In a further, particularly preferred embodiment the term cancer also relates to Langerhans cell histocytosis (LCH), i.e. a cancerous change in Langerhans cells. Langerhans cell histiocytosis is a rare disease involving clonal proliferation of Langerhans cells. Clinically, its manifestations range from isolated bone lesions to multisystem disease. Langerhans cell histiocytosis is part of a group of clinical syndromes called histiocytoses, which are characterized by an abnormal proliferation of histiocytes (i.e. activated dendritic cells and macrophages). This cancer form is related to leukemia and lymphomas. The disease typically manifests at Langerin.sup.+ cell, i.e. cells expressing Langerin on the surface. Without wishing to be bound by theory, it is believed that hyperactive ERK can drive LCH pathogenesis. It is further believed that BRAF-V600E is involved in high-risk LCH due to its presence in hematopoietic cells in bone marrow. This can, for example, be explained by a misguided myeloid DC model of LCH pathogenesis where the state of cell differentiation in which pathologic ERK activation arises determines the clinical extent of LCH. Further factors which may contribute to aspects of pathogenesis are inflammatory infiltrates. LCH is hence assumed to be a myeloproliferative neoplasm or an inflammatory myeloid neoplasia. LCH may preferably be treated by using cytotoxic substances, small molecules, radionuclides or proteins, e.g. suitable antibodies such as antibodies against surface markers or proteins present on the cell surface, more specifically anti-Langerin antibodies and/or multicomponent systems as described above, which are provided to Langerin.sup.+ cells in the form of cargos as described herein above. Suitable antibodies to be used in the context of treatment of LCH include, for example, antibodies against BRAF V600E based on the finding that BRAF V600E. Also envisaged are antibodies against further mutations in the context of LCH as known to the skilled person.
[0388] In a further particularly preferred embodiment of the present invention, the pharmaceutical composition as defined herein above is for use in the treatment or prevention of an autoimmune disease. The term autoimmune disease as used herein relates to inappropriate immune responses that attack either self-tissues or innocuous environmental components as defined herein above. Examples of autoimmune diseases, which are envisaged by the present invention and can be treated with the described pharmaceutical composition, include Antiphospholipid-Syndrome (aPL syndrome), Pemphigus, Multiple Sclerosis (MS), Myasthenia gravis, Grave's disease, Goodpasture's syndrome, Microscopic angiitis, Granulomatosis with polyangiits, Systemic Autoimmune Rheumatic Diseases (SARD), Mixed Connective Tissue Disease, Systemic Lupus Erythematosus, Sjgrens Syndrome, Systemic Sclerosis/CREST Syndrome, Polymyositis/Dermatomyositis, Autoimmune Thyroid Diseases, Celiac Disease, Autoimmune Hepatitis, Primary Biliary Cirrhosis, ANCA Associated Diseases, Antiphospholipid Syndrome/Thromboembolic Syndrome, Anti-GBM Disease, Diabetes Mellitus, Pernicious Anemia, Vitiligo and Crohn's Disease. The treatment of autoimmune diseases as described above is based on the use of autoimmune disease antigens or autoimmune disease epitopes as described above, which are provided to Langerin.sup.+ DCs in the form of cargos as described herein above. In particular, Langerin.sup.+ DCs are known to induce the expansion of regulatory T cells and the antigen-specific deletion of CTLs, i.e. an antigen-specific tolerance, in absence of co-stimulatory signals, i.e. without the co-delivery of adjuvants. In the context of this treatment scheme the autoimmune disease antigens or autoimmune disease epitopes as described above is hence preferably provided without co-delivery of any adjuvant. It is further preferred that any co-stimulatory signal which leads to an activation of Langerin.sup.+ DCs be inhibited by any suitable means known to the skilled person.
[0389] In yet another particularly preferred embodiment of the present invention, the pharmaceutical composition as defined herein above is for use in the treatment or prevention of a bacterial infection. The term bacterial infection relates to the infection a patient, in particular of a human, with a pathogenic bacterium or a bacterium whose presence in the organism is unwanted, e.g. a part of a bacterial consortium or bioflora. Preferred examples include intracellular bacterial infections, e.g. conveyed by bacteria such as Chlamydophila, Ehrlichia, Rickettsia, Salmonella, Neisseria, Brucella, Mycobacterium, Nocardia, Listeria, Francisella, Legionella, or Yersinia. Further examples of pathogenic bacteria, whose infection is envisaged to be treated with the pharmaceutical composition according to the present invention include bacteria of the genus Bacillus, Bartonella, Bordetella, Borrelia, Campylobacter, Chlamydia, Clostridium, Corynebacterium, Enterococcus, Escherichia, Haemophilus, Helicobacter, Leptospira, Mycoplasma, Pseudomonas, Shigella, Staphylococcus, Streptococcus, Treponema, Ureaplasma and Vibrio. In specific embodiments, the bacterial infection to be treated may be an infection by one or more of the following species: Bacillus anthracis, Bacillus cereus, Bartonella henselae, Bartonella quintana, Bordetella pertussis, Borrelia burgdorferi, Borrelia garinii, Borrelia afzelii, Borrelia recurrentis, Brucella abortus, Brucella canis, Brucella melitensis, Brucella suis, Campylobacter jejuni, Chlamydia pneumoniae, Chlamydia trachomatis, Chlamydophila psittaci, Clostridium botulinum, Clostridium difficile, Clostridium perfringens, Clostridium tetani, Corynebacterium diphtheriae, Enterococcus faecalis, Enterococcus faecium, Escherichia coli, Francisella tularensis, Haemophilus influenzae, Helicobacter pylori, Legionella pneumophila, Leptospira interrogans, Leptospira santarosai, Leptospira weilii, Leptospira noguchii, Listeria monocytogenes, Mycobacterium leprae, Mycobacterium tuberculosis, Mycobacterium ulcerans, Mycoplasma pneumoniae, Neisseria gonorrhoeae, Neisseria meningitidis, Pseudomonas aeruginosa, Rickettsia rickettsii, Salmonella typhi, Salmonella typhimurium, Shigella sonnei, Staphylococcus aureus, Staphylococcus epidermidis, Staphylococcus saprophyticus, Streptococcus agalactiae, Streptococcus pneumoniae, Streptococcus pyogenes, Treponema pallidum, Ureaplasma urealyticum, Vibrio cholerae, Yersinia pestis, Yersinia enterocolitica and Yersinia pseudotuberculosis. Particularly preferred is the treatment of infections with Neisseria meningitides, Corynebacterium diphtheria, Bordetella pertussis or Clostridium tetani.
[0390] In the context of a bacterial infection, the term treating includes any or all of: inhibiting the growth of bacteria, multiplication or replication of the pathogen that causes the infectious disease and ameliorating one or more symptoms of an infectious disease. The infections with bacteria as mentioned above may preferably be treated by using bacterial antigens or bacterial epitopes as described herein, or which are known to the skilled person, e.g. from suitable literature source such as Detmer and Glenting, 2006, Microbial Cell Factories, 5, 23, which are provided to Langerin.sup.+ DCs in the form of cargos as described herein above. These antigens or epitopes thereof are subsequently processed and presented by the Langerin.sup.+ cells to further immune cells and activate these immune cells leading to an immune response, e.g. via CTLs or antibodies against entities, e.g. bacteria or parts thereof, showing said antigen or epitope. It is also envisaged that different antigens and/or different epitopes, e.g. either derived from different bacteria, or derived from different proteins or glycoproteins, which may be present on the same bacterium are provided. These antigens or epitopes may, for example, be provided in a multiantigen fusion protein or a multiepitope protein (e.g. comprising 2, 3, 4, 5, 6, 7, 8 or more epitopes), or as single antigen/epitope units which are packed together in a cargo load. Also preferred is the use of different molecular forms of the bacterial antigen/epitopes within the cargo load. For example, it may be provided as protein/peptide, as an oligosaccharide or as nucleic acid. It is further preferred that bacterial antigens/epitopes, if several are provided, are provided in combination or as mixtures of antigens/epitipoes, e.g. when a liposome is formulated or generated.
[0391] In another particularly preferred embodiment of the present invention, the pharmaceutical composition as defined herein above is for use in the treatment or prevention of a viral infection. The term viral infection as used herein refers to an infection and/or disease caused by a pathogenic virus or an infectious virus particle (virion). Examples of pathogenic viruses or virions, whose infection is envisaged to be treated with the pharmaceutical composition according to the present invention include viruses of the groups: Adenoviridae, Picornaviridae, Herpesviridae, Hepadnaviridae, Flaviviridae, Retroviridae, Orthomyxoviridae, Paramyxoviridae, Papillomaviridae, Rhabdoviridae, Togaviridae. In specific embodiments, the viral infection to be treated may be an infection by one or more of the following virus types: Adenovirus, Coxsackievirus, Epstein-Barr virus, Hepatitis A virus, Hepatitis B virus, Hepatitis C virus, Herpes simplex virus, type 1, Herpes simplex virus, type 2, Cytomegalovirus, Human herpesvirus, type 8, HIV, Influenza virus, Measles virus, Mumps virus, Human papillomavirus, Parainfluenza virus, Poliovirus, Rabies virus, Respiratory syncytial virus, Rubella virus, Varicella-zoster virus. Particularly preferred is the treatment of infections with Human papillomavirus, Hepatitis A virus and Hepatitis B virus.
[0392] In the context of a viral infection, the term treating includes any or all of: inhibiting the growth of viruses, multiplication or replication of the pathogen that causes the infectious disease and ameliorating one or more symptoms of an infectious disease. The infections with viruses or virions as mentioned above may preferably be treated by using viral antigens or viral epitopes as described herein, or which are known to the skilled person, e.g. from suitable literature source such as Ansari et al., 2010, Nucleic Acids Res, 38, D847-D853 or from internet resources such as https://www.who.int/immunization/diseases/en/ (last visited on Dec. 4, 2018), which are provided to Langerin.sup.+ DCs in the form of cargos as described herein above. These antigens or epitopes thereof are subsequently processed and presented by the Langerin.sup.+ cells to further immune cells and activate these immune cells leading to an immune response, e.g. via CTLs or antibodies against entities, e.g. viruses or parts thereof, showing said antigen or epitope. It is also envisaged that different antigens and/or different epitopes, e.g. either derived from different viruses, or derived from different proteins or glycoproteins, which may be present on or in the same virus are provided. These antigens or epitopes may, for example, be provided in a multiantigen fusion protein or a multiepitope protein (e.g. comprising 2, 3, 4, 5, 6, 7, 8 or more epitopes), or as single antigen/epitope units which are packed together in a cargo load. For example, different antigens may be mixed and subsequently be formulated in carrier, e.g. a liposome as defined herein. Also preferred is the use of different molecular forms of the virus antigen/epitopes within the cargo load. For example, it may be provided as protein/peptide, as an oligosaccharide or as nucleic acid.
[0393] In yet another particularly preferred embodiment of the present invention, the pharmaceutical composition as defined herein above is for use in the treatment or prevention of a parasitic infection. The term parasitic infection relates to the infection a patient, in particular of a human, with a parasite. Such an infection may, but must not necessarily lead to a parasitic disease or parasitosis, i.e. an infectious disease caused or transmitted by a parasite. The present invention thus not only envisages the treatment of parasitic diseases per se, but also the treatment of infections by parasites which may not lead to a disease. Such infection may still be considered problematic for a patient's health, e.g. due to use of energy or food resources by the parasite, fatigue, or psychic problems due to, e.g. the knowledge of being infected. Also, from an epidemiologic perspective the treatment of such infections is advantageous since thereby a further dissimilation can be prevented. The parasite whose infection is to be treated is, as described above, a parasite of mammals, in particular of humans. The parasite typically belongs to the group of protozoa or metazoan. Examples of parasites, whose infection is envisaged to be treated with the pharmaceutical composition according to the present invention include flagellates, amebae, sporozoa, and ciliates, as well as plathelminthes. In specific embodiments, the parasitic infection to be treated may be an infection by one or more of the following genuses or species: Giardia, Trichomonas, Trypanosoma, Leishmania, Entamoeba, Naegleria, Acanthamoeba, Cryptosporidium, Cyclospora, Toxoplasma, Plasmodium, Balantidium coli, Fasciola hepatica, Taenia, Schistosoma, Wuchereria bancrofti and Onchocerca volvulus. Particularly preferred is the treatment of infections with Plasmodium.
[0394] In the context of a viral infection, the term treating includes any or all of: inhibiting the growth of parasites, multiplication or replication of the pathogen that causes the infectious disease and ameliorating one or more symptoms of the parasitic infection. The infections with parasites as mentioned above may preferably be treated by using parasitic antigens or parasitic epitopes as described herein, or which are known to the skilled person, e.g. from suitable literature source such as Ansari et al., 2010, Nucleic Acids Res, 38, D847-D853, Tarleton, 2005, Cellular Microbiology, 7, 10, 1379-1386 or Higashi, 1988, Ann Rev Public Health, 9, 483-501, which are provided to Langerin.sup.+ DCs in the form of cargos as described herein above. These antigens or epitopes thereof are subsequently processed and presented by the Langerin.sup.+ cells to further immune cells and activate these immune cells leading to an immune response, e.g. via CTLs or antibodies against entities, e.g. viruses or parts thereof, showing said antigen or epitope. It is also envisaged that different antigens and/or different epitopes, e.g. either derived from different parasites, or derived from different proteins or glycoproteins, which may be present on or in the same parasite are provided. These antigens or epitopes may, for example, be provided in a multiantigen fusion protein or a multiepitope protein (e.g. comprising 2, 3, 4, 5, 6, 7, 8 or more epitopes), or as single antigen/epitope units which are packed together in a cargo load. For example, different antigens may be mixed and subsequently be formulated in carrier, e.g. a liposome as defined herein. Also preferred is the use of different molecular forms of the parasite antigen/epitopes within the cargo load. For example, it may be provided as protein/peptide, as an oligosaccharide or as nucleic acid.
[0395] In yet another particularly preferred embodiment of the present invention, the pharmaceutical composition as defined herein above is for use in the treatment or prevention or of a graft-vs. host disease. The term graft-vs. host disease as used herein relates to a medical complication following the receipt of transplanted tissue from a genetically different person. Graft-vs. host disease is typically associated with stem cell transplants such as those that occur with bone marrow transplants. Graft-vs. host disease may also apply to other forms of transplanted tissues such as solid organ transplants. Without wishing to be bound by theory, it is assumed that the disease is caused by the fact that white blood cells of the donor's immune system which remain within the donated tissue (the graft) recognize the recipient (the host) as foreign (non-self). The white blood cells present within the transplanted tissue then typically attack the recipient's body's cells, which leads to graft-vs. host disease. The graft-vs. host disease is different from a transplant rejection, which occurs when the immune system of the transplant recipient rejects the transplanted tissue; graft-vs. host disease, on the other hand, occurs when the donor's immune system's white blood cells reject the recipient. Graft-vs. host disease can also occur after a blood transfusion if the blood products used have not been irradiated or treated with an approved pathogen reduction system. The present invention envisages that the host of the donated tissue (the graft) is provided with an MHC antigen comprised in the donated tissue, e.g. an antigen of the graft or the donor of the tissue. This antigen may advantageously be provided to Langerin.sup.+ DCs cells via as cargo in a suitable carrier as defined herein. This step may be followed is typically followed by an expansion and activation of MHC specific regulatory T cells, which leads to an antigen-specific deletion of CTLs, i.e. an antigen-specific tolerance in the absence of co-stimulatory signals, e.g. without the co-delivery of adjuvants. In the context of this treatment scheme the antigens or autoimmune disease epitopes as described above are preferably provided without co-delivery of any adjuvant. It is further preferred that any co-stimulatory signal which leads to an activation of Langerin.sup.+ DCscells be inhibited by any suitable means known to the skilled person. Further details may be derived from suitable literature sources such as Sela et al., 2011, J. Exp. Med., 208, 12, 2489-2496.
[0396] In a further embodiment, the present invention further envisages that the immunological reaction of the donor of the donated tissue (the graft) be inhibited, e.g. ex vivo. Accordingly, the present invention relates, for example, to the use of skin transplants in which LCs in the donor graft are specifically killed ex vivo. Further details can be derived, for example, from Zell et al., 2008, Journal of Investigative Dermatology, 128, 8, 1874, Obhrai et al., 2008, Journal of Investigative Dermatology, 128, 8, 1950-1955; Molinero et al., 2007, American Journal of Transplantation, 8, 1; Adhikary et al., 2018, Transplantation, 102, S235 or Yamano et al., 2011, Blood, 117, 2640-2648.
[0397] In additional, particularly preferred embodiment of the present invention, the pharmaceutical composition as defined herein above is for use in the treatment or prevention of local or systemic inflammation. The term inflammation as used herein relates to complex biological response of body tissues to damaging or harmful stimuli, such as pathogens, damaged cells, or irritants. The inflammation is a protective response involving immune cells, blood vessels, and molecular mediators. The function of inflammation is to eliminate the initial cause of cell injury, clear out necrotic cells and tissues damaged from the original insult and the inflammatory process, and initiate tissue repair. Inflammation is a generic response, and therefore it is considered as a mechanism of innate immunity. The process of inflammation is initiated by resident immune cells already present in the involved tissue, in particular resident macrophages, dendritic cells, histiocytes (Langerhans cells), Kupffer cells and mast cells. These cells possess surface receptors known as pattern recognition receptors (PRRs), which recognize two subclasses of molecules: pathogen-associated molecular patterns (PAMPs) and damage-associated molecular patterns (DAMPs). PAMPs are compounds that are associated with various pathogens, but which are distinguishable from host molecules. DAMPs are compounds that are associated with host-related injury and cell damage. At the onset of an infection, burn, or other injuries, these cells undergo activation (one of the PRRs recognize a PAMP or DAMP) and release inflammatory mediators responsible for the clinical signs of inflammation. Vasodilation and its resulting increased blood flow cause the redness and increased heat. Increased permeability of the blood vessels results in an exudation of plasma proteins and fluid into the tissue, which manifests itself as swelling. Some of the released mediators such as bradykinin increase the sensitivity to pain. The mediator molecules also alter the blood vessels to permit the migration of leukocytes, mainly neutrophils and macrophages, outside of the blood vessels into the tissue. The neutrophils migrate along a chemotactic gradient created by the local cells to reach the site of injury. The loss of function is probably the result of a neurological reflex in response to pain.
[0398] When inflammation overwhelms the host, i.e. becomes a systemic inflammation, a systemic inflammatory response syndrome is given. When it is due to infection, the syndrome is considered as sepsis. Vasodilation and organ dysfunction may occur with widespread infection that may lead to septic shock and death. In contrast thereto, a local inflammation is confined to the location or tissue region of the first harmful stimulus, injury or damage. Without wishing to be bound by theory, it is currently believed that Langerhans cells modulate regulatory, T cells which in turn can shut down inflammatory responses, e.g. as described in Sharabi et al., 2018, Nature Reviews Drug Discovery, 17, 823-844. It is further assumed that fact that Langerhans cells can induce an anti-inflammatory response via Tregs, as is derivable from suitable literature resources such as Stary et al., 2011, J Immunol, 186, 1, 103-112. The envisaged treatment approach involves the provision of suitable compounds such as glucocorticosteroids which may be comprised in a carrier as defined herein to Langerin.sup.+ cells via the vehicle of the present invention. There an anti-inflammatory response may accordingly be initiated. Further information can be derived from Bartneck et al., 2014, Nanomedicine, 10, 6, 1209-20.
[0399] In a further particularly preferred embodiment of the present invention, the pharmaceutical composition as defined herein above is for use in the treatment or prevention of allergy. The term allergy as used herein relates to a pathological condition caused by hypersensitivity of the immune system to a stimulus from the environment that normally, i.e. in a healthy subject cause little or no problem. The allergy is hence a condition in which the patient produces an abnormally vigorous immune response in which the immune system defends the organism against a perceived threat that would otherwise be harmless to the body. The underlying mechanism is assumed to involve immunoglobulin E antibodies (IgE), binding to an allergen, e.g. as defined herein above and to a receptor on mast cells or basophils where it triggers the release of inflammatory chemicals such as histamine.
[0400] In a further particularly preferred embodiment of the present invention, the pharmaceutical composition as defined herein above is for use in hyposensitization. The term hyposensitization which is also known as desensitization or hypo-sensitization, is an allergen immunotherapy in the form of a medical treatment for some types of allergies which relies on the administration of increasing doses of allergens to drive immune responses from IgE production towards the induction of regulatory T cell responses, thereby promoting allergen-specific tolerance. The present invention can be used to directly induce regulatory T cell responses with higher efficiency via the selective delivery of allergens to Langerin.sup.+ DCs, specifically Langerhans cells, in the absence of adjuvants.
[0401] The present invention further envisages the treatment of any other disease or medical condition which is directly or indirectly linked to cells expression Langerin on their surface, in particular DCs. In particular, the cargo, which may be comprised in or associated with the carrier as defined herein above, may be an active pharmaceutical or immunological compound, which is, for example, capable of eliciting an immunological reaction in the body, which operates as an immunomodulator, as an immunological tolerance inducer or as an inhibitor of cellular function, such as an inhibitor of apoptosis. Moreover, the active pharmaceutical or immunological compound which is delivered into a Langerin.sup.+ cell may, upon said delivery, allow for a specific activation or suppression of the immune system, preferably via pathways typical for DCs. This activation or modulation of the immune system may be useful for in vivo treatment or prevention of a disease. The disease to be treated may accordingly not be developed or already exists in the subject to be treated.
[0402] In another aspect, the invention relates to a diagnostic composition comprising the vehicle as defined above or the composition as defined above, wherein the carrier comprises or is associated to a diagnostically suitable cargo. The term diagnostically suitable cargo as used herein relates to cargo entities selected from any of the following: a small molecule, a peptide, a protein, a nucleic acid, a metal, a radionuclide, a toxin, a dye, and a pigment. It is preferred that all of the mentioned elements correspond to those defined herein above in the context of the cargo, including additional examples of the mentioned elements. Particularly preferred are dyes, which can be used to target and visualize Langerin.sup.+ cells in different contexts, e.g. the skin or lymphatic tissue. Also envisaged are combinations of the above-mentioned cargos, e.g. a protein and a nucleic acid, or a protein and a dye, or a small molecule and a dye etc. In further, preferred embodiments, the carrier as mentioned may comprise or be associated to a diagnostically suitable cargo, e.g. a dye, and at the same time to a therapeutically suitable cargo, e.g. a small molecule etc. as defined herein. The presence of the diagnostically suitable cargo may accordingly be used to detect and/or count the delivery of the therapeutically suitable cargo. The diagnostic composition may further comprise a pharmaceutically acceptable carrier as defined herein above in the context of the pharmaceutical compositions, or a pharmaceutical adjuvant as defined herein above in the context of the pharmaceutical compositions.
[0403] In specific embodiments, the diagnostic composition as defined herein may be used to directly diagnose Langerhans cell-related diseases, e.g. LC-histocytosis, wherein the diagnostic composition may comprise a disease specific marker/biomarker or comprise a suitable component which allows to detect LC histocytosis.
[0404] In further embodiments the diagnostic composition as described herein may be used for prognostic and/or predictive uses. For example, the diagnostic composition may be used to assess changes in the Langerhans cell activation level and/or the cross-presentation levels of disease-specific antigens or allergens, e.g. before, during or after a treatment, preferably directly following a treatment. Such uses particularly envisage diagnostisc compositions comprising labelled markers for activation signalesignals such as RNA, peptide or protein level markers. These markers may be delivered or co-delivered, together with further components such as pharmaceutically active compounds as defined herein, to the target cell, i.e. a Langerin.sup.+ cell via the vehicle and carrier as defined herein.
[0405] Therefore a labeled marker for activation signals (on RNA, peptide/protein level) could be co-delivered using the system In a preferred embodiment, the diagnostic composition as defined above is for use in detecting or monitoring a treatment approach and/or the efficacy of said treatment approach based on a pharmaceutical composition as defined herein against cancer, an autoimmune disease, a bacterial infection, a viral infection, or a graft-vs. host disease local or systemic inflammation or allergy.
[0406] In a further aspect, the invention relates to a method of identifying a suitable dose for a dendritic cell-targeting therapy of a disease comprising: (a) contacting a population of Langerin.sup.+ cells with a compound capable of being introduced into the cells; (b) determining the number of cells which incorporated said compound; (c) determining a suitable dose of the compound by comparing the number of cells with incorporated the compound and the starting population. The term dendritic cell-targeting therapy as used herein relates to the use of a pharmaceutical composition as described herein. Preferably, the term relates to therapy forms or uses of pharmaceutical compositions which involve an interaction of a vehicle as defined herein, more preferably comprising a cargo as defined herein, via a ligand as part of the conjugate as defined herein and the cognate receptor Langerin. Accordingly, the disease may be any disease mentioned herein above, e.g. cancer, or a bacterial, viral, parasitic infection, allergy etc. The step contacting a population of Langerin.sup.+ cells with a compound means that said compound is brought into contact with or is brought into the vicinity of said cell or is delivered to said cell, preferably via the vehicle as defined above. The cells are either derived from a cell culture in vitro, or are ex vivo cells obtained form a patient's skin. It is particularly preferred that the number of cells which are used is determined or known. These cells may accordingly be provided in a confined environment, e.g. a reaction chamber etc. The compound is a compound capable of being introduced into the cells, which means that the compound can be internalized by the Langerin.sup.+ cells, for example by endocytosis. Such approach may, for example, comprise an in vitro step, wherein LCs are stained, or wherein a flow cytometric analysis is performed. The introduction of the compound may preferably be performed via endocytosis of the Langerin.sup.+ cells.
[0407] For example, in a specific embodiment, the approach may be is implemented as in vitro approach, wherein Langerin.sup.+ cells may be labeled with a composition according to the present invention, e.g. comprising a dye. Further envisaged is the employment of flow cytometry to separate labeled from not labeled cells. Also envisaged is the implementation as in vivo approach or as a combined in vitro/ex vivo approach. The compound may, in specific embodiments, be a cargo as defined herein above, preferably a dye or pigment, more preferably it is Alexa Fluor 647.
[0408] The step of determining the number of cells which incorporated said compound as used in step b) of the method relates to any suitable analysis process, which allows differentiating the cells which have incorporated the compound from those which have not. Preferably, this process is a fluorescence detection process, which identifies those cells which have incorporated a dye or pigment form those which have not. More preferably it is a process based on the use of Alexa Fluor 647. Accordingly, the number of cells which have incorporated the compound vs. the cells which have not incorporated said compound can be determined by counting those cells which show, for example, a fluorescence signal or stain and deduct the number from the number of originally provided cells, i.e. the overall number of cells used in the assay, thus resulting in the number of non-fluorescent or non-stained cells. Finally, the dose of a compound, or of any similar or comparable compound by analogy, may be determined by correlating the amount of compound used with the number or percentage of cells with incorporated compounds. Accordingly, by increasing the amount of compound delivered to the cells, the percentage of cells with incorporation of compounds may be increased. In additional embodiments, also alternative parameters may be changed, e.g. the presence of additives, the formulation of the compound, the presence of divalent ions etc. A suitable dose may thus, according to certain embodiments be a percentage of 50%, 60%, 70%, 75%, 80%, 85%, 90% or more than 90% of cells which show an incorporation of the compound, e.g. by fluorescence accordingly to the above described steps. Furthermore, the method may be performed as described in the Examples, e.g. in Example 10. Further information may be derived from suitable literature sources such as Boyd and Jackson, 2015, Cell Host & Microbe, 17, 301-307.
[0409] In a preferred embodiment, the comparison of cells with incorporated compounds vs. non-incorporated compound may be performed after a period of 1-3 days, e.g. after 24 h, 30 h, 36 h, 40 h, 48 h, 55 h, 60 h, 65 h, or 72 h.
[0410] In a further embodiment, the number of cells with incorporated compound may be compared with observed literature results or results derivable from a database or internet repository. For example, the incorporation percentage, the calculated suitable dose etc. of compound may, for example, be compared with data for other compounds in the same assay or a similar assay from a database. In certain embodiments, the database may be a database developed with information from different approaches/different compounds according to the present invention. Also, information from further projects outside of the present invention may be used for such a database.
[0411] In a further aspect the present invention relates to a medical kit comprising at least one element selected from the vehicle as defined herein above and/or the composition as defined herein above, wherein the carrier comprises or is associated to a pharmaceutically active cargo. The kit may optionally comprise a leaflet with instructions. The term medical kit includes any pharmaceutical composition as defined above, a medical device, a therapeutic as mentioned above etc. In further specific embodiments the medical kit may also be a vaccine, diagnostic, prognsotic or predictive kit comprising suitable ingredients for the performance of vaccination, for the performance of a diagnosis of a disease associated with Langerin, e.g. as defined herein, or the prognostic or predictive determination of a e health status with respect to such a disease. In further embodiments, a medical kit may comprise any medical device in a package. The term medical device comprises a syringe, a needle, e.g. a needle of syringe, a vaccination gun, a plaster, or an inhaler, preferably as defined herein above. The vehicle of the invention or a composition thereof may, for example, be administered via a medical device. Moreover, the vehicle or a composition thereof may be stored in the medical device. The term package insert or leaflet with instructions is used to refer to instructions customarily included in commercial packages of therapeutic products that contain information about the indication(s), usage, dosage, administration, contraindications and/or warnings concerning the use of such therapeutic products. The leaflet with instructions may be part of a medical kit.
[0412] In yet another aspect the present invention relates to a vaccine comprising the vehicle as defined above, or the composition as defined above, wherein the carrier comprises or is associated to an inoculant cargo, e.g. as defined herein above.
[0413] The term vaccine is to be seen as composition including, in preferred embodiments, the vehicle or the composition as defined above, which is suitable for a vaccination of a subject. A vaccine composition has been described herein above in the context of pharmaceutical compositions. It is particularly preferred that the vaccine comprises an adjuvant, in particular an immunologic adjuvant as described above. The vaccine may, for example comprise a therapeutically effective amount of the vehicle comprising a cargo as defined above. For example, the vaccine may, in preferred embodiment comprise proteins and/or nucleic acids as immunogenic elements.
[0414] The term vaccination refers to the elicitation of an immune response against a tumro via a cancer antigen, a bacterial infection via a bacterial antigen, a viral infection via a viral antigen, a parasitic infection via parasitic antigen as defined above, in a subject comprising administering to said subject a therapeutically effective amount of the vehicle comprising a cargo as defined above. Preferably, the carrier of the vehicle of the invention comprises a cargo which is or comprises a cancer antigen or epitope as defined above, a bacterial antigen or epitope as defined above, a viral antigen or epitope as defined above, a parasitic antigen or epitope, as defined above. Also envisaged is the vaccination with entities described in the context of graft-vs. host disease as defined above. The present invention, in particular, envisages the use of liposome or nanoparticle carriers as defined herein for vaccination purposes. It is further preferred that the liposome or nanoparticle carrier comprises a peptide or protein antigen as described herein. The peptide or protein antigen may accordingly be comprised in or encapsulated in said liposome or nanoparticle carrier as described herein. The administration of said carrier is preferably an intradermal injection as described herein or a transcutaneous administration as described herein, preferably an administration via microneedle patches.
[0415] The vaccine may, in preferred embodiments, be for use in treating or preventing cancer, an autoimmune disease, bacterial infection, viral infection, a parasitic infection or graft-vs. host disease.
[0416] The immunisation may be performed according to any scheme or schedule known to the skilled person, e.g. derivable from www.who.int/immunization/documents/en/ (last visited on Dec. 4, 2018) or similar sources of information. The schedule may, for example, comprise several doses of the vaccine composition comprising the vehicle or the composition as defined above. In one embodiment of the invention, at least 1 dose of the vaccine composition is administered to the subject. In another embodiment, the vaccination consists of 1 dose of the vaccine composition. In another embodiment a subject receives an initial 2 dose vaccination, but does not receive further administrations of the vaccine composition, or receives a further administration after a predefined period of time of at least 1 month, or 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 or 12 months or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, etc. years. The interval in between administration of several, e.g. two or more, doses of the vaccine may further be varied between 1 week and about one year or more, or between 1 month and one year, or between 1 and 3 months.
[0417] The administration of the vaccine may be performed according to any suitable administration scheme and on any suitable route, e.g. subcutaneously, transdermally, intradermally, intramuscularly, orally, via corneal or nasal route, intravenously, topically, or via hair follicles etc. It is particularly preferred to use transdermal, intradermal or subcutaneous routes, e.g. as intradermal injection. The application is preferably performed with needles, microneedles, nanopatches, hydrogel patches, vaccination guns etc. as described above.
[0418] Similarly, in a further aspect the present invention relates to a method of inducing an immune response against cancer, a bacterial infection, a viral infection or a parasitic infection in a subject comprising administering to said subject a therapeutically effective amount of the vehicle as defined above, wherein the carrier comprises or is associated to a pharmaceutically active cargo as defined above, or the composition as defined above, wherein the carrier comprises or is associated to a pharmaceutically active cargo as defined above, or the pharmaceutical composition as defined above, or the vaccine as defined above. The method essentially comprises the steps of providing an immunoactive compound as mentioned herein to a Langerin.sup.+ cell and thereby cause said Langerin.sup.+ cell to incorporate said compound, process it and displays it or one or more parts of it on its surface to induce a reaction of other immune cells, or of the immune system, or to elicit in any other suitable manner an immune response via Langerin.sup.+ cells. The method may, in particularly preferred embodiments, comprise vaccination steps as defined herein above. In particular, vaccination schemes and schedules as mentioned may be employed.
[0419] The term effective amount includes an amount effective, at dosages and for periods of time necessary, to achieve the desired result. An effective amount of compound may vary according to factors such as the disease state, age, and weight of the subject, and the ability of the compound to elicit a desired response in the subject. Dosage regimens may be adjusted to provide the optimum therapeutic response. An effective amount is also one in which any toxic or detrimental effects (e.g., side effects) of the inhibitor compound are outweighed by the therapeutically beneficial effects.
[0420] The term therapeutically effective amount refers to that amount of the compound being administered sufficient to prevent development of, or alleviate to some extent one or more of the symptoms of the condition or disorder being treated.
[0421] A therapeutically effective amount of compound (i.e., an effective dosage) may may be determined in view of the body weight of the patient and other factors known to the skilled person. The therapeutically effective amount may further be defined as concentration, e.g. in the pM or M range. The skilled person will appreciate that certain factors may influence the dosage required to effectively treat a subject, including but not limited to the severity of the disease or disorder, previous treatments, the general health and/or age of the subject, and other diseases present. Moreover, treatment of a subject with a therapeutically effective amount of a compound can include a single treatment or, preferably, can include a series of treatments. In one example, a subject is treated with a compound one or several times per day for between about 1 to 50 weeks, or any other suitable period of time. In another example, a subject may be treated daily for two or more years in the setting of a chronic condition or illness. It will also be appreciated that the effective dosage of a compound used for treatment may increase or decrease over the course of a particular treatment.
[0422] In yet another aspect the present invention relates to a method of treatment or prevention of cancer, of an autoimmune disease, of a bacterial infection, of a viral infection, of a parasitic infection, or of a graft-vs. host disease, of a local or systemic inflammation, or of allergy, comprising administering to a subject a therapeutically effective amount of the vehicle as defined above, wherein the carrier comprises or is associated to a pharmaceutically active cargo, the composition as defined herein above, wherein the carrier comprises or is associated to a pharmaceutically active cargo, the pharmaceutical composition as defined above, or the vaccine as defined above. The method may any suitable administration scheme as described herein above. The compound to be used for the method is in a particularly preferred embodiment a pharmaceutical composition as described above, or a vaccine as described herein above. The method of treatment, in particularly preferred embodiments, contemplates an administration via an oral, corneal, nasal, intravenous, topical, subcutaneous, epicutaneous, intradermal, transdermal route or a vaccination or an administration via hair follicles.
[0423] The administration of the vehicle, composition, pharmaceutical composition or vaccine may be in combination with a chemotherapeutic agent in particular if the treatment of against cancer. Suitable examples include checkpoint inhibitors or CAR T-cells. The chemotherapeutic agent may preferably be any cytotoxic substance as mentioned above. The treatment with a chemotherapeutic agent preferably is performed on another way than the presently described interaction with DCs, i.e. not via Langerin.sup.+ cell. For example, the chemotherapeutic agent may be administered in a systemic manner, or intravenously etc. The chemotherapeutic agent may accordingly support a vaccination approach against cancer by destroying cancerous cells chemotherapeutically. For example, an approach based on a combination with a chemotherapeutic agent may be based on systemic chemotherapy which is capable of modulating immune phenotypes of residual tumor cells, e.g. after the tumor mass has been optimally reduced with surgery. Another approach may be based on the enhancement of tumor antigen presentation by upregulating the expression of tumor antigens themselves, or of the MHC Class I molecules to which the antigens bind. Furthermore, chemotherapy may be used to upregulate co-stimulatory molecules (e.g. B7-1) or down-regulate co-inhibitory molecules (e.g. PD-L1/B7-H1 or B7-H4) expressed on the tumor cell surface, which leads to an enhancement of the strength of effector T cell activity. In a further embodiment, chemotherapy may be used to render tumor cells more sensitive to T cell-mediated lysis through fas-, perforin-, or granzyme B-dependent mechanisms.
[0424] In a further aspect the present invention relates to a method of hyposensitization. The present invention accordingly envisages that the allergic patient is provided with an antigenic allergen. This allergen may advantageously be provided to Langerin.sup.+ cell via as cargo in a suitable carrier as defined herein. It is particularly preferred that the antigenic allergen be provided in more than one dose. The number of doses and/or the concentration of allergen may be increased over the treatment period. This provision step, which may be repeated one or several times, is typically followed by an expansion and activation of antigenic allergen specific regulatory T cells, which leads to an allergen-specific deletion of CTLs, i.e. an allergen-specific tolerance in the absence of co-stimulatory signals, e.g. without the co-delivery of adjuvants. In the context of this treatment scheme the allergens as described above are preferably provided without co-delivery of any adjuvant. It is further preferred that any co-stimulatory signal which leads to an activation of Langerin.sup.+ cells be inhibited by any suitable means known to the skilled person. Further details may be derived from suitable literature sources such as Sela et al., 2011, J. Exp. Med., 208, 12, 2489-2496.
[0425] The invention is further described in the following examples, which are not intended to limit the scope of the invention.
EXAMPLES
Example 1
Langerin-Expressing Hek293 Cells
[0426] The human embryonic kidney cell line Hek293 was maintained in DMEM medium with GlutaMax supplemented with 10% FCS (Biochrom) and 100 U/ml Penicillin-Streptomycin. Cells were cultured to 70% confluence and subcultured with trypsin every 2-3 days. Unless stated otherwise, all media and supplements were purchased from Thermo Fisher Scientific. Cells were grown under controlled conditions at 37 C. and 5% CO2. Cells were monitored with a light microscope (IT40 SPH, VWR) and cultured in Petri dishes (Corning). Cells were subcultured with the proteolytic enzyme trypsin in combination with 0.25% EDTA. In routine subculture, all cells were centrifuged at 500 g for 3 min (Heraeus Megafuge 8R, Thermo Fisher Scientific). The supernatant was aspirated and cells were resuspended in fresh growth medium. As a quality control, cells were frequently tested free from mycoplasma contamination using a MycoAlert Mycoplasma Detection Kit (Lonza). No contamination was detected. Cells were counted with an automatic cell counter (Eve, Montreal Biotech). To cryopreserve cells, vital cells were counted, centrifuged, aspirated and resuspended in freezing medium consisting of 90% growth medium and 10% DMSO (cell culture grade, Euro Clone). Cryo vials were then transferred into a cryo vial container filled with isopropanol (Mr. Frosty, Nalgene). The container was stored at 80 C. for at least 24 h and for long-time storage vials were preserved in liquid nitrogen.
[0427] The cDNA ORF clone of human Langerin was purchased from sinobiological, The gene was cloned from a pcDNA5/FRT/V5-His-TOPO TA vector (life technologies) into an RP172 expression vector (K. J. Koymans et al., Staphylococcal Superantigen-Like Protein 1 and 5 (SSL1 & 55L5) Limit Neutrophil Chemotaxis and Migration through MMP-Inhibition. International journal of molecular sciences 17, 2016) by Gibson Assembly, according to the manufacturer's instruction. Briefly, gene fragments were amplified with an overhang from the destination vector by PCR using a Phusion high-fidelity DNA polymerase (NEB). For the PCR reaction a master mix was prepared consisting of 10 l Phusion HF buffer (NEB), 5 l of 2 mM dNTPs (Carl Roth), 0.5 l Phusion polymerase (NEB) and 29 l H.sub.2O per reaction. To each reaction 0.5 l of 50 M primer and 2.5 l of approximately 10 ng/ml template vectors were added. The destination vector was linearized by PCR (Mastercycler nexus gradient, Eppendorf). Here, 0.6 l DMSO (NEB) was added. The PCR products were quality checked by agarose gel electrophoresis and DNA concentration was measured with a nanodrop (Implen Nanophotometer).
[0428] In particular, for the generation of Langerin clones, Langerin variant clones and mLangerin clones, as well as for the generation of DC-SIGN and mDectin clones the following primer sequences and PCR conditions were used:
TABLE-US-00001 PCR Name Sequence(5to3) Direction SEQIDNO: conditions hLangerinpcDNA3.1(+) CTGGCTAGCGTTTAAA forward 17 62C./30sec/ CTTAAGCATGACTGTG primer 35 GAGAAGGAGGCC hLangerinpcDNA3.1(+) CTAGACTCGAGCGGCC reverse 18 62C./30sec/ TCACGGTTCTGATGGG primer 35 AC hLangerinBackbone GCTTAAGTTTAAACGC forward 19 59C./2.5 plasmidpcDNA3.1(+) TAGCC primer min/20 hLangerinBackbone GGCCGCTCGAGTCTAG reverse 20 59C./2.5 plasmidpcDNA3.1(+) AG primer min/20 hLangerinpcDNA5 CTGGCTAGCGTTTAAA forward 21 59C./1min/ CTTAAGCATGACTGTG primer 35 GAGAAGGAGGCC hLangerinpcDNA5 GTGATGGTGATGATG reverse 22 59C./1min/ ACTCACGGTTCTGATG primer 35 GGAC hLangerinBackbone GCTTAAGTTTAAACGC forward 23 62C./3.5 plasmidpcDNA5 TAGCC primer min/20 hLangerinBackbone GTCATCATCACCATCA reverse 24 62C./3.5 plasmidpcDNA5 CC primer min/20 hLangerinRP172 CTGGCTAGCGTTTAAA forward 25 60C./1min/ CTTAAG primer 35 hLangerinRP172 CAATGGTGATGGTGAT reverse 26 60C./1min/ GATG primer 35 hLangerinBackbone GAGCTAGCAGtaTTAA forward 27 60C./3.5 plasmidRP172 TTAACCACCCTGGCTA primer min/20 GCGTTTAAACTTAAG hLangerinBackbone GTACCGGTTAGGATGC reverse 28 60C./3.5 plasmidRP172 ATGCCAATGGTGATGG primer min/20 TGATGATG hLangerinSNP GAGCTAGCAGtATTAA forward 34 Backbone TTAACCACCATGACTG primer TGGAGAAGGAG hLangerin-FLAG ACGTTTCTTTTCATTTG reverse 35 BackboneSNP TAAGCGACCCTATGTC primer CCATCAGAACCGGACT ACAAAGACGATGACG ACAAGTGAGCATGCAT CCTAACCGGTAC N288D CCAGGTGAGCCCAACg forward 36 ATGCTGGGAACAATG primer AACACTG N288D CATTGTTCCCAGCATc reverse 37 GTTGGGCTCACCTGGA primer ATCCAG K313I GTACCGGTTAGGATGC forward 38 ATGCTCACGGTTCTGA primer TGGGACATAGGGTCG CTTACAAATGAAAAGA AACGTTaTGTCACATG GGGCATCATTCCAG K313I GAGCTAGCAGtATTAA reverse 39 TTAACCACCATGACTG primer TGGAGAAGGAG DC-SIGNpcDNA3.1(+) CTGGCTAGCGTTTAAA forward 40 62C./30sec/ CTTAAGCATGAGTGAC primer 35 TCCAAGGAACCAAG DC-SIGNpcDNA3.1(+) CTAGACTCGAGCGGCC reverse 41 62C./30sec/ CTACGCAGGAGGGGG primer 35 DC-SIGNBackbone GCTTAAGTTTAAACGC forward 42 59C./2.5 plasmidpcDNA3.1(+) TAGCC primer min/20 DC-SIGNBackbone GGCCGCTCGAGTCTAG reverse 43 59C./2.5 plasmidpcDNA3.1(+) AG primer min/20 DC-SIGNpcDNA5 CTGGCTAGCGTTTAAA forward 44 59C./1min/ CTTAAGCATGAGTGAC primer 35 TCCAAGGAACCAAG DC-SIGNpcDNA5 GTGATGGTGATGATG reverse 45 59C./1min/ ACCTACGCAGGAGGG primer 35 GGGTT DC-SIGNBackbone GCTTAAGTTTAAACGC forward 46 62C./3.5 plasmidpcDNA5 TAGCC primer min/20 DC-SIGNBackbone GTCATCATCACCATCA reverse 47 62C./3.5 plasmidpcDNA5 CC primer min/20 DC-SIGNRP172 CTGGCTAGCGTTTAAA forward 48 60C./1min/ CTTAAG primer 35 DC-SIGNRP172 CAATGGTGATGGTGAT reverse 49 60C./1min/ GATG primer 35 DC-SIGNBackbone GAGCTAGCAGTATTAA forward 50 60C./3.5 plasmidRP172 TTAACCACCCTGGCTA primer min/20 GCGTTTAAACTTAAG DC-SIGNBackbone GTACCGGTTAGGATGC reverse 51 60C./3.5 plasmidRP172 ATGCCAATGGTGATGG primer min/20 TGATGATG mLangerinpcDNA3.1 CTGGCTAGCGTTTAAA forward 57 62C./30sec/ (+) CTTAAGCATGCCAGAG primer 35 GCAGAGATGAAG mLangerinpcDNA3.1 CTAGACTCGAGCGGCC reverse 58 62C./30sec/ (+) TCATTCAGTTGTTTGG primer 35 ACG mLangerinBackbone GCTTAAGTTTAAACGC forward 59 59C./2.5 plasmidpcDNA3.1(+) TAGCC primer min/20 mLangerinBackbone GGCCGCTCGAGTCTAG reverse 60 59C./2.5 plasmidpcDNA3.1(+) AG primer min/20 mLangerinpcDNA5 CTGGCTAGCGTTTAAA forward 61 59C./1min/ CTTAAGCATGCCAGAG primer 35 GCAGAGATGAAG mLangerinpcDNA5 GTGATGGTGATGATG reverse 62 59C./1min/ ACTCATTCAGTTGTTTG primer 35 GACG mLangerinBackbone GCTTAAGTTTAAACGC forward 63 62C./3.5 plasmidpcDNA5 TAGCC primer min/20 mLangerinBackbone GTCATCATCACCATCA reverse 64 62C./3.5 plasmidpcDNA5 CC primer min/20 mLangerinRP172 CTGGCTAGCGTTTAAA forward 65 60C./1min/ CTTAAG primer 35 mLangerinRP172 CAATGGTGATGGTGAT reverse 66 60C./1min/ GATG primer 35 mLangerinBackbone GAGCTAGCAGTATTAA forward 67 60C./3.5 plasmidRP172 TTAACCACCCTGGCTA primer min/20 GCGTTTAAACTTAAG mLangerinBackbone GTACCGGTTAGGATGC reverse 68 60C./3.5 plasmidRP172 ATGCCAATGGTGATGG primer min/20 TGATGATG mDectin-1pcDNA3.1 TAGCGTTTAAACTTAA forward 69 62C./30sec/ (+) GCATGAAATATCACTC primer 35 TCATATAGAGAATC mDectin-1pcDNA3.1 TAGACTCGAGCGGCCT reverse 70 62C./30sec/ (+) TACAGTTCCTTCTCACA primer 35 GATAC mDectin-1Backbone GCTTAAGTTTAAACGC forward 71 59C./2.5 plasmidpcDNA3.1(+) TAGCC primer min/20 mDectin-1Backbone GGCCGCTCGAGTCTAG reverse 72 59C./2.5 plasmidpcDNA3.1(+) AG primer min/20 mDectin-1pcDNA5 TAGCGTTTAAACTTAA forward 73 59C./1min/ GCATGAAATATCACTC primer 35 TCATATAGAGAATC mDectin-1pcDNA5 GTGATGGTGATGATG reverse 74 59C./1min/ ACTTACAGTTCCTTCTC primer 35 ACAGATAC mDectin-1Backbone GCTTAAGTTTAAACGC forward 75 62C./3.5 plasmidpcDNA5 TAGCC primer min/20 mDectin-1Backbone GTCATCATCACCATCA reverse 76 62C./3.5 plasmidpcDNA5 CC primer min/20 mDectin-1RP172 CTGGCTAGCGTTTAAA forward 77 60C./1min/ CTTAAG primer 35 mDectin-1RP172 CAATGGTGATGGTGAT reverse 78 60C./1min/ GATG primer 35 mDectin-1Backbone GAGCTAGCAGTATTAA forward 79 60C./3.5 plasmidRP172 TTAACCACCCTGGCTA primer min/20 GCGTTTAAACTTAAG mDectin-1Backbone GTACCGGTTAGGATGC reverse 80 60C./3.5 plasmidRP172 ATGCCAATGGTGATGG primer min/20 TGATGATG
[0429] Finally, PCR products were assembled by Gibson Assembly. Equal volumes (2-10 l) of DNA containing 0.02-0.5 pmols of DNA fragments with a 2-3 excess of insert and Gibson Assembly Master Mix were incubated at 50 C. for 20 min. The master mix contained T5 exonucleases, Phusion DNA polyermases and Taq DNA ligases to create single-stranded DNA overhangs, incorporate nucleotides into DNA gaps and to anneal complementary DNA fragments. After Gibson Assembly, 1 l DpnI (NEB) was added to digest the given cloning vector. The digested PCR reaction (1 l) was then transformed into 10 l 5-alpha competent E. colis (NEB) by heat shock transformation at 42 C. for 30 sec. After 2-3 min on ice, 200 l SOC medium (SOB medium containing 20 mM glucose, Carl Roth) were added to the reaction vials and incubated for 1 h at 37 C. E. coli cells were plated on LB agar plates (Luria/Miller, Carl Roth) containing 100 g/ml ampicillin (Panreac AppliChem) and incubated at 37 C. overnight. To isolate DNA, a MiniPrep kit was used following the manufacturer's instructions (GeneJET Plasmid Miniprep Kit, Thermo Fisher Scientific). The DNA concentration was measured with a nanodrop, and plasmid DNA was sequenced.
[0430] The Lentivirus used for transduction of the cell lines was produced in 293T cells using a lipopolyplex transfection (LT) reagent Mirus LT1 (Sopachem). Using this system the RP172 vector (BIC-PGK-Zeo-T2a-mAmetrine; EF1A) containing the Langerin sequence and a packaging mix containing all three necessary plasmids (pVSV-G, pMDL, and pRSV) were introduced into the 293T cells. After transfection with the LT system, 293T cells produced virus for 3-4 days which was harvested and frozen down at 80.sup.2C to kill remaining 293T cells. This supernatant was then used to transduce Langerin/RP172 into the different cell lines.
[0431] Lentivirus-containing supernatants were mixed with Raji cells and gently spun centrifuged in full media containing polybrene (Santa Cruz Biotechnology) at 33.sup.2C. The RP172 vector (BIC-PGK-Zeo-T2a-mAmetrine; EF1A) includes a Zeocin resistance cassette and a fluorescent GFP derived protein mAmetrine. Transduction of 50000 Raji cells was facilitated by spin infection at 1000*g for approximately 90 min at 33 C. After 2-3 days, the (partially) infected cells were exposed to Zeocin (Life technologies) pressure to select for RP172 containing cells. Transduced cells were selected with selection medium containing 300 g/ml Zeocin (life technologies) for two weeks. Presence of RP172 is assessed by mAmetrine expression measured by FACS (BD FACS canto II). The initial mAmetrine check (performed before selection) is crucial as the percentage of infected cells gauges the lentiviral titer. In all transductions, we aimed for an initial mAmetrine percentage of 5-10%.
[0432] Recombinantly expressed receptors were detected with CLR-specific antibodies. For antibody staining, 50000 cells were incubated with 25 l medium containing a 1:100 dilution of PE anti-mouse/human CD207 (4C7, Biolegend) to stain murine Langerin, PE anti-human CD209 (9E9A8, Biolegend) to stain DC-SIGN, PE anti-mouse Dectin-1 (bg1fpj, eBioscience) to stain mDectin-1 cells or PE anti-mouse/IgG2a (RMG2a-62, Biolegend) or PE anti-normal mouse/IgG1 (sc-2866, Santa CruzBiotechnology) for isotype staining. To stain cell surface expression of human Langerin expressing cells, 50000 cells were incubated with a 1:5 dilution of CD207-PE conjugated antibody (DCGM4, Beckman Coulter). After incubation at 4 C. for 30 min, cells were washed and PE staining was analyzed by flow cytometry with a 488 laser with a 574/26 filter (Attune Nxt, life technologies).
Example 2
CLR-Expressing Raji Cells
[0433] The human Raji cell line from hematopoietic origin was grown in RPMI base medium containing 10% FCS, 100 U/ml Penicillin-Streptomycin and GlutaMax. Cells were maintained between 0.5-3 Mio cells/ml by addition or replacement of the complete growth medium and grown, maintained, monitored and stored under the same conditions as mentioned for Hek293 (see above). The cDNA ORF clones of DC-SIGN and mouse Dectin-1 were also transferred from a pcDNA5/FRT/V5-His-TOPO TA vector (life technologies) into a RP172 vector (Koymans et al., 2016, Int. J. Mol. Sci., 17, 7, 1072) for stable expression in Raji cells by transduction. Cloning was done using Gibson Assembly, according to the manufacturer's instruction (see above). DNA concentration was measured with a nanodrop, and plasmid DNA was sequenced. Transduction of human Langerin, DC-SIGN and mouse Dectin-1 into Raji cell lines was conducted as described for Hek293 cells (see Example 1). Recombinantly expressed receptors were detected with CLR-specific antibodies and measured using flow cytometry (see Example 1 and
Example 3
Synthesis of the Targeting Ligand
[0434] ##STR00018##
[0435] Glucoseamine hydrochloride (46.4 mmol, 10 g) was dissolved in a aqueous NaOH solution (1M, 47 mL) at 0 C. p-anisaldehyde (47 mmol, 5.7 mL) was added dropwise over 5 min and the reaction was left to stir at 0 C. for 2 h during which the solution solidified. The crystalline slurry was suction-filtered, washed with H.sub.2O and small amounts of Et2O and dried under high vacuum at 45 C. to obtain 1 as a colourless solid in 97% yield (45.34 mmol, 13.48 g).
##STR00019##
[0436] 1 (40.3 mmol, 11.98 g) was dissolved in pyridine (71 mL) under Ar and cooled to 0 C. Acetic anhydrite (36 mL) was added under stirring, the cooling bath was removed and the mixture was allowed to warm to room temperature under stirring overnight. The mixture was poured into ice water (240 mL). The resulting precipitate was suction filtered, washed with water (350 mL) and dried in high vacuo to obtain 2 as colourless solid in 87% yield (35.15 mmol, 16.36 g).
##STR00020##
[0437] 2 (35.15 mmol, 16.36 g) was heavy stirring in boiling acetone in a beaker (boiling 70 mL). 7.03 mL (35 mmol) of aqueous HCl (5 M) were quickly added. The immediately solidifying mass was allowed to cool to room temperature, subsequently suction filtered, washed with cold Et2O and dried in vacuo. The resulting solid (35.15 mmol, 11.67 g) was suspended in 180 mL pyridine and cooled to 0 C. under heavy stirring. 2,2,2-Trichloroethyl chloroformate (76 mmol, 10.4 mL) was added the mixture at once and left stirring for 3 hours. 30 mL of methanol were added to quench excess of Troc-Cl and the mixture subsequently concentrated in vacuo. 250 mL of DCM were added, the resulting precipitate was filtered off and the filtrate concentrated in vacuo. The residue was redissolved in little DCM and purified using liquid chromatography to obtain 3 as a colourless solid in 87% yield (30.61 mmol, 16 g).
##STR00021##
[0438] 3 (13.32 mmol, 6.96 g) and ethanethiol (18.64 mmol, 1.38 mL) were dissolved in 35 mL anhydrous DCM under an Ar atmosphere and cooled to 0 C. BF3.Et20 (18.64 mmol, 2.36 mL) was added over 5 min and the reaction stirred for 40 min at 0 C., then at room temperature for 4 hours. The reaction was quenched by addition of 1.1 mL NEt3 and the mixture concentrated in vacuo. Purification using liquid chromatography obtained 4 as a white solid in 83% yield (11.05 mmol, 5.8 g).
##STR00022##
[0439] A suspension of 4 (2.48 mmol, 1.30 g) and benzyl-2-hydroxyethylcarbamate (3.96 mmol, 790 mg) in 60 mL anhydrous DCM was stirred for 45 min under an Ar atmosphere. Dimethyl(methylthio)sulfonium tetrafluoroborate (4.95 mmol, 1 g) was added and the reaction left stirring overnight at room temperature. The solvent was removed in vacuo and the residue purified by liquid chromatography to obtain 5 as a white solid in 68% yield (1.67 mmol, 1.1 g).
##STR00023##
[0440] A suspension of 5 (0.76 mmol, 500 mg) and freshly activated zinc (6.46 g, 99 mmol) in 27 mL acetic acid was stirred for 4 h. The reaction mixture was filtered over celite and dried in high vacuo overnight. The resulting solid was then dissolved in pyridine (12 mL) and p-toluenesulfonyl chloride (1.52 mmol, 290 mg; dissolved in 12 mL pyridine) were added dropwise. The reaction mixture was left to stir overnight. The solvent was then removed in vacuo and the residue purified by liquid chromatography to obtain 6 as a white powder in 43% yield (209 mg, 0.33 mmol).
##STR00024##
[0441] To a solution of 6 (0.30 mmol, 190 mg) in anhydrous methanol (8 mL) sodium methanolate solution (c=0.5 mM. 149 mmol 2.98 mL) was added under an Ar atmosphere and left to stir for 2 hours. The solvent was removed in vacuo. The resulting white powder was re-dissolved in anhydrous methanol (30 mL), 30 mg of palladium on charcoal (10%) were added and the reaction mixture was left to stir under an hydrogen atmosphere overnight. The catalyst was filtered off through Celite and washed with methanol. The solvents were removed and the residue purified by reverse phase high performance liquid chromatography to obtain 7 as a white solid in 71% yield (0.21 mmol, 80 mg).
Example 4
Lipid Conjugation
[0442] Ligands and dyes were coupled to PEG-DSPE by NHS conjugation. Alexa Fluor 647 NHS Ester (A647, life technologies) was conjugated to the primary amine of NH2-PEG-DSPE (PEG MW 2000, Sunbright) via amide coupling. The lipid (1.024 mg) dissolved in 500 l DMSO was stirred in a pear shaped flask, and 1 mg dye (1.5 equiv.) dissolved in 500 l DMSO was added dropwise to the lipid. The reaction was stirred overnight in the dark at room temperature. DMSO was freeze dried (Alpha 2-4 LDplus, CHRIST) and the reaction product was dissolved in 2-3 ml buffer containing 0.1 M sodium bicarbonate (Sigma-Aldrich) at pH8.4. Unconjugated dye was removed by dialysis with a Slide-A-Lyzer cassette (7MWCO, 0.5-3 ml, Thermo Fisher Scientific) first against 500 ml buffer for several hours with two times of buffer exchange as well as an overnight incubation and then three more times dialyzed against water with at least 1 h of dialysis under permanent stirring. Water was removed by freeze drying and the final product was dissolved in DMSO at a concentration of 8 mg/ml. The glycomimetic Langerin ligand, mannose as well as mannose polymers contained a terminal primary amine and were coupled to NHS-PEG-DSPE (PEG MW 2000, NOF Europe) via amide coupling equally as described for A647 conjugation except that 2 mg ligands were dissolved in 900 l buffer and 0.125 equivalent lipids were dissolved in 100 l DMF. Lipids were added dropwise in a pear shape flask and DMF was removed in vacuo (Heidolph). The final product was dissolved in DMSO-d6 (Euriso-Top) and the conjugation efficiency was determined by 1H-proton NMR spectroscopy with 265 scans (400 MHz, Variant).
Example 5
Formulation Liposomes
[0443] Targeted and naked PEGylated liposomes were prepared by hydration film extrusion method (Chen et al., 2010, Blood, 115, 23, 4778-4786). Unless stated otherwise, liposomes contained DSPE:cholesterol:ligand-PEG-DSPE/PEG-DSPE:dye-PEG-DSPE at a mole ratio of 57:38:4.75:0.25. If liposomes contained less than 4.75 mol % ligand-conjugated lipids then liposomes were filled up with PEG-DSPE to always obtain a total mole ratio of 5% PEGylated lipids. PEGylated lipids were dissolved in DMSO at a concentration of 8 mg/ml and stored at 20 C. for long term storage. DSPE (NOF Europe) and cholesterol (Sigma-Aldrich) were always freshly prepared and dissolved in chloroform at a concentration of 20 mg/ml and 10 mg/ml, respectively. PEGylated lipids were added to a glass tube and DMSO was freeze dried. Next, DSPE and cholesterol were added and Chloroform was removed in vaccuo overnight. The dry lipid film was hydrated with DPBS (w/o calcium and magnesium; life technologies) at a concentration of 1.6 mM if not stated otherwise. Lipid containing solution was first vortexed and then sonicated (Ultrabath 1510, Branson) for 3 sec with three repetitions and a short time lag in between. This step was repeated until a homogenous suspension was obtained. Large unilamellar liposomes were produced by pore extrusion (extruder, Avanti Polar Lipids) with 30 strokes first with a polycarbonate membrane of 200 nm and then of 100 nm (Avanti Polar Lipids). Liposome concentration refers to total lipid concentration.
Example 6
Characterization of Liposomes
[0444] To characterize liposomes prepared following the procedure described in Example 4 regarding particle size and stability, dynamic light scattering measurements (Malvern Instruments Zetasizer) were carried out on dilute liposome solutions (32 M in pure water). Liposomes exhibiting Zeta potentials between 35 mV and 15 mV as well as average particle sizes between 100 and 200 nm (% Intensity plot) and poly dispersity indices up to 0.3 were considered to be feasible for further usage.
Example 7
Liposomal Loading and Purification
[0445] Several proteins were devised as cargo for liposomal loading. In the following the recombinant expression of these proteins is presented and its loading into liposomes is described.
[0446] 2 mg Bovine Serum Albumin (BSA) (PAA) was dissolved in 1 ml HBSS buffer (life technologies) and transferred into a 5 ml pear shaped flask with septum and stir bar. Fluorescein isothiocyanate (Thermo Fisher Scientific) was dissolved in DMSO (1 mg/ml) and 200 l were added slowly in 5 l steps to BSA. The flask was covered in aluminum foil and stirred overnight at room temperatures. The reaction was quenched by adding a final concentration of 50 mM ethanolamine (Sigma-Aldrich) and stirred for 1 hour at room temperature. Unconjugated fluorescein was removed by dialysis with a Slide-A-Lyzer cassette (7MWCO, 0.5-3 ml, Thermo Fisher Scientific) against HBS buffer (25 mM HEPES, Carl Roth; 150 mM NaCl, Panreac AppliChem; pH 7.5). Buffer was twice exchanged after 1 h of stirring and after another overnight incubation. Protein concentration of FITC conjugated proteins were measured with absorbance at 280 nm and the conjugation efficiency was determined at 495 nm with a nanodrop (Implen Nanophotometer). Protein samples were stored at 4 C.
[0447] Liposomes were loaded with FITC-BSA by hydration of the thin film lipid with DPBS containing the FITC-BSA. FITC-BSA concentrations ranged from 1 mg/ml to 20 mg/ml. Followed by sonication and pore extrusion, liposomes were purified by ultracentrifugation or size exclusion. To remove free proteins by ultracentrifugation, liposomal suspension was transferred into ultracentrifugation tube (Thinwall, Ultra-Clear, 4 mL, Beckman coulter). The tube was filled up with DPBS to prevent implosion. Liposomes were ultracentrifuged at 55000 rpm for 1 h at 4 C. with a SW 60 Ti rotor (Beckman coulter) in an ultracentrifuge (Optima L-80 XP Ultracentrifuge, Beckman Coulter). The supernatant was removed and the pellet was resuspended in DPBS. Ultracentrifugation was repeated twice. Purification by size exclusion was performed with 20 ml sepharose CL gel filtration media (CL-4B, cross-linked, Sigma-Aldrich) that was packed into a chromatography column (Econo-column, 1.530 cm, BioRad). The column was equilibrated with DPBS before liposome solution was loaded to the column. Fractions of 1.5 ml were collected until liposomes and free FITC-BSA eluted (10-15 fractions). After fractionation, the column was regenerated with regeneration buffer containing 0.5 M NaCl in 0.1 M NaOH, equilibrated with DPBS until the pH was neutral and the next liposomal solution was separated by size exclusion. Encapsulation efficiencies were analyzed with a plate reader (SpectraMax M5, Molecular Devices) and calculated on the basis of standard curves. Liposome concentration was measured via Alexa 647 decorated liposomes (ex. 640, em. 670) and FITC-BSA concentration via (ex. 485, em. 525). Encapsulation efficiencies were calculated per 1 mM total lipid concentration.
Example 8
Liposome Characterization
[0448] Liposomal dispersity and stability were determined as described before (see Examples 4 to 6).
[0449] FITC-BSA was utilized to show encapsulation and purification methods for a protein. The total FITC-BSA protein concentration was measured after ultracentrifugation. Next, purified liposomes were then tested in a cell-based assay. FITC-BSA encapsulated liposomes were incubated with Langerin.sup.+ Raji cells for 2 h at 37 C. to induce internalization. A647 and FITC fluorescence of single cells was measured simultaneously by flow cytometry (see
[0450] To exclude that high centripetal forces during ultracentrifugation, liposomes released their cargo into the supernatant resulting in lower encapsulation efficiencies, liposomes purified by size exclusion and ultracentrifugation were compared in a cell-based assay (see
[0451] To analyse the impact of the initial concentration of FITC-BSA on the encapsulation efficiency the protein concentration was varied from 20 mg/ml to 1 mg/ml, and encapsulated liposomes were tested in a cell-based assay (see
[0452] Furthermore, the initial liposome concentration was varied. 10 mM were compared to 1 mM rehydrated liposomes in a cell-based assay (see
[0453] Next, encapsulated liposomes were dose-dependently incubated and a kinetic study was carried out to detect differences between the encapsulated FITC-BSA cargo and the A647 labeled delivery vehicle (see
[0454] These optimized encapsulation methods were then utilized to formulate liposomes containing immune-active EBNA1 protein. EBNA (Epstein-Barr nuclear antigen) was selected as a model peptide. It is a short immune-active peptide of the Epstein Barr virus (EBV) which has a prevalence of more than 90% in the adult population (see Cohen, 2000, N Engl J Med, 343, 7, 481-492). In addition, a housekeeping peptide PCNA (proliferating-cell-nuclear antigen) is associated with cancer progression and is thought to promote immune evasion (Rosental et al., 2011, J Immunol, 187, 11, 5693-5702). In addition, a housekeeping peptide PCNA (proliferating-cell-nuclear antigen) is associated with cancer progression and is thought to promote immune evasion. Hence, this peptide was used as a negative control.
Example 9
Bacterial Protein Expression and Purification of EBNA1 and PNCA
[0455] EBNA1 BL21 and PCNA BL21 E. coli cells were used LCs (see Barwell et al., 1995, J Biol Chem, 270, 35, 20556-20559). Proteins are fused to a His-tag and a thrombin recognition site. For protein expression, cells were cultured in 50 ml LB medium (Luria/Miller, Carl Roth) with 200 g/ml Ampicillin in a 250 ml Erlenmeyer flask overnight at 37 C. and 300 rpm (MaxQ 4000, Thermo Fisher Scientific). Next day, pre-culture was centrifuged at 3000 g for 12 min (Multifuge X3R Heraus, Thermo Scientific Fisher). The pellet was resuspended in fresh LB medium. For inoculation of 500 ml medium supplemented with 200 g/ml Ampicillin, 20 ml pre-culture was added to a 2000 ml Erlenmeyer flask and shacked at 300 rpm at 37 C. The culture was incubated until an optical density (OD at 600 nm) value of approximately 0.8 was reached to induce protein expression with 1 mM IPTG for overnight expression at 30 C. The next day, 500 ml bacterial cell suspensions were centrifuged at 4000 g for 15 min. Supernatant was discarded and the pellet was resuspended in PBS, transferred into a 50 ml tube, again centrifuged and the final E. coli pellet was either frozen at 80 C. or directly used for protein purification by affinity chromatography with a His-tag column (HisTrap HP, 11 ml; GE Healthcare).
[0456] To purify the recombinant expressed protein, E. coli cells were lysed with 5 ml lysis buffer (50 mM Na2PO4, Carl Roth; 300 mM NaCl, Panreac AppliChem; 10 mM imidazole, Carl Roth; pH 8) per 1 g E. coli pellet. 1 mg lysozyme (Fluka) was added per 1 ml lysate and cells were incubated at 4 C. for 30 min. Afterwards, cells were sonicated three times 20 sec at 30% amplitude and 10 sec off in between (Bransen, Digital Sonifier). The lysate was centrifuged at 10000 g for 15 min and the supernatant, containing the overexpressed protein, was filtered with a 0.45 m membrane filter (Corning) to remove cell debris.
[0457] Recombinantly expressed proteins were purified by his-tag affinity chromatography using a fast protein liquid chromatography (FPLC, MWD2.1L Azura, Knauer) FPLC was equilibrated with binding buffer (in line A: 50 mM Na2PO4, 300 mM NaCl, 10 mM imidazole, pH 8), washing buffer (in line B: 50 mM Na2PO4, 300 mM NaCl, 20 mM imidazole, pH 8), distilled water (in line C), and elution buffer (in line D: 50 mM Na2PO4, 300 mM NaCl, 250 mM imidazole, pH 8). Filtered supernatant containing the overexpressed protein was injected into the FPLC. Supernatant was loaded on his-trap column with binding buffer at a flow rate of 1 ml/min and a maximum pressure of 1 bar for 20 min. Protein concentration was measured at 280 nm with a UV detector. Loaded column was washed for 20 min with washing buffer before the protein was eluted by applying a gradient from washing buffer to elution buffer for 10 min. Fractions of 1 ml were collected in small reaction tubes. For additional 5 min, 100% elution buffer was applied to elute all his-trapped protein. Column was equilibrated with binding buffer before the next run was started. Fractions with his-tagged proteins were collected and combined to dialyze proteins (CelluTrans dialysis, Cral Roth) against HBS buffer (25 mM HEPES, 150 mM NaCl, pH 7.5) containing 2 mM CaCl2). Protein quality was checked by SDS-PAGE gel and protein concentration was measured by nanodrop (Implen Nanophotometer).
[0458] The peptides were overexpressed in E. coli and results are shown in
[0459] Proteins were loaded as described in section of Liposome loading and purification except that FITC conjugated EBNA proteins were digested with tenfold volume of trypsin, purified by size exclusion and concentrated with ultracentrifugation. All other steps were according to the protocol.
[0460] Liposomes were analyzed by DLS and the encapsulation efficiencies were detected by a fluorescence plate reader (see
[0461] Next, FITC-PCNA and FITC-EBNA antigens were delivered to LCs. Antigen encapsulated liposomes targeted to LCs stained 56.9% and 84.1% LCs with FITC-PCNA and FITC-EBNA, respectively, whereas naked liposomes showed no FITC fluorescence increase. This demonstrates specific delivery of antigens via encapsulated liposomes.
[0462] Taken together, proteins encapsulated in liposomes can specifically be delivery to Langerin-positive cells.
Example 10
Cellular Liposome-Binding and Internalization Assay
[0463] Liposome specificity was investigated by expressing several CLRs with overlapping binding patterns in model cell lines and analyzing liposome binding. 50000 Raji cells were plated in 100 l complete growth medium containing 16 M liposomes. To measure liposomal binding, the plate was incubated at 4 C., whereas receptor internalization was induced with incubation at 37 C. After incubation, cells were centrifuged at 500 g for 3 min and the supernatant was discarded. Cells were resuspended in 100 l ice cold culture medium and analyzed by detecting the co-formulated Alexa647 dye via flow cytometry with a 633 nm laser and a 570/20 nm filter (BD FACSCanto II, BD Biosciences) or a 654 nm laser with a 670/14 nm filter (Attune Nxt, life technologies).
[0464] As presented in
Example 11
Liposome Internalization of Heparin-Inspired Langerin Ligand Functionalized Liposomes
[0465] So far, specific binding of Langerin targeting liposomes was detected to Langerin expressing cells. However, for the delivery of immune-modulating agents, liposomes need to be internalized into cells; therefore, microscopy studies were performed with non-functionalized and functionalized liposomes. Laser scanning microscopy (LSM) in combination with fluorescence proteins or synthetic fluorophores enables the detection of co-localization of particles and cellular organelles. Cells were cultured on coverslips (Carl Roth) in 24 culture well plates (Corning). Before cell seeding, coverslips were coated with poly-L-Lysine (Sigma Aldrich) by overnight incubation. After washing the coverslips with DPBS, 200000 wt or Langerin.sup.+ Hek293 cells were seeded in 500 l culture medium. The 24 well plate was incubated overnight at 37 C. and 5% CO2. Next day, 16 M liposomes were added for 1 h at 37 C. unless stated otherwise. After liposome incubation, cells were fixed with 4% paraformaldehyde (Roti-Histofix, Carl Roth) for 10 min, and the cell membrane was stained with 10 M DiO (Thermo Fisher Scientific) for 15 min. To stain the nucleus, cells were first permeabilized with 0.1% saponin (Sigma Aldrich) for 10 min and subsequently stained with 1 g/ml DAPI (Sigma Aldrich) for 5 min. For long-term storage, coverslips were fixed on microscope slides (Carl Roth) using a mounting solution (Carl Roth). Slides were analyzed by microscopy (confocal light-sheet microscope DLS-DMi8, Leica). Internalization of Langerin targeted liposomes was detected by scanning different cell focus layers (see
[0466] Next, receptor-ligand interactions were studied in more detail with binding- and internalization-kinetics of Langerin functionalized liposomes. Binding kinetics revealed that liposomal adhesion to Langerin.sup.+ cells was saturated after 4 h (see
[0467] Concentrations applied in previous studies (16 M) are indicated with a black arrow in
[0468] To visualize and verify high liposomal uptake rates, microcopy studies were performed. Targeted liposomes were incubated with Langerin.sup.+ Hek293 cells for various time points up to 48 h (see
[0469] After 24 h, liposomes accumulated so strongly that the A647 signal was completely oversaturated. Therefore, PMT voltages were reduced visible in the right panel. Wt Hek293 cells showed even at high PMTs after 48 h no detectable fluorescence signal of A647 lipids.
[0470] Taken together, specific binding and uptake of targeted liposomes to Langerin expressing cell lines was shown to be dose- and time dependent.
Example 12
Targeted Delivery to Model Cell Lines: Mol % Ligand Density
[0471] A dependency of fluorescence signal to ligand mole ratio was detected demonstrating a relationship between the concentration of the targeting ligand and the binding efficiency to Langerin.sup.+ cells (see
[0472] Liposomal formulations with different mole ratios were also incubated dose- and time-dependently (see
Example 13
Liposomal Routing and Antigen Delivery Via Langerin Targeted Liposomes
[0473] The fate of antigen presentation on MHCI or MHCII is highly dependent on intracellular processing pathways. Therefore, liposomal routing was analyzed with endosomal markers. Liposome localization was studied by microscopy after 2 h of liposome incubation with immunostaining against Rab5, Rab7, Rab11, EEA1 and Lamp-1 (see
[0474] Less co-localization compared to Lamp-1 was detected for the early endosomal markers EEA1 and Rab5 as well as with the recycling marker Rab11. In conclusion, after 2 h of liposome incubation most of the Langerin targeting vehicles were located in late endosomes and lysosomes. However, liposomes were co-localized with early endosomal markers EEA1 and Rab5 at earlier time points of 2 min and 20 min (see
[0475] Taken together, these data demonstrate that targeted liposomes are taken up into Langerin positive cell lines and follow an intracellular routing in the endosomal compartment starting in the early endosome (2-20 min), then move into the late endosomal and lysosomal compartment (60-120 min).
Example 14
In Vitro Cytotoxicity of Heparin-Inspired Langerin Targeting Liposomes
[0476] Liposomes consist mainly of phospholipids and cholesterol. These naturally occurring and biocompatible compounds have revealed liposomes to be highly safe in clinical trials (Immordino et al., 2006, Int J Nanomedicine 1, 3, 297-315. Nevertheless, longer incubation periods and high concentrations of functionalized liposomes can lead to cytotoxic effects. To rule out toxicity induced by the fluorescence dye and the glycomimetic Langerin ligand toxicity assays were performed. To analyze cytotoxic effects induced by liposomes, cells were stained with Annexin-V and 7-AAD. To analyze early and late apoptosis, 10000 cells were incubated with various liposomal concentrations in 50 l for 24 h or 16 M liposomes were incubated for various time points at 37 C. and 5% CO2. As a positive control, cells were treated for 3 min with 50% DMSO. Untreated cells were applied as negative controls. Cells were washed and resuspended in 25 l buffer (10 mM HEPES, 140 mM NaCl and 2.5 mM CaCl2), pH7.4) containing 1:100 diluted Annexin-V-FITC (Adipogen). Cells were incubated for 10 min in the dark at room temperature. After washing, cells were resuspended in 100 l buffer containing 1 l 7-AAD solution (Biolegend) and incubated for 5-10 min in the dark at room temperature. Cells were directly measured without any further washing steps by flow cytometry. Annexin-V and 7-AAD were excited with the 488 laser, Alexa 647 with the 654 laser. Annexin-V was detected with a 530/30 filter, 7-AAD with a 695/40 filter and Alexa647 with a 670/14 filter (Attune Nxt, life technologies). Spectral overlaps were compensated. Langerin targeted liposomes were incubated with cells for extended time periods up to 72 h, and cell toxicity was subsequently analyzed (see
[0477] Early apoptotic effects were detected with Annexin-V staining that binds translocated phosphatidylserine, whereas late apoptotic cells were stained with 7-AAD a cell impermeable fluorescent intercalator that associates to DNA and undergoes a spectral shift. 7-AAD however is membrane permeable in dead cells. Cell debris was omitted when gating live and dead cells in the FSC-A/SSC-A plot. After doublet discrimination, single cells were analyzed for Annexin-V-FITC and 7-AAD staining in a bivariate histogram by dividing the plot in four quadrants. Untreated, DMSO treated and liposome treated cells were exemplarily presented in
[0478] Similar to the kinetic study, a dose-dependent toxicity study was performed (see
[0479] Taken together, targeted liposomes did not show any toxicity over an extended period of time as well as no induction of cell death when applied at very high concentrations for 24 h.
Example 15
Targeted Delivery to Model Cell Lines: SNPs
Mutagenesis
[0480] N288D and K313I mutations were introduced into the wild type (wt) DNA of human Langerin by in vitro site-directed mutagenesis. For site-directed mutagenesis, a commercially available mutagenesis kit (QuikChange II XL Site-Directed Mutagenesis Kit, Agilent) was used. All steps were followed according to the manufacturer. Briefly, primers for site-directed mutational PCR were designed with the online tool QuickChange Primer Design (Agilent). A master mix was prepared and 48 l were transferred to a PCR reaction tube for each mutational reaction. 1 l 10 M forward primer and 1 l 10 M reverse primer were added per mutational reaction (see also Example 1). The reaction mixture was transferred to a thermal cycler and a PCR program according to the manufacturer's guidelines was applied. After PCR reaction, 1 l Dpn I was added for 1 h at 37 C. to digest the parental methylated and hemi-methylated DNA strands. Digested PCR reactions were then transformed, cultured and harvested in 5-alpha competent E. coli cells (NEB). Cells were seated on L-Ampicillin containing Agar plates, and next day two to three bacterial colonies were picked per clone and cultured for plasmid isolation (GeneJET Plasmid Miniprep Kit, Thermo Fisher Scientific). The DNA concentration was measured with a nanodrop (Implen Nanophotometer) and plasmid DNA was sequenced. To introduce the second mutation, mutagenesis was repeated with a mutated plasmid.
Assessing Liposomal Binding to Relevant Nucleotide Polymorphisms of Human Langerin
[0481] The effect of polymorphic residues on the activity of liposomal binding and internalization into human Langerin expressing cells was determined. Relevant single nucleotide polymorphisms (SNPs) were introduced into wt cDNA of Langerin. Wt Langerin that is referred to in this text contains the V278A polymorphism and is present in the human population at 49.9% (rs741326, National Center for Biotechnology Information (NCBI) SNP database). As Langerin has several SNP variations, the focus was placed on the most important polymorphism for this study a double polymorphism N288D/K313I that showed enhanced binding affinities for glycans with terminal GlcNAc residues and reduced affinities for 6504-Gal glycans presented in previous studies (J Biol Chem, 288, 52, 36762-36771). The N288D/K313I mutant has a heterozygosity of 13.5% (rs13383830 and rs57302492, respectively, NCBI SNP database). The double polymorphism N288D and K313I occurs always together in the human population.
[0482] The single mutant N288D and the double mutant were fused to a flag tag at the N-terminal end of Langerin. First, liposomal binding of targeted and naked liposomes was tested to wt Langerin.sup.+ and compared to the Langerin mutants N288D, K313I and the double mutant N288D/K313I (see
Example 16
Targeted Delivery of Directly Modified Proteins to Model Cell Lines
[0483] Preparation of Reactive Ligand Liker Construct to React with Amino Groups of Proteins
##STR00025##
[0484] Compound 7 (0.87 mg, 2.3 mop was dissolved in 300 L DMSO and 43 L pyridine in presence of 17.4 uL trimethylamine under an inert atmosphere. 8.63 mg (22 mop bis(4-nitrophenyl) adipate (dissolved in 193 L DMSO) were added and the solution left to stir for 3 hours. The solvent was subsequently removed by freeze-drying. The residue was washed with toluene and the solvent removed in vacuo to obtain compound 8.
Preparation of Ligand Modified Green Fluorescent Protein (GFP)
[0485] Green Fluorescence Protein (GFP) was used as a model for direct ligand modification of proteins. The amino acid sequence of GFP was:
TABLE-US-00002 (SEQIDNO:82) MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICT TGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHN VYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH YLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKA
[0486] A solution of 1 mg GFP in 175 L PBS (pH 8) was added to 1.45 mg (2.31 mop reactive compound 8 (see above, Example 16) and left to stir for 23 hours at room temperature. The mixture was diluted with PBS (pH 7.4) to 2.5 mL and centrifuged. The supernatant dialyzed twice for 12 hours against PBS (pH 7.4) at 4 C. and the solution subsequently concentrated to 1.06 mg/mL modified protein.
Characterization of Ligand Modified Green Fluorescent Protein (GFP)
[0487] To estimate the total number of ligands on the modified GFP, obtained following the procedure as described in Example 17, Matrix Assisted Laser Desorption/Ionization (Bruker MALDI-TOF Autoflex speed) measurements were carried out using a 2,5-dihydroxyacetophenone matrix. Comparing the average molecular weight of pristine GFP and ligand modified GFP gave an average of around 7 ligand moieties per protein molecule.
Targeted delivery to model cell lines: Protein cargo uptake
[0488] Functionalized GFP was then tested in a cell-based binding and internalization assay. Both GlcNTosyl functionalized GFP and unconjugated GFP were incubated with WT or hLangerin.sup.+ Raji cells at 4 C. and at 37 C. for 1 h or 2 h, respectively (see
[0489] However, as opposed to liposomal internalization, the uptake of GFP was hardly visible, indicting an impaired internalization rate or fast degradation (see
[0490] Employing fluorescence microscopy, functionalized GFP and unconjugated GFP were investigated after incubation with Langerin.sup.+ COS-7 cells (see FIG. 16Fehler! Verweisquelle konnte nicht gefunden werden). Cells incubated with functionalized GFP showed increased fluorescence signals, whereas unconjugated GFP did not bind to Langerin.sup.+ cells. After a mere 5 min of incubation at 37 C., functionalized GFP was redistributed and after 60 min, appeared to be located in endosomal compartments. The distinct cell membrane staining at time point 0 min was completely abolished at time point 60 min suggesting GFP internalization. Moreover, binding and competition studies with mannan demonstrated that functionalized GFP displayed increased binding affinities (see
[0491] In summary, functionalized GFP conjugated with approximately seven ligands displayed increased binding affinities in comparison to ligand conjugated liposomes. However, GFP internalization was drastically impaired compared to GlcNTosyl decorated liposomes.
Example 17
Targeted Delivery of Alternative Nanoparticles
Preparation of Ligand Modified PMMA Beads
[0492] 0.01 mL of carboxylated poly(methyl methacrylate) beads (0.5% stock solution, diameter 130 nm, PolyAn) were dissolved in 200 L activation buffer (MES 50 mM pH=5+0.001% tween). 12 L of a 1.5 M aqueous 1-ethyl-3-(3-dimethylaminopropyl) carbodiimide solution and 12 L of a 0.3 M N-hydroxysuccinimide solution were added and vigorously stirred for 1 hour. Subsequently the beads were washed three times with coupling buffer (HBS, pH=7, 5 mM Ca.sup.+). 2 L of a 10 mM aqueous targeting ligand solution were added and left to stir over night at room temperature. The modified beads were washed twice with ethanolamine (1 M in coupling buffer, pH=8+0.02% tween) followed by washing and storing in with HBS buffer (pH=7, 5 mM Ca.sup.+, 0.02% Tween) at 4 C.
Interaction of Ligand Modified PMMA Beads with THP-1 Cells
[0493] Different dosages (5, 10, 20 L) of a ligand modified PMMA beads solution (c=2.510 beads/mL (preparation as described in Example 18) were added to THP-1 cell suspensions of 50 L (cell count was 210.sup.6 cells/ml). After 45 min incubation on ice and exclusion of light, the mixtures were spun down, fixated with 120 L of an aqueous paraformaldehyde solution (4%) and finally re-suspended in 150 L medium. Beads-cell-interaction was analyzed using fluorescence-activated cell sorting (FACS) flow cytometry gating for THP1 cells detecting the beads' red fluorescence.
Example 18
Targeted Delivery to Primary Langerhans Cells
Liposomal Delivery in Epidermal Cell Suspensions
[0494] Primary cells are an excellent model prior translating the studies in vivo. From skin samples from healthy donors were removed from subcutaneous fat with a scalpel. Epidermal cell suspensions were incubated in RPMI1640 medium (Lonza) supplemented with 1.5 U/ml dispasell (Roche) and 0.1% trypsin (Sigma-Aldrich) overnight at 4 C. On the other hand, whole skin cell suspensions were obtained by incubation in RPMI1640 medium supplemented with 10% FCS (Pan-Biotech) and 1 mg/ml collagenaseIV (Worthington Biochemical Corporation) overnight at 37 C. Peeled off epidermis or whole skin was filtered through a 100 m cell strainer (Thermo Fisher Scientific) to obtain single cell suspensions. Cell suspensions were incubated with 16 M liposomes in HBSS buffer (Mg and Ca.sup.+; Biochrom GmbH) containing 1% BSA (Serva Electrophoresis GmbH) for 1 h at 37 C. For the kinetic study liposomes were incubated for various time periods at 37 C. or 4 C. As a control, 10 mM EDTA (Lonza) was added. Before analyzing cells by flow cytometry (FACS Canto II, BD Biosciences), cells were stained with an eFluor 780 viability dye (eBioscience) and fluorochrome-conjugated antibodies (CD1a, clone: H1149; CD14, clone: HCD14; HLA-DR, clone: L243; CD45, clone: H130Biolegend; Langerin, clone: MB22-9F5Miltenyi Biotec; isotype-matched control antibodies) for 15 min at 4 C. For confocal microscopy, epidermal cell suspensions were stained with FITC-conjugated CD1a antibody (clone: H1149; Biolegend) for 15 min at 4 C. After 1 h liposomal incubation at 37 C., cells were analyzed by microscopy (Zeiss AxioObserver Z1).
[0495] For the utilization of primary cells, epidermal cell suspensions were prepared from human skin samples and liposomal binding to Langerhans cells was analyzed by flow cytometry (see
[0496] More than 97% epidermal Langerhans cells were Langerin positive and stained with the A647 co-formulated dye present on liposomes. Liposomal binding to Langerhans cells was specific for liposomes that were decorated with the targeting ligand and Ca.sup.2+-dependent liposomal binding was competed with 10 mM EDTA. These results confirm a specific ligand-receptor interaction at the primary binding site of the CRD of Langerin. In addition, liposomal staining was specific for LCs since CD45 and CD45, HLR-DR cells were not able to bind Langerin targeted liposomes (see
Liposomal Delivery in in Whole Skin Cell Suspensions
[0497] LCs are known to be the only professional antigen presenting cells in the epidermis. To show liposomal specificity towards LCs over other dendritic cell lines, whole skin cell suspensions were prepared from human skin samples and analyzed by flow cytometry to detect liposome staining (see
[0498] To sum up, targeted liposomes are delivered specifically to Langerin-positive cells in epidermal as well as whole skin cell suspensions.
Example 19
Biophysical Characterization of Human Langerin Ligands
Receptor Expression and Purification
[0499] General remarks. Codon-optimized genes for the expression of Langerin and DC-SIGN in E. coli were purchased from GenScript and Life Technologies, respectively. All growth media or chemicals used for receptor expression and purification were purchased from Carl Roth if not stated otherwise.
[0500] The codon-optimized gene sequence for Langerin containing a StreptagII and TEV site at the C-terminus for expression in E. coli is presented by SEQ ID NO: 29. For the E. coli expression of said sequence the following primer sequences were used:
TABLE-US-00003 SEQ Sequence ID Name (5to3) Direction NO: truncatedLangerin GGTGGTCATATGGCC forward 30 extracellular TCGACGCTGAATGCC primer domain(ECD)- CAGATTCCGG residues148to328 truncatedLangerin ACCACCAAGCTTTTA reverse 31 extracellular TTTTTCAAAC primer domain(ECD)- TGCGGATG residues148to328 Langerin GGTGGTCATATGGCC forward 32 carbohydrate CAGGTGGTTAGCCAA primer recognition GGCTGGAAATAC domain(CRD)- residues193to328 Langerin ACCACCAAGCTTTTA reverse 33 carbohydrate TTTTTCAAACTGCGG primer recognition ATG domain(CRD)- residues193to328
[0501] The codon-optimized gene sequence for DC-SIGN containing a StreptagII and TEV site at the C-terminus for expression in E. coli is presented by SEQ ID NO: 52. For the E. coli expression of said sequence the following primer sequences were used:
TABLE-US-00004 SEQ Sequence ID Name (5to3) Direction NO: DC-SIGN GCCGCCTCTAGAGAG forward 53 extracellular TAATACGACTCACTA primer domain(ECD)- TAGGGACTAGAGAA residues60to404 AGAGGAGAAAACTA GATGGCCAAAGTTCC GAGCAGCATT DC-SIGN GGCGGCCTGCAGGT reverse 54 extracellular ACAAAAAAGCAGGC primer domain(ECD) TACTAGT DC-SIGN CCGCCTCTAGAGGAG forward 55 carbohydrate TAATACGACTCACTA primer recognition TAGGGACTAGAGAA domain(CRD)- AGAGGAGAAAACTA residues205to404 GATGGCTGAACGTCT GTGTCATCCGTG DC-SIGN GGCGGCCTGCAGGT reverse 56 carbohydrate ACAAAAAAGCAGGC primer recognition TACTAGT domain(CRD)
[0502] Langerin extracellular domain. Expression and purification were conducted as previously published (Wamhoff, E. C. et al. (19)F Nmr-Guided Design of Glycomimetic Langerin Ligands. ACS Chem Biol, 11, 2407-13 (2016)). Briefly, the trimeric Langerin extracellular domain (ECD) was expressed insolubly in E. coli BL21* (DE3) (Invitrogen). Following enzymatic cell lysis, inclusion bodies were harvested and subsequently solubilized. The sample was centrifuged and the Langerin ECD was refolded overnight via rapid dilution. Next, the sample was dialyzed overnight, centrifuged and purified via mannan-agarose affinity chromatography (Sigma Aldrich). For .sup.19F R.sub.2-filtered NMR and lipid-enzyme-linked lectin assay (Lipid-ELLA) experiments, the buffer was exchanged to 25 mM Tris with 150 mM NaCl and 5 mM CaCl.sub.2 at pH 7.8 using 7 kDa size-exclusion desalting columns (Thermo Scientific). For STD NMR experiments, Langerin ECD samples were dialyzed five times for at least 8 h against H.sub.2O. Subsequently, the H.sub.2O was removed via lyophilization and the residue was stored at 80 C. Prior to STD NMR experiments, the Langerin ECD was dissolved in in 25 mM Tris-d.sub.11 (Eurisotope) with 100% D.sub.2O, 150 mM NaCl and 5 mM CaCl.sub.2 at pH 7. The concentration of Langerin ECD was determined via UV spectroscopy (A.sub.280, 0.1%=2.45). Purity and monodispersity of Langerin ECD samples were analyzed via SDS PAGE and DLS.
[0503] Langerin and DC-SIGN carbohydrate recognition domain. Expression and purification were conducted as previously published. Briefly, the monomeric .sup.15N-labeled Langerin and DC-SIGN carbohydrate recognition domains (CRDs) were expressed insolubly in E. coli BL21* (DE3) (Invitrogen). Following enzymatic cell lysis, inclusion bodies were harvested and subsequently solubilized. The sample was centrifuged and the Langerin and DC-SIGN CRDs were refolded overnight via rapid dilution. Next, the sample was dialyzed overnight, centrifuged and purified via StrepTactin affinity chromatography (Iba). After an additional dialysis step overnight, the sample was centrifuged and the buffer was exchanged to 25 mM HEPES with 150 mM NaCl at pH 7.0 using 7 kDa size-exclusion desalting columns (Thermo Scientific) for .sup.19F R.sub.2-filtered and .sup.15N HSQC NMR experiments. The concentration of Langerin and DC-SIGN CRDs was determined via UV spectroscopy (A.sub.280, 0.1%=3.19 and A.sub.280, 0.1%=2.98). Purity and monodispersity of Langerin and DC-SIGN CRD samples were analyzed via SDS PAGE and DLS.
.sup.19F R.sub.2-Filtered NMR
[0504] General remarks. .sup.19F R.sub.2-filtered NMR experiments were conducted on a PremiumCompact 600 MHz spectrometer (Agilent). Spectra were processed in MestReNova and data analysis was performed with OriginPro (Mestrelab Research. Mestrenova. 11.0.2. (2016); OriginLab. Originpro. 9.1. (2015)). Experiments with the Langerin ECD were performed at a receptor concentration of 50 M in 25 mM Tris with 10% D.sub.2O, 150 mM NaCl and 5 mM CaCl.sub.2 at pH 7.8 and 25 C. Experiments with the DC-SIGN CRD were performed at a receptor concentration of 50 M in 25 mM HEPES with 10% D.sub.2O, 150 mM NaCl and 5 mM CaCl.sub.2 at pH 7.0 and 25 C. TFA served as an internal reference at a concentration of 50 M. Apparent relaxation rates R.sub.2,obs for the reporter ligand were determined using the CPMG pulse sequence as previously published (Wamhoff, E. C. et al. (19)F Nmr-Guided Design of Glycomimetic Langerin Ligands. ACS Chem Biol, 11, 2407-13 (2016): Carr, H. Y. & Purcell, E. M. Effects of Diffusion on Free Precession in Nuclear Magnetic Resonance Experiments. Phys Rev, 94, 630-638 (1954); Meiboom, S. & Gill, D. Modified Spin-Echo Method for Measuring Nuclear Relaxation Times. Rev Sci Instrum 29, 688-691 (1958)).
[0505] Assay development for DC-SIGN. The .sup.19F R.sub.2-filtered NMR reporter displacement assay for DC-SIGN was developed following the procedure previously published for Langerin (Wamhoff, E. C. et al. (19)F Nmr-Guided Design of Glycomimetic Langerin Ligands. ACS Chem Biol 11, 2407-13 (2016)). Briefly, the K.sub.D value and the relaxation rate in bound state R.sub.2,b were determined at five concentrations [L].sub.T of reporter ligand 24 in three independent titration experiments. Samples were prepared via serial dilution. The addition of 10 mM EDTA served to validate the Ca.sup.2+-dependency of the interaction between DC-SIGN and the reporter ligand. To ensure the validity of the equations for K.sub.D and K.sub.I determination, the chemical exchange contribution R.sub.2,ex was estimated by .sup.19F NMR relaxation dispersion experiments at a reporter ligand concentration of 0.1 mM in presence of receptor.
[0506] K.sub.i determination. K.sub.i values were determined as previously published for Langerin (Wamhoff, E. C. et al. (19)F NMR-Guided Design of Glycomimetic Langerin Ligands. ACS Chem Biol 11, 2407-13 (2016)). Briefly, titration experiments were conducted at a concentration of 0.1 mM of reporter ligand 24 at five competitor concentrations [I].sub.T. Samples were prepared via serial dilution. For the acids GlcNS, GlcNAc-6-OS and GlcNS-6-OS the pH values were monitored and adjusted to 7.8 if necessary.
.SUP.15.N HSQC NMR
[0507] General remarks. .sup.15N HSQC NMR experiments were conducted on an Ascend 700 MHz spectrometer (Bruker) (Bodenhausen, G. & Ruben, D. J. Natural Abundance Nitrogen-15 NMR by Enhanced Heteronuclear Spectroscopy. Chem Phys Lett 69, 185-189 (1980)). Spectra were processed in NMRPipe (Delaglio, F. et al. Nmrpipe: A Multidimensional Spectral Processing System Based on Unix Pipes. J Biomol NMR 6, 277-93 (1995)). Data analysis was performed using CCPN Analysis, MatLab and OriginPro (OriginLab. Originpro. 9.1. (2015); Vranken, W. F. et al. The Ccpn Data Model for NMR Spectroscopy: Development of a Software Pipeline. Proteins, 59, 687-96 (2005); MathWorks. Matlab. 9.0. Natick, U.S.A. (2016)). Experiments with the Langerin CRD were performed at a receptor concentration of 100 M in 25 mM HEPES with 10% D.sub.2O, 150 mM NaCl and 5 mM CaCl.sub.2 at pH 7.8 and 25 C. DSS-d6 served as an internal reference at a concentration of 100 M. Spectra were referenced via the internal spectrometer reference. Spectra were acquired with 128 increments and 32 scans per increments for 150 L samples in 3 mm sample tubes. The relaxation delay d.sub.1 was set to 1.4 s and the acquisition time t.sub.acq was set to 100 ms. The W5 Watergate pulse sequence was used for solvent suppression (Liu, M. et al. Improved Watergate Pulse Sequences for Solvent Suppression in NMR Spectroscopy. J Magn Reson 132, 125-129 (1998)). The used resonance assignment for the Langerin CRD has been published previously (Hanske, J. et al. Intradomain Allosteric Network Modulates Calcium Affinity of the C-Type Lectin Receptor Langerin. J Am Chem Soc, 138, 12176-86 (2016)).
[0508] K.sub.D determination. K.sub.D values were determined in titration experiments at six ligand concentrations [L].sub.T. Samples were prepared via serial dilution. Chemical shift perturbations CSPs for Langerin CRD resonances in the fast or fast-to-intermediate exchange regime observed upon titration with ligand were calculated via Equation 1 (Williamson, M. P. Using Chemical Shift Perturbation to Characterise Ligand Binding. Prog Nucl Magn Reson Spectrosc 73, 1-16 (2013)).
[0509] A standard deviation of 0.02 ppm was previously determined for the measurement of chemical shifts in .sup.15N HSQC NMR experiments with the Langerin CRD (Hanske, J. et al. Intradomain Allosteric Network Modulates Calcium Affinity of the C-Type Lectin Receptor Langerin. J Am Chem Soc, 138, 12176-86 (2016)). Accordingly, only assigned resonances that displayed CSP values higher than a threshold of 2 at the highest ligand concentration were selected for the determination of K.sub.D values via Equation 2 in a global two parameter fit (Williamson, M. P. Using Chemical Shift Perturbation to Characterise Ligand Binding. Prog Nucl Magn Reson Spectrosc, 73, 1-16 (2013)). Standard errors were derived directly from the fitting procedures. Additionally, resonances that displayed line broadening v.sub.0.5 larger than 10 Hz upon titration in either the .sup.1H or the .sup.15N dimension were not considered for the determination of K.sub.D values. CSP.sub.max represents the CSP value observed upon saturation of the binding site.
[0510] For resonances assumed to be in the slow exchange regime upon titration, K.sub.D values were derived from integrals V.sub.b and V.sub.f corresponding to the bound and free state of the Langerin CRD, respectively. V values served to calculate the bound fraction of the receptor p.sub.b via Equation 3. Integrals V were normalized via integral V of the N-terminal K347 and served to calculate the bound fraction of the receptor p.sub.b via Equation 3. For these calculations, only resonances for which the bound state could be assigned were considered. Selected data points displaying a low SNR or issues with the baseline correction were treated as outliers and not considered for the determination of pb values. Next, a one parameter fit of Equation 3 to mean p.sub.b values served to determine K.sub.D values.
[0511] Binding mode analysis. Based on the resonance assignment, CSP values observed at maximal ligand concentrations [L].sub.T were mapped on the X-ray structure of the Langerin CRD (PDB code: 4N32) using Matlab's Bioinformatics Toolbox via substitution of the B-factor values (Feinberg, H. et al. Common Polymorphisms in Human Langerin Change Specificity for Glycan Ligands. J Biol Chem, 288, 36762-71 (2013); MathWorks. Bioinformatics Toolbox. 4.7. Natick, U.S.A. (2016)). The CSP patterns obtained were visualized in MOE using Chain B of the Langerin CRD in complex with GlcNAc (ChemicalComputingGroup. Molecular Operating Enviroment. 2016.08. Montreal, Canada (2016)). Model quality was maintained using MOE's Structure Preparation followed by the simulation of protonation states and the hydrogen bond network of the complex with MOE's Protonate 3D. Receptor surfaces were visualized in Connolly representation (Connolly, M. L. The Molecular Surface Package. J Mol Graph, 11, 139-41 (1993)).
STD NMR
[0512] General remarks. STD NMR experiments were conducted on a PremiumCompact 600 MHz spectrometer (Agilent) (Mayer, M. & Meyer, B. Characterization of Ligand Binding by Saturation Transfer Difference NMR Spectroscopy. Angew Chem Int Ed, 38, 1784-1788 (1999)). Spectra were processed in MestReNova and data analysis was performed with OriginPro (Mestrelab Research. Mestrenova. 11.0.2. (2016): OriginLab. Originpro. 9.1. (2015)). Experiments with the Langerin ECD were conducted at a receptor concentration of 50 M in 25 mM Tris-d.sub.11 (Eurisotope) with 100% D20, 150 mM NaCl and 5 mM CaCl2) at pH 7.8 and 25 C. Experiments were repeated in absence of receptor to exclude STD effects due to direct saturation of ligands. Residual H.sub.2O or TSP-d6 at 0.1 mM served as an internal reference. Spectra were recorded in 5 mm sample tubes at sample volumes of 500 L. Saturation was implemented via a train of 50 ms Gauss pulses at varying saturation times t.sub.sat. The on-resonance irradiation frequency v.sub.sat was set to 0.0 ppm and the off-resonance irradiation frequency v.sub.ref was set to 80.0 ppm. The acquisition time t.sub.acq was set to 2.0 s and the DPFGSE pulse sequence was utilized for solvent suppression (Hwang, T. L. & Shaka, A. J. Water Suppression That Works-Excitation Sculpting Using Arbitrary Wave-Forms and Pulsed-Field Gradients. J Magn Reson, 112, 275-279 (1995)). Receptor resonances were suppressed using a T1,rho filter at a relaxation time of 35 ms.
[0513] Epitope mapping. The binding epitope for 16 was determined at a concentration of 500 M. For each spectrum 512 scans were recorded. The relaxation delay d.sub.1 was set to 6 s and spectra were recorded at 5 different saturation time t.sub.sat varying from 0.25 to 6.00 s. Equation 4 served to derive the STD effect STD for each analyzed resonance from the corresponding on- and off-resonance spectra (Mayer, M. & Meyer, B. Group Epitope Mapping by Saturation Transfer Difference NMR to Identify Segments of a Ligand in Direct Contact with a Protein Receptor. J Am Chem Soc, 123, 6108-17 (2001)). I.sub.0 represents the integral of a resonance in the off-resonance spectrum and I.sub.sat represents the integral of a resonance in the on-resonance spectrum.
[0514] The apparent saturation rate ksat and the maximal STD effect STD.sub.max were derived from Equation 5 in a two parameter fit (Angulo, J. & Nieto, P. M. Std-Nmr: Application to Transient Interactions between Biomolecules-a Quantitative Approach. Eur Biophys J, 40, 1357-69 (2011)). Standard errors were derived directly from the fitting procedures. These parameters were used to calculate the initial slope of the STD build-up curves STD.sub.0 via Equation 6. STD.sub.0 values were normalized and mapped on the corresponding ligand structure. Only resonances for which at least part of a multiplet was isolated were considered for the epitope mapping.
STD=STD.sub.max(1e.sup.k.sup.
STD.sub.0=STD.sub.maxk.sub.sat Equation 6
Molecular Modelling
[0515] General remarks. Molecular modelling procedures were performed in MOE (ChemicalComputingGroup. Molecular Operating Environment. 2016.08. Montreal, Canada (2016)). Deviations from default options and parameters are noted. The AMBER10:EHT force field was selected for the refinement of docking poses and the hydrogen bond network while the MMFF94x force field was utilized for the generation conformers (Case, D. A., Darden, T. A., Cheatham, T. E., Simmerling, C. L., Wang, J., Duke, R. E., Luo, R., Crowley, M., R. C. Walker, Zhang, W., Merz, K. M., B. Wang, Hayik, S., Roitberg, A., Seabra, G., Kolossvry, I., K. F. Wong, Paesani, F., Vanicek, J., X. Wu, Brozell, S. R., Steinbrecher, T., Gohlke, H., Yang, L., Tan, C., Mongan, J., Hornak, V., Cui, G., Mathews, D. H., Seetin, M. G., Sagui, C., Babin, V. and P. A. Kollman. Amber. 10. San Francisco, U.S.A. (2008); Gerber, P. R. & Muller, K. Mab, a Generally Applicable Molecular Force Field for Structure Modelling in Medicinal Chemistry. J Comput Aided Mol Des, 9, 251-68 (1995); Halgren, T. A. Merck Molecular Force Field. I. Basis, Form, Scope, Parameterization, and Performance of Mmff94. J Comput Chem, 17, 490-519 (1996)). Receptor surfaces were visualized in Connolly representation (Connolly, M. L. The Molecular Surface Package. J Mol Graph, 11, 139-41 (1993)).
[0516] Development of the pharmacophore model and preparation of the Langerin complex. A structural alignment of Langerin carbohydrate binding sites in complex with GlcNAc was performed (PDB codes: 4N32) (Feinberg, H. et al. Common Polymorphisms in Human Langerin Change Specificity for Glycan Ligands. J Biol Chem, 288, 36762-71 (2013)). Based on this visualization, a pharmacophore model was defined with features for O3, O4 and O5 of the Glc scaffold. The spatial constraint on the O3 and O4 was defined by a sphere with a radius r of 0.5 while the position of O5 was constrained by a sphere with a radius r of 1.0 . Chain B of the Langerin CRD in complex with GlcNAc served as the structural basis for the conducted molecular docking study. Additionally, an alternative conformation for K313 observed for the Langerin complex with Gal-6-OS was modeled and included in the study (Feinberg, H. et al. Structural Basis for Langerin Recognition of Diverse Pathogen and Mammalian Glycans through a Single Binding Site. J Mol Biol, 405, 1027-39 (2011)). Overall model quality and protein geometry were evaluated and maintained using MOE's Structure Preparation. Next, protonation states and the hydrogen bond network of the complex were simulated with MOE's Protonate 3D followed by the removal of all solvent molecules.
[0517] Molecular docking. Conformations for 16 were generated utilizing MOE's Conformation Import. A pharmacophore-based placement method was utilized to generate docking poses that we scored using the London AG function. Highly scored poses were refined utilizing molecular mechanics simulations, rescored via the GBIV/WSA G function, filtered using the pharmacophore model and written into the output database (Corbeil, C. R., Williams, C. I. & Labute, P. Variability in Docking Success Rates Due to Dataset Preparation. J Comput Aided Mol Des, 26, 775-86 (2012)). Conformational flexibility of the carbohydrate binding site was accounted for by introducing B-factor-derived tethers to side chain atoms. Refined docking poses were ranked according to their the GBIV/WSA G score and evaluated visually in the context of the conducted .sup.15N HSQC and STD NMR experiments.
Example 20
Heparin-Derived Monosaccharides Represent Favorable Scaffolds for Glycomimetic Ligand Design
[0518] Aside from its function as a pathogen recognition receptor, Langerin interacts with self-antigens such as glycosaminoglycans including heparin (Munoz-Garcia, J. C. et al. Langerin-Heparin Interaction: Two Binding Sites for Small and Large Ligands as Revealed by a Combination of NMR Spectroscopy and Cross-Linking Mapping Experiments. J Am Chem Soc, 137, 4100-10 (2015); Hanske, J. et al. Calcium-Independent Activation of an Allosteric Network in Langerin by Heparin Oligosaccharides. ChemBioChem, accepted (2017); Zhao, J. et al. Kinetic and Structural Studies of Interactions between Glycosaminoglycans and Langerin. Biochemistry (2016)). These linear polysaccharides are composed of disaccharide repeating units consisting of galactose or uronic acids and differentially sulfated N-acetyl glucosamine (GlcNAc). Prompted by the 10-fold affinity increase (K.sub.D=0.490.05 mM) over mannose (Man) disaccharides (K.sub.D=ca. 4 mM) recently reported for a heparin-derived trisaccharide, ligand-observed .sup.19F R.sub.2-filtered NMR experiments were employed to determine K.sub.i values for a set of differentially sulfated GlcNAc derivatives (see
[0519] GlcNS-6-OS, representing the most potent monosaccharide identified, displayed an additive structure-activity relationship (SAR) for the sulfation in C2 and C6. This affinity increase is based on the formation of salt bridges with K299 and K313 as previously shown by X-ray crystallography (Porkolab, V. et al. Rational-Differential Design of Highly Specific Glycomimetic Ligands: Targeting Dc-Sign and Excluding Langerin Recognition. ACS Chem Biol (2018)). GlcNS-6-OS displayed an altered orientation of the Glc scaffold compared to the Langerin-GlcNAc complex (
Example 21
Small Aromatic Sulfonamide Substituents Render Glycomimetics Potent Targeting Ligands for Langerin and Provide Specificity Against DC-SIGN
[0520] Assuming the conservation of the Glc scaffold orientation observed for GlcNAc, small aromatic substituents in C2 were hypothesized to increase the affinity by the formation of cation- interactions with K299 and K313 or - and H- interactions with F315 and P310, respectively (see
[0521] Despite its low complexity, 2 displays an affinity superior to that of glycans previously applied as targeting ligands for DC subsets distinct from LCs (Fehres, C. M. et al. Cross-Presentation through Langerin and Dc-Sign Targeting Requires Different Formulations of Glycan-Modified Antigens. J Control Release, 203, 67-76 (2015)). Here, the blood group antigen Le.sup.X (K.sub.D,DC-SIGN=ca. 1 mM) was demonstrated to promote the DC-SIGN-dependent internalization of liposomes by isolated dermal DCs to activate T cells in vitro (Pederson, K., Mitchell, D. A. & Prestegard, J. H. Structural Characterization of the Dc-Sign-Lex Complex. Biochemistry, 53, 5700-5709 (2014)). Encouraged by these reports, 2 was advanced towards targeted delivery applications via the introduction of an ethylamino linker in -orientation of C1 of the Glc scaffold to yield targeting ligand 15 (see
[0522] After acetylation of the amino group, model ligand 16 was obtained (
[0523] Next, the specificity of targeting ligand 16 (see
Example 22
Binding Mode Analysis Derived from NMR and Molecular Modelling Insights: The Formation of - Interactions and Hydrogen Bonds by Aromatic Sulfonamide Substituents Mediate an Affinity Increase for Langerin
[0524] To investigate the binding mode of model ligand 16 (see
[0525] Titration of 16 (see
[0526] To complement the protein-observed NMR experiments and to investigate the orientation of the acetylated ethylamino linker, STD NMR epitope mapping with 16 and 21 (see
[0527] Finally, molecular docking was performed utilizing the X-ray structure of the Langerin complex with GlcNAc (see
Example 23
Application of a Lipid-Based Plate-Based Enzyme-Linked Lectin Assay (ELLA)
[0528] Monosaccharide analogs 15 or 20 (see