Methods of treatment using anti-c-met antibodies

10927177 ยท 2021-02-23

Assignee

Inventors

Cpc classification

International classification

Abstract

The present disclosure provides a pharmaceutical composition for preventing or treating a variety of diseases through c-Met activation in cells induced by the anti-c-Met antibody described herein which functions as a c-Met agonist. The current invention concerns a method for preventing or treating various diseases through c-Met activation by the anti-c-Met antibody described herein.

Claims

1. A method for treating a disease selected from the group consisting of ischemic disorder, stroke, kidney injury or disease, retinal neovascularization disorder, amyotrophic lateral sclerosis, and wound healing, the method comprising administering to a subject in need thereof a therapeutically effective amount of a polypeptide or a pharmaceutical composition comprising the polypeptide, wherein the polypeptide comprises an immunoglobulin heavy chain variable domain which comprises a CDR1 of SEQ ID NO:5, a CDR2 of SEQ ID NO:6, a CDR3 of SEQ ID NO:7, and a light chain variable domain which comprises a CDR1 of SEQ ID NO:8, a CDR2 of SEQ ID NO:9, and a CDR3 of SEQ ID NO:10.

2. The method according to claim 1, wherein the ischemic disorder is selected from the group consisting of ischemia of brain tissue, heart tissue, kidney tissue, or intestinal tissue.

3. The method according to claim 1, wherein the stroke is an embolic stroke or a thrombotic stroke.

4. The method according to claim 1, wherein the kidney injury or disease is a fibrotic condition.

5. The method according to claim 1, wherein the kidney injury or disease is selected from the group consisting of renal fibrosis, chronic kidney fibrosis, chronic nephropathy associated with diabetes, lupus, scleroderma of the kidney, glomerular nephritis, focal segmental glomerular sclerosis, IgA nephropathyrenal fibrosis associated with human chronic kidney disease (CD), chronic progressive nephropathy (CPN), tubulointerstitial fibrosis, ureteral obstruction, chronic uremia, chronic interstitial nephritis, radiation nephropathy, glomerulosclerosis, progressive glomerulonephrosis (PGN), endothelial/thrombotic microangiopathy injury, HIV-associated nephropathy, and a fibrosis associated with exposure to a toxin, an irritant, or a chemotherapeutic agent.

6. The method according to claim 1, wherein the retinal neovascularization disorder is caused by a member selected from the group consisting of macular degeneration, histoplasmosis, pathological myopia, angioid streaks, anterior ischemic optic neuropathy, bacterial endocarditis, Best's disease, birdshot retinochoroidopathy, choroidal hemangioma, choroidal nevi, choroidal nonperfusion, choroidal osteomas, choroidal rupture, choroideremia, chronic retinal detachment, coloboma of the retina, Drusen, endogenous Candida endophthalmitis, extrapapillary hamartomas of the retinal pigmented epithelium, fundus flavimaculatus, idiopathic, macular hole, malignant melanoma, membranoproliferative glomerulonephritis (type II), metallic intraocular foreign body, morning glory disc syndrome, multiple evanescent white-dot syndrome (MEWDS), neovascularization at or a serrata, operating microscope burn, optic nerve head pits, photocoagulation, punctuate inner choroidopathy, rubella, sarcoidosis, serpiginous or geographic choroiditis, subretinal fluid drainage, tilted disc syndrome, Taxoplasma retinochoroiditis, tuberculosis, Vogt-Koyanagi-Harada syndrome, diabetic retinopathy, non-diabetic retinopathy, branch vein occlusion, central retinal vein occlusion, retinopathy in premature infants, rubeosis iridis, neovascular glaucoma, periofoveal telangiectasis, sickle cell retinopathy, Eales disease, retinal vasculitis, Von Hippel Linau disease, radiation retinopathy, retinal cryoinjury, retinitis pigmentosa, retinochoroidal coloboma, corneal neovascularization due to herpes simplex keratitis, corneal ulcers, keratoplasty, pterigyia, and trauma.

7. The method according to claim 1, wherein the retinal neovascularization disorder is choroidal neovascularization.

8. The method according to claim 1, wherein the wound is a mechanical, chemical, bacterial, or thermal wound.

9. The method according to claim 1, wherein the wound is selected from the group consisting of an incision, a laceration, an abrasion, a puncture wound, a penetration wound, and a gunshot wound.

10. The method according to claim 1, wherein the wound is a skin wound.

11. The method according to claim 1, wherein the heavy chain variable domain comprises SEQ ID NO:1 and the light chain variable domain comprises SEQ ID NO:2.

12. The method according to claim 1 wherein the polypeptide is an antibody or fragment thereof.

13. The method according to claim 12, wherein the antibody or fragment thereof is a chimeric antibody, a humanized antibody, or a human antibody.

14. The method according to claim 1, wherein the polypeptide comprises a scFv.

15. The method according to claim 14, wherein the heavy chain variable domain comprises SEQ ID NO:1 and the light chain variable domain comprises SEQ ID NO:2.

16. The method according to claim 14, wherein the scFv comprises SEQ ID NO:3.

17. The method according to claim 1, wherein the administering is intravenous, intravitreal, intrathecal, parenteral, subcutaneous, topical, transdermal or by infusion.

18. The method according to claim 1, wherein the subject is not suffering from a cancer.

Description

BRIEF DESCRIPTION OF DRAWINGS

(1) FIGS. 1A-1B show a wound-healing promoting effect of an agonist anti-c-Met antibody. FIG. 1A is a photograph of a epidermal lesion on Day 10 after the wound occurred in mice. FIG. 1B is a graph illustrating the kinetics of wound closure for 14 days in mice treated with the agonist anti-c-Met antibody.

(2) FIGS. 2A-2B show a protective effect of an agonist anti-c-Met antibody in the adriamycin (ADR)-induced nephropathy model. FIG. 2A is a graph showing the change in the levels of blood urea nitrogen (BUN) and FIG. 2B is a graph showing the change in the levels of blood creatinine (Crea) in mice with renal injury which were treated with agonist anti-c-Met antibody-treated mice with renal injury. Nave refers to animals treated with neither ADR nor antibody. PBS refers to animals treated with ADR then with phosphate buffered saline (no antibody).

(3) FIGS. 3A-3B show an image of a tissue section (FIG. 3A) and corresponding graph (FIG. 3B) showing the degree of kidney injury in the mice treated with an agonist anti-c-Met antibody.

(4) FIGS. 4A-4B show a renal protective effect of an anti-c-Met agonist antibody in the rat nephropathy model induced by unilateral ureteral obstruction (UUO). FIG. 4A shows representative images of Masson's trichrome-stained sections of injured kidney tissues induced by UUO. FIG. 4B is a corresponding graph illustrating the score of fibrosis measured in the images of FIG. 4A.

(5) FIG. 5 shows the change in the infarct size upon treatment with an agonist anti-c-Met antibody in a rat model of ischemic stroke.

(6) FIG. 6 is a graph showing the measurement of the fluorescence that represents choroidal neovascularization upon treatment with an agonist anti-c-Met antibody in the rabbit model of laser-induced choroidal neovascularization (CNV).

(7) FIGS. 7A and 7B show migrating-promoting effects of an agonist anti-c-Met antibody on Schwann cells (iSc) in a Transwell assay. FIG. 7A shows images of stained cells. FIG. 7B is a quantitative representation of the images shown in FIG. 7A.

(8) FIGS. 8A-8D illustrate the effects of an agonist anti-c-Met antibody on motor function and survival of B6SJL-Tg (SOD1-G93A) mice. Results are shown for weekly assessment of Rotarod (FIG. 8A), grip strength (FIG. 8B), body weight (FIG. 8C), and survival (FIG. 8D).

BRIEF DESCRIPTION OF THE SEQUENCES

(9) SEQ ID NO:1 is the amino acid sequence of the 1E4 heavy chain variable domain.

(10) SEQ ID NO:2 is the amino acid sequence of the 1E4 light chain variable domain.

(11) SEQ ID NO:3 is the amino acid sequence of the 1E4 scFv construct.

(12) SEQ ID NO:4 is the amino acid sequence of the linker domain in the 1E4 scFv construct.

(13) SEQ ID NO:5 is the amino acid sequence of the 1E4 heavy chain variable domain CDR1.

(14) SEQ ID NO:6 is the amino acid sequence of the 1E4 heavy chain variable domain CDR2.

(15) SEQ ID NO:7 is the amino acid sequence of the 1E4 heavy chain variable domain CDR3.

(16) SEQ ID NO:8 is the amino acid sequence of the 1E4 light chain variable domain CDR1.

(17) SEQ ID NO:9 is the amino acid sequence of the 1E4 light chain variable domain CDR2.

(18) SEQ ID NO:10 is the amino acid sequence of the 1E4 light chain variable domain CDR3.

(19) SEQ ID NO:11 is the nucleic acid sequence of the 1E4 heavy chain variable domain.

(20) SEQ ID NO:12 is the nucleic acid sequence of the 1E4 light chain variable domain.

(21) SEQ ID NO:13 is the amino acid sequence of a human c-Met protein isoform b as described in GenBank Ace. No. NP_000236).

(22) SEQ ID NO:14 is the amino acid sequence of human c-Met protein isoform a as described in GenBank Acc. No. NP_001120972).

(23) SEQ ID NO:15 is the amino acid sequence of a mouse c-Met protein as described in GenBank Ace. No. NP_032617).

DETAILED DESCRIPTION

(24) Various aspects now will be described more fully hereinafter. Such aspects may, however, be embodied in many different forms and should not be construed as limited to the embodiments set forth herein; rather, these embodiments are provided so that this disclosure will be thorough and complete, and will fully convey its scope to those skilled in the art.

I. DEFINITIONS

(25) As used in this specification, the singular forms a, an, and the include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to a polymer includes a single polymer as well as two or more of the same or different polymers, reference to an excipient includes a single excipient as well as two or more of the same or different excipients, and the like.

(26) Where a range of values is provided, it is intended that each intervening value between the upper and lower limit of that range and any other stated or intervening value in that stated range is encompassed within the disclosure. For example, if a range of 1 m to 8 m is stated, it is intended that 2 m, 3 m, 4 m, 5 m, 6 m, and 7 m are also explicitly disclosed, as well as the range of values greater than or equal to 1 m and the range of values less than or equal to 8 m.

(27) The term c-Met herein refers to the MET proto-oncogene, receptor tyrosine kinase protein product which is also known in the art as the hepatocyte growth factor receptor (HGFR). Examples of c-Met include but are not limited to protein products described in GenBank as Accession No. NP_00236 (human c-Met isoform b, SEQ ID NO:13), NP_001120972 (human c-Met isoform a, SEQ ID NO:14) and NP_032617 (mouse, SEQ ID NO:15) and variants thereof which are bound by the 1E4 polypeptides described herein.

(28) The term antibody herein is used in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments so long as they exhibit the desired antigen-binding activity.

(29) A human antibody is one which possesses an amino acid sequence which corresponds to that of an antibody produced by a human or a human cell or derived from a non-human source that utilizes human antibody repertoires or other human antibody-encoding sequences. This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues.

(30) The term chimeric antibody refers to an antibody in which a portion of the heavy and/or light chain is derived from a particular source or species, while the remainder of the heavy and/or light chain is derived from a different source or species.

(31) The terms full length antibody, intact antibody, and whole antibody are used herein interchangeably to refer to an antibody having a structure substantially similar to a native antibody structure or having heavy chains that contain an Fc region as defined herein.

(32) The class of an antibody refers to the type of constant domain or constant region possessed by its heavy chain. There are five major classes of antibodies: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgG1, IgG2, IgG.sub.3, IgG.sub.4, IgA.sub.1, and IgA.sub.2. The heavy chain constant domains that correspond to the different classes of immunoglobulins are called , , , , and , respectively.

(33) An antibody fragment refers to a molecule other than an intact antibody that comprises a portion of an intact antibody that binds the antigen to which the intact antibody binds. Examples of antibody fragments include but are not limited to Fv, Fab, Fab, Fab-SH, F(ab)2; diabodies; linear antibodies; single-chain antibody molecules (e.g. scFv); and multispecific antibodies formed from antibody fragments. Papain digestion of antibodies produces two identical antigen-binding fragments, called Fab fragments, each with a single antigen-binding site, and a residual Fc fragment, whose name reflects its ability to crystallize readily. Pepsin treatment yields an F(ab)2 fragment that has two antigen-combining sites and is still capable of cross-linking antigen.

(34) The Fab fragment contains the heavy- and light-chain variable domains and also contains the constant domain of the light chain and the first constant domain (CH1) of the heavy chain. Fab fragments differ from Fab fragments by the addition of a few residues at the carboxy terminus of the heavy chain CH1 domain including one or more cysteines from the antibody hinge region. Fab-SH is the designation herein for Fab in which the cysteine residue(s) of the constant domains bear a free thiol group. F(ab)2 antibody fragments originally were produced as pairs of Fab fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.

(35) Framework or FR refers to variable domain residues other than hypervariable region (HVR) residues. The FR of a variable domain generally consists of four FR domains: FR1, FR2, FR3, and FR4. Accordingly, the HVR and FR sequences generally appear in the following sequence in VH (or VL): FR1-H1(L1)-FR2-H2(L2)-FR3-H3 (L3)-FR4.

(36) Fv is the minimum antibody fragment which contains a complete antigen-binding site. In one embodiment, a two-chain Fv species consists of a dimer of one heavy- and one light-chain variable domain in tight, non-covalent association. In a single-chain Fv (scFv) species, one heavy- and one light-chain variable domain can be covalently linked by a flexible peptide linker such that the light and heavy chains can associate in a dimeric structure analogous to that in a two-chain Fv species. It is in this configuration that the three HVRs of each variable domain interact to define an antigen-binding site on the surface of the VH-VL dimer. Collectively, the six HVRs confer antigen-binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three HVRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.

(37) The term variable region or variable domain refers to the domain of an antibody heavy or light chain that is involved in binding the antibody to antigen. The variable domains of the heavy chain and light chain (VH and VL, respectively) of a native antibody generally have similar structures, with each domain comprising four conserved framework regions (FRs) and three hypervariable regions (HVRs). (See, e.g., Kindt et al. Kuby Immunology, 6th ed., W.H. Freeman and Co., page 91 (2007)). A single VH or VL domain may be sufficient to confer antigen-binding specificity. Furthermore, antibodies that bind a particular antigen may be isolated using a VH or VL domain from an antibody that binds the antigen to screen a library of complementary VL or VH domains, respectively. See, e.g., Portolano et al., J. Immunol. 150:880-887 (1993); Clarkson et al., Nature 352:624-628 (1991).

(38) The term specifically binds, or the like, means that an antibody or antigen-binding fragment thereof, or other construct such as an scFv, forms a complex with an antigen that is relatively stable under physiologic conditions. Specific binding can be characterized by an equilibrium dissociation constant of at least about 110.sup.6 M or less (e.g., a smaller K.sub.D denotes a tighter binding). Methods for determining whether two molecules specifically bind are well known in the art and include, for example, equilibrium dialysis, surface plasmon resonance, and the like. An isolated antibody that specifically binds human c-Met may, however, exhibit cross-reactivity to other antigens such as c-Met molecules from other species.

(39) Affinity refers to the strength of the sum total of noncovalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, binding affinity refers to intrinsic binding affinity which reflects a 1:1 interaction between members of a binding pair (e.g., antibody and antigen). The affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (Kd). Affinity can be measured by common methods known in the art, including those described herein. Specific illustrative and exemplary embodiments for measuring binding affinity are described in the following.

(40) An effective amount or therapeutically effective amount of an agent, e.g., a pharmaceutical formulation, refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result.

(41) As used herein, the term treating is used to refer to both prevention of a disease or disorder, and treatment of pre-existing or diagnosed conditions.

II. THERAPEUTIC METHODS USING AGONIST C-MET ANTIBODIES

(42) A. c-Met as a Therapeutic Target

(43) The c-Met receptor protein, also known as the hepatocyte growth factor (HGF) receptor, is expressed on the surface of epithelial cells of many organs, including the liver, pancreas, prostate, kidney, muscle and bone marrow. The ligand for c-Met is HGF. HGF acts as a pleiotropic factor and cytokine, promoting cell proliferation, survival, motility, scattering, differentiation and morphogenesis in various tissues of the body. In addition, HGF appears to play a protective role in several diseases, including liver cirrhosis, lung fibrosis, and progressive nephropathies. Upon binding of HGF to the c-Met extracellular domain, multiple tyrosine residues within the cytoplasmic domain of c-Met are phosphorylated. Phosphorylation of Y1234 and Y1235 activates c-Met tyrosine kinase activity and subsequent phosphorylation of the Y1349 and Y1356 residues (Matsumoto et al., 2014, Biomedicines, 2:275-300). Phosphorylated tyrosine residues recruit various intracellular signaling molecules resulting in biological activities such as promotion of mitogenesis and migration, suppression of cell death, and induction of epithelial morphogenesis. HGF-c-Met interaction has been shown to play a role in diverse biological systems including but not limited to the liver, kidney, skin, pancreas, lung, the nervous system, heart and immune system.

(44) Disclosed herein are therapeutic compositions and methods for administering to a subject in need thereof a polypeptide which specifically binds the c-Met protein and which activates c-Met in a manner which may be similar to activation by binding of HGF. Data are provided below to show that the c-Met activating polypeptides disclosed herein are therapeutically effective in preventing or treating a variety of conditions indicative of disease states.

(45) B. c-Met Agonist Antibodies

(46) An immunoglobulin which binds the c-Met protein was generated as described in PCT Application No. PCT/KR2015/007899 (the contents of which are incorporated by reference in their entirety). In summary, a fully humanized single-chain antibody (scFv) phage display library for biopanning was used to select scFv species which bound human c-Met. The scFv referred to herein as 1E4 scFv was identified and demonstrated to bind c-Met with high affinity and has the amino acid sequence presented herein as SEQ ID NO:3. The 1E4 scFv or variants thereof can be used for treating a subject in need thereof as described in more detail below.

(47) Also described in PCT/KR2015/007899 is the construction of a full-length immunoglobulin having the heavy chain variable domain (SEQ ID NO:1) and light chain variable domain (SEQ ID NO:2) of the 1E4 scFv, as well as human IgG light chain constant domain and human IgG heavy chain constant domains. The heavy chain variable domain comprises a CDR1 (SEQ ID NO:5), a CDR2 (SEQ ID NO:6) and a CDR3 (SEQ ID NO:7). The light chain variable domain comprises a CDR1 (SEQ ID NO:8), a CDR2 (SEQ ID NO:9), and a CDR3 (SEQ ID NO:10). The person having ordinary skill in the art understands that antigen binding specificity of an immunoglobulin is determined largely by the CDR sequences. Accordingly, in some embodiments, the presently disclosed methods encompass treatment with an antibody comprising a heavy chain variable domain comprising the CDRs of SEQ ID NO:5, SEQ ID NO:6 and SEQ ID NO:7, and a light chain variable domain comprising the CDRs of SEQ ID NO:8, SEQ ID NO:9 and SEQ ID NO:10. In additional embodiments, the antibody comprises an IgG heavy chain comprising SEQ ID NO:1 and an IgG light chain comprising SEQ ID NO:2. The amino acid sequences of the 1E4 constructs described above are presented in Table 1.

(48) TABLE-US-00001 TABLE1 SEQ ID Descrip- NO tion Sequence 1 Heavy QVQLVQSGAEVKKPGESLRISCQGSGYSFPTHWIT chain WVRQMPGKGLEWMGTIDPTDSYNFYGPSFQGHVTI variable SADSSSSTAYLQWSSLKASDTAMYYCARDGNYYDS domain RGYYYDTFDMWGQGTLVTVSS 2 Light DIQMTQSPSFLSASVGDRVTITCRASQGISTYLAW chain YQQKPGTAPKLLIYSASTLESGVPSRFSGSGSGTD variable FTLTISSLQPEDSATYYCQQADSFPLTFGGGTKVE domain IKRGGASLVE 3 1E4 QVQLVQSGAEVKKPGESLRISCQGSGYSFPTHWIT scFv WVRQMPGKGLEWMGTIDPTDSYNFYGPSFQGHVTI SADSSSSTAYLQWSSLKASDTAMYYCARDGNYYDS RGYYYDTFDMWGQGTLVTVSSGLGGLGGGGSGGGG SGGSSGVGSDIQMTQSPSFLSASVGDRVTITCRAS QGISTYLAWYQQKPGTAPKLLIYSASTLESGVPSR FSGSGSGTDFTLTISSLQPEDSATYYCQQADSFPL TFGGGTKVEIKRGGASLVE 4 scFv GLGGLGGGGSGGGGSGGSSGVGS linker 5 Heavy THWIT chain CDR1 6 Heavy TIDPTDSYNFYGPSFQG chain CDR2 7 Heavy DGNYYDSRGYYYDTFDM chain CDR3 8 Light RASQGISTYLA chain CDR1 9 Light SASTLES chain CDR2 10 Light QQADSFPLT chain CDR3

(49) The 1E4 antibody for use in the treatment methods described herein is optionally referred to herein as an agonist antibody because the 1E4 antibody has been shown to both induce scattering in MDCK-2 (Madin-Darby Canine Kidney epithelial Cells-2) and to induce c-Met phosphorylation (PCT/KR2015/007899).

(50) The 1E4 antibody has also been shown to bind to both human c-Met and mouse c-Met. Specifically, BIAcore analysis of the 1E4-IgG antibody was performed (PCT/KR2015/007899) using both human and mouse c-MET. The binding results are presented below in Table 2.

(51) TABLE-US-00002 TABLE 2 Protein Ka (1/Ms) Kd (1/s) KD (M) Mouse c-Met 2.58 10.sup.6 1.59 10.sup.3 6.15 10.sup.10 Human c-Met 2.71 10.sup.6 8.07 10.sup.4 2.98 10.sup.10

(52) Accordingly, in some embodiments, a method for treating a subject is provided comprising administering to the subject an antibody which binds to a human c-Met protein with a KD less than or equal to about 310.sup.10 M or which binds to a mouse c-Met protein with a KD less than or equal to about 710.sup.10 M, wherein the antibody is an agonist of c-Met function.

(53) Unless specifically indicated otherwise, the term antibody, as used herein, shall be understood to encompass antibody molecules comprising two immunoglobulin heavy chains and two immunoglobulin light chains (i.e., full antibody molecules) as well as antigen-binding fragments thereof (e.g., the term antibody, as used herein, shall be understood to encompass polypeptides comprising a heavy chain variable domain and a light chain variable domain). Accordingly, the term antibody as used herein may encompass the scFv construct or other immunoglobulin proteins. The terms antigen-binding portion of an antibody, antigen-binding fragment of an antibody, and the like, as used herein, include any naturally occurring, enzymatically obtainable, synthetic, or genetically engineered polypeptide or glycoprotein that specifically binds an antigen to form a complex. The terms antigen-binding portion of an antibody, or antibody fragment, as used herein, refers to one or more fragments of an antibody that retain the ability to specifically bind to c-Met protein. An antibody fragment may include a Fab fragment, a F(ab).sub.2 fragment, a Fv fragment, a dAb fragment, a fragment containing a CDR, or an isolated CDR. Antigen-binding fragments of an antibody may be derived, e.g., from full antibody molecules using any suitable standard techniques such as proteolytic digestion or recombinant genetic engineering techniques involving the manipulation and expression of DNA encoding antibody variable and (optionally) constant domains. Such DNA is known and/or is readily available from, e.g., commercial sources, DNA libraries (including, e.g., phage-antibody libraries), or can be synthesized. The DNA may be sequenced and manipulated chemically or by using molecular biology techniques, for example, to arrange one or more variable and/or constant domains into a suitable configuration, or to introduce codons, create cysteine residues, modify, add or delete amino acids, etc.

(54) Non-limiting examples of antigen-binding fragments include: (i) Fab fragments; (ii) F(ab)2 fragments; (iii) Fd fragments; (iv) Fv fragments; (v) single-chain Fv (scFv) molecules; (vi) dAb fragments; and (vii) minimal recognition units consisting of the amino acid residues that mimic the hypervariable region of an antibody (e.g., an isolated complementarity determining region (CDR) such as a CDR3 peptide), or a constrained FR3-CDR3-FR4 peptide. Other engineered molecules, such as domain-specific antibodies, single domain antibodies, domain-deleted antibodies, chimeric antibodies, CDR-grafted antibodies, diabodies, triabodies, tetrabodies, minibodies, nanobodies (e.g. monovalent nanobodies, bivalent nanobodies, etc.), small modular immunopharmaceuticals (SMIPs), and shark variable IgNAR domains, are also encompassed within the expression antigen-binding fragment, as used herein.

(55) An antigen-binding fragment of an antibody will typically comprise at least one variable domain. The variable domain may be of any size or amino acid composition and will generally comprise at least one CDR, which is adjacent to or in frame with one or more framework sequences. In antigen-binding fragments having a V.sub.H domain associated with a V.sub.L domain, the V.sub.H and V.sub.L domains may be situated relative to one another in any suitable arrangement. For example, the variable region may be dimeric and contain V.sub.H-V.sub.H, V.sub.H-V.sub.L or V.sub.L-V.sub.L dimers. Alternatively, the antigen-binding fragment of an antibody may contain a monomeric V.sub.H or V.sub.L domain.

(56) As with full antibody molecules, antigen-binding fragments may be mono-specific or multi-specific (e.g., bi-specific). A multi-specific antigen-binding fragment of an antibody will typically comprise at least two different variable domains, wherein each variable domain is capable of specifically binding to a separate antigen or to a different epitope on the same antigen. Any multi-specific antibody format, including the exemplary bi-specific antibody formats disclosed herein, may be adapted for use in the context of an antigen-binding fragment of an antibody of the present invention using routine techniques available in the art.

(57) In certain embodiments, amino acid sequence variants of the antibodies provided herein are contemplated. For example, it may be desirable to improve the binding affinity and/or other biological properties of the antibody. Amino acid sequence variants of an antibody may be prepared by introducing appropriate modifications into the nucleotide sequence encoding the antibody, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of residues within the amino acid sequences of the antibody. In some embodiments, an anti-c-Met antibody as used according to the methods described herein comprises a heavy chain variable domain (VH) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO:1. In certain embodiments, a VH sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO:1 contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-c-Met antibody comprising that sequence retains the ability to bind to c-Met. In certain embodiments, the substitutions, insertions, or deletions occur in regions outside the CDRs (i.e., in the framework regions). Optionally, the anti-c-Met antibody described comprising the VH sequence includes post-translational modifications of that sequence.

(58) In another aspect, an anti-c-Met antibody as used according the methods described herein comprises a light chain variable domain (VL) having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO:2. In certain embodiments, a VL sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO:2 contains substitutions (e.g., con/servative substitutions), insertions, or deletions relative to the reference sequence, but an anti-c-Met antibody comprising that sequence retains the ability to bind to c-Met. In certain embodiments, the substitutions, insertions, or deletions occur in regions outside the CDRs (i.e., in the framework regions). Optionally, the anti-c-Met antibody described comprising the VL sequence includes post-translational modifications of that sequence.

(59) In some embodiments, an anti-c-Met antibody as used according to the methods described herein comprises a VH sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO:1 and a VL sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO:2, wherein the antibody specifically binds a c-Met protein having the sequence of SEQ ID NO:13. In other embodiments, the antibody binds to the c-Met protein having the sequence of SEQ ID NO:13 with K.sub.D less than or equal to about 310.sup.10 M. In still other embodiments, the antibody binds to the c-Met protein having the sequence of SEQ ID NO:15 with K.sub.D less than or equal to about 710.sup.10 M.

(60) Any combination of deletion, insertion, and substitution can be made to arrive at the final construct, provided that the final construct possesses the desired characteristics, e.g., antigen-binding.

(61) In certain embodiments, antibody variants having one or more amino acid substitutions are provided. Sites of interest for substitutional mutagenesis include the variable regions including the framework regions. Conservative substitutions are shown in Table 3 under the heading of conservative substitutions. More substantial changes are provided in Table 3 under the heading of Preferred substitutions, and as further described below in reference to amino acid side chain classes. Amino acid substitutions may be introduced into an antibody of interest and the products screened for a desired activity, e.g., retained/improved antigen binding, decreased immunogenicity, or improved ADCC or CDC.

(62) TABLE-US-00003 TABLE 3 Original Preferred Residue Conservative Substitutions Substitutions Ala (A) Val; Leu; Ile Val Arg (R) Lys; Gln; Asn Lys Asn (N) Gln; His; Asp, Lys; Arg Gln Asp (D) Glu; Asn Glu Cys (C) Ser; Ala Ser Gln (Q) Asn; Glu Asn Glu (E) Asp; Gln Asp Gly (G) Ala Ala His (H) Asn; Gln; Lys; Arg Arg Ile (I) Leu; Val; Met; Ala; Phe; Norleucine Leu Leu (L) Norleucine; Ile; Val; Met; Ala; Phe Ile Lys (K) Arg; Gln; Asn Arg Met (M) Leu; Phe; Ile Leu Phe (F) Trp; Leu; Val; Ile; Ala; Tyr Tyr Pro (P) Ala Ala Ser (S) Thr Thr Thr (T) Val; Ser Ser Trp (W) Tyr; Phe Tyr Tyr (Y) Trp; Phe; Thr; Ser Phe Val (V) Ile; Leu; Met; Phe; Ala; Norleucine Leu

(63) Amino acids may be grouped according to common side-chain properties:

(64) (1) hydrophobic: Norleucine, Met, Ala, Val, Leu, lie;

(65) (2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gin;

(66) (3) acidic: Asp, Glu;

(67) (4) basic: His, Lys, Arg;

(68) (5) residues that influence chain orientation: Gly, Pro;

(69) (6) aromatic: Trp, Tyr, Phe.

(70) Non-conservative substitutions will entail exchanging a member of one of these classes for another class.

(71) In certain embodiments, an antibody provided herein is altered to increase or decrease the extent to which the antibody is glycosylated. Addition or deletion of glycosylation sites to an antibody may be conveniently accomplished by altering the amino acid sequence such that one or more glycosylation sites is created or removed.

(72) Where the antibody comprises an Fc region, the carbohydrate attached thereto may be altered. The oligosaccharide may include various carbohydrates, e.g., mannose, N-acetyl glucosamine (GlcNAc), galactose, and sialic acid, as well as a fucose attached to a GlcNAc in the stem of the biantennary oligosaccharide structure. In some embodiments, modifications of the oligosaccharide in an antibody of the invention may be made in order to create antibody variants with certain improved properties. Antibodies variants are further provided with bisected oligosaccharides, e.g., in which a biantennary oligosaccharide attached to the Fc region of the antibody is bisected by GlcNAc. Such antibody variants may have reduced fucosylation and/or improved ADCC function. Antibody variants with at least one galactose residue in the oligosaccharide attached to the Fc region are also provided.

(73) C. Generating 1E4 Immunoglobulins for Therapeutic Use

(74) The generation of a full-length human 1E4 IgG antibody from the heavy and light chain variable domains of an scFv construct (SEQ ID NO:3) is done using routine methods and compositions. Construction of the human 1E4 antibody used in the methods described herein is described in Example 1 below and in PCT/KR2015/007899. The nucleic acids encoding variable domains of the 1E4 antibody as described herein (SEQ ID NOS: 11 and 12 and variants thereof) can be used to generate full-length antibodies using routine methods. In some embodiments, a nucleic acid encoding a heavy chain of an anti-c-Met antibody of the present disclosure can comprise a nucleotide sequence encoding a VH domain of the disclosure (SEQ ID NO:11) joined in-frame to a nucleotide sequence encoding a heavy chain constant domain from any source. Similarly, a nucleic acid molecule encoding a light chain of an anti-c-Met antibody of the present disclosure can comprise a nucleotide sequence encoding a VL domain of the disclosure (SEQ ID NO:12) joined in-frame to a nucleotide sequence encoding a light chain constant domain from any source.

(75) In a further aspect of the disclosure, nucleic acid molecules encoding the variable domain of the heavy (VH) and/or light (VL) chains are converted to full-length antibody genes. In one embodiment, nucleic acid molecules encoding the VH or VL domains are converted to full-length antibody genes by insertion into an expression vector already encoding heavy chain constant (CH) or light chain constant (CL) domains, respectively, such that the VH segment is operatively linked to the CH segment(s) within the vector, and/or the VL segment is operatively linked to the CL segment within the vector. In another embodiment, nucleic acid molecules encoding the VH and/or VL domains are converted into full-length antibody genes by linking, e.g., ligating, a nucleic acid molecule encoding a VH and/or VL domains to a nucleic acid molecule encoding a CH and/or CL domain using standard molecular biological techniques. Nucleic acid sequences of human heavy and light chain immunoglobulin constant domain genes are known in the art. See, e.g., Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed., NIH Publ. No. 91-3242, 1991. Nucleic acid molecules encoding the full-length heavy and/or light chains may then be expressed from a cell into which they have been introduced and the anti-c-Met antibody isolated.

(76) The nucleic acid molecules may be used to recombinantly express large quantities of anti-c-Met antibodies. The nucleic acid molecules also may be used to produce chimeric antibodies, bispecific antibodies, single chain antibodies, immunoadhesins, diabodies, mutated antibodies and antibody derivatives, as described further above.

(77) Similarly, in some embodiments, the polynucleotides encoding the heavy chain variable domain (SEQ ID NO:1) and the light chain variable domain (SEQ ID NO:2) can be joined by a polynucleotide encoding a linker (e.g., SEQ ID NO:4), cloned into an expression vector and expressed from a cell into which the vector has been introduced to produce an scFv construct for use in the treatment methods described herein.

(78) D. Wound Healing

(79) In one aspect, a method for promoting wound healing in a subject in need thereof is provided comprising administering to the subject a therapeutically effective amount of a polypeptide comprising the heavy and light chain variable domains of the 1E4 antibody as described herein. As described in Example 2 below, administration of 1E4 antibody to the wounds of a mouse resulted in a faster wound healing time as compared to healing of wounds in mice not administered the 1E4 antibody. As shown in FIG. 1, topical administration to a skin wound on a mouse of 3 g, 6 g or 12 g of 1E4 antibody was effective in reducing wound area by at least 20% as compared to healing in the absence of 1E4 immunoglobulin. A skilled artisan would thereby understand that administration of an immunoglobulin molecule comprising the c-Met binding domains of 1E4 would be effective in promoting wound healing in a subject.

(80) Wound healing has been shown to require the HGF-c-Met pathway. Wounds can occur from many sources, including a break in the skin or other tissue or organ, such as lacerations, cuts, scrapes, blisters, abrasions, burns, diabetic ulcers, bedsores, surgical wounds, and other wounds. All wounds regardless of their nature undergo a similar process of wound healing. Wound healing occurs in four distinct phases. The first phase is blood clotting (hemostasis) when platelets arrive at the site of the wound where they are activated to promote clotting. The second phase, the inflammatory phase, is characterized by inflammation at the site of the trauma. This phase is critical for healing and involves extensive cell migration. The third phase of wound healing is the proliferative phase, which is marked by epithelialization, angiogenesis, granulated tissue formation and collagen deposition. Angiogenesis, which involves new capillary formation, is used to deliver nutrients and maintain granulation. Without formation of new capillaries into the wound, required nutrients fail to reach the wound resulting in a chronically unhealed wound. The fourth and final stage of wound healing is the maturational phase wherein fibroblasts differentiate into collagen. The compositions and methods of this disclosure are effective in one or more distinct phases of the wound healing. In one embodiment, the compositions and methods of the present disclosure trigger the proper healing sequence required in all forms of wounds and therefore prevent the destructive biochemical reactions typically brought on by a wound.

(81) In one embodiment, the 1E4 antibody of the disclosure is effective against burn. There are various types of burn such as thermally induced burns, thermally induced controlled burns, chemical burns, radiation burns, electrical burns, ice burns, or burns caused by exposure to lightening that may be prevented and/or treated with the compositions and methods of the present disclosure. There are various degrees of burns including those that are 1st degree, 2nd degree, 3rd degree, or 4th degree burns or any combination thereof.

(82) In another embodiment, the compositions and methods of the present disclosure directly or indirectly prevent microorganisms from invading the wound site by promoting wound healing. Patients will therefore also suffer less because they remain free from various infections commonly associated with typical wound. The composition thus prevents wound injuries from progressing to greater severity. The use of compositions and methods of the present disclosure prevents, treats and/or ameliorates the tissue damage that is the breeding ground for microorganisms in most wounds. The ability to interfere with the cycle of infection can halt the disease process. The reduced rate of infection translates to reduced severity of disease, disorders and deformities that are normal consequences of a wound.

(83) Other conditions related to wounds or sores which may be successfully treated or prevented according to the disclosure are, by way of example and not limitation, anthrax wounds, tetanus, gas gangrene, scalatina, erysipelas, sycosis barbae, folliculitis, impetigo contagiosa, or impetigo bullosa, etc.

(84) In practicing the method of treatment or use of the present disclosure, a therapeutically effective amount of an agonist c-Met immunoglobulin is administered to a subject in need of wound healing. The immunoglobulin may be administered in accordance with the method of the present disclosure either alone or in combination with other known therapies. When co-administered with one or more other therapies, the immunoglobulin may be administered either simultaneously with the other treatment(s), or sequentially. If administered sequentially, the attending physician will decide on the appropriate sequence of administration, which may be before or after a second therapy.

(85) E. Prevention or Treatment of Damage to Kidney Tissue

(86) In one aspect, methods for preventing or treating damage to kidney tissue is provided comprising administering to a subject in need thereof a polypeptide comprising the variable domains of the 1E4 antibody as described herein. Experiments were done as described in Example 3 below to show that administration of the 1E4 antibody to an animal reduces kidney tissue damage which is caused by administration to the animal of the chemotherapeutic drug adriamycin (ADR). Specifically, BALB/c mice were treated with 2 mg/kg, 5 mg/kg or 10 mg/kg 1E4 antibody by tail vein injections. The following day, kidney injury was induced by a single tail injection of 15 mg/kg ADR. The mice were then injected intravenously with 2 mg/kg, 5 mg/kg or 10 mg/kg 1E4 antibody 2 and 5 days after injection of the ADR. As the data in FIGS. 2A and 2B show, doses of 5 mg/kg or more of 1E4 immunoglobulin are effective in reducing the increased levels of BUN (blood urea nitrogen) and creatinine. Increasing BUN and creatinine levels in the blood are indicative of kidney malfunction and damage. Plasma concentrations of creatinine and urea (which are highly dependent on glomerular filtration) begin a nonlinear rise as the renal function diminishes. Changes in creatinine and urea concentrations are minimal early on; later levels increase rapidly and are usually associated with systemic manifestations.

(87) After administration of ADR, animals treated with PBS only experienced increases in both BUN and creatinine (FIGS. 2A and 2B, PBS as compared to nave animals which were not treated with ADR or antibody). However, administration of 5 mg/kg or 10 mg/kg 1E4 antibody resulted in decreased levels of both BUN and creatinine as compared to levels in animals not treated with 1E4 antibody. Moreover, significant reduction of kidney tissue damage in the presence of at least 5 mg/kg of 1E4 immunoglobulin was observed via histological analysis (see Example 3).

(88) Renal fibrosis results from an excessive accumulation of extracellular matrix that occurs in almost every type of chronic kidney disease and ultimately leads to end-stage renal failure. Renal fibrosis is thought by some as a failed wound-healing process of the kidney tissue after chronic, sustained injury. Example 4 below describes use of an animal model for renal fibrosis and shows that administration of the 1E4 antibody decreased the extent of fibrotic lesions in the kidney tissue. Accordingly, in some embodiments is a method for treating or preventing damage to kidney tissue comprising administering a 1E4 immunoglobulin.

(89) The methods and compositions of the present disclosure are applicable to the treatment and prevention of various renal diseases and renal injury, both primary and secondary. Secondary renal diseases include those diseases resulting from a pre-existing condition such as diabetes or hypertension. The methods and compositions of the present invention find application particularly in chronic inflammatory and autoimmune diseases characterized by pathological changes of tubulointerstitial nephropathy or glomerulonephropathy and by proteinuria. Diseases include, but are not limited to, focal segmental glomerulosclerosis, glomerulonephritis, diabetic renal disease, hypertensive renal disease, renal failure, End Stage Renal Disease, and related conditions.

(90) Additionally, chronic renal failure may result from any major cause of renal dysfunction. The most common cause of end-stage renal disease is diabetic nephropathy, followed by hypertensive nephroangiosclerosis and various primary and secondary glomerulopathies. Other causes include but are not limited to glomerulopathies, e.g. IgA nephropathy, focal glomerulosclerosis, membranous nephropathy, membranoproliferative glomerulonephritis, idiopathic crescentic glomerulonephritis, diabetes mellitus, postinfectious glomerulonephritis, systemic lupus erythematosus, Wegener's granulomatosis, hemolytic-uremic syndrome, amyloidosis; chronic tubulointerstitial nephropathies; hereditary nephropathies, e.g. polycistic kidney disease, Alport's syndrome, medullary cystic disease, Nail-patella syndrome; hypertension, e.g. nephroangiosclerosis, malignant glomerulosclerosis; renal macrovascular disease; and obstructive uropathy, e.g. ureteral obstruction, vesicoureteral reflux, benign prostatic hyperplasia; and the like.

(91) In practicing the method of treatment or use of the present disclosure, a therapeutically effective amount of an agonist c-Met immunoglobulin is administered to a subject afflicted with a disease or disorder related to loss of renal function. The immunoglobulin may be administered in accordance with the method of the present disclosure either alone or in combination with other known therapies. When co-administered with one or more other therapies, the immunoglobulin may be administered either simultaneously with the other treatment(s), or sequentially. If administered sequentially, the attending physician will decide on the appropriate sequence of administration, which may be before or after a second therapy.

(92) F. Treatment or Prevention of Tissue Damage Due to Ischemia

(93) In one aspect, methods for preventing or treating ischemic damage to tissue is provided comprising administering to a subject in need thereof a polypeptide comprising the variable domains of the 1E4 antibody as described herein. The 1E4 antibody was shown to be effective for reducing injury due to ischemic stroke in an animal model (see Example 5). An animal model was used in which the middle cerebral artery was occluded in rats which had been administered 10 mg/kg 1E4 antibody 1 day earlier. The rats were then intravenously administered 10 mg/kg 1E4 antibody 1 hour after on days 3, 10, 17 and 24 after occlusion. Analysis of brain tissue was performed using an MRI to measure the extent of infarction. The results showed that administration of the 1E4 antibody was effective in reducing infarction size in the occlusion model (see FIG. 5).

(94) Ischemia refers to a reduction or abolition of blood supply to a tissue. The immunoglobulin polypeptides and methods described herein can be used to treat injuries associated with ischemia, or ischemic injuries. Ischemic injuries can include injuries to, e.g., the kidney, liver, lungs, pancreas, skeletal muscle, intestines, heart and brain. Ischemic injuries can be associated with or caused by, e.g., stroke, acute myocardial infarction, elective angioplasty, coronary artery bypass graft, surgery involving cardiac bypass or organ or tissue transplantation (e.g., cardiac transplantation), tissue rejection after transplantation, graft versus host disease, head trauma, drowning, sepsis, cardiac arrest, shock, atherosclerosis, hypertension, cocaine-induced heart disease, smoking-induced heart disease, heart failure, pulmonary hypertension, hemorrhage, capillary leak syndrome (such as child and adult respiratory distress syndrome), multi-organ system failure, a state of low colloid oncotic pressure (such as starvation, anorexia nervosa, or hepatic failure with decreased production of serum proteins), anaphylaxis, hypothermia, cold injury (e.g., due to hypothermic perfusion or frostbite) hepatorenal syndrome, delirium tremens, a crush injury, mesenteric insufficiency, peripheral vascular disease, claudication, burn, electrocution, excessive drug-induced vasodilation, excessive drug-induced vasoconstriction, radiation exposure (e.g., during fluoroscopy or radiographic imaging), or exposure to high energy, e.g., exposure to laser light. Excessive drug-induced vasodilation can be caused by, for instance, nitroprusside, hydralazone, dyazoxide, a calcium channel blocker, or a general anesthetic. Excessive drug-induced vasoconstriction can be caused by, for instance, neosynephrine, isoproterenol, dopamine, dobutamine, or cocaine.

(95) Stroke is a general term for acute brain damage resulting from disease or injury of blood vessels. Stroke can be classified into at least two main categories: hemorrhagic stroke (resulting from leakage of blood outside of the normal blood vessels) and ischemic stroke (cerebral ischemia due to lack of blood supply). Some events that can cause ischemic stroke include thrombosis, embolism, and systemic hypoperfusion (with resultant ischemia and hypoxia). Stroke generally causes neuronal death and injury in the brain by oxygen deprivation and secondary events. The area of the brain that dies as a result of the lack of blood supply or other damage is called an infarct. In some cases, the treatments described herein can be used to reduce or minimize the size of an infarct, e.g., by reducing secondary events that cause neuronal death or injury.

(96) Obstruction of a cerebral artery resulting from a thrombus which has built up on the wall of a brain artery is generally called cerebral thrombosis. In cerebral embolism, the occlusive material blocking the cerebral artery arises downstream in the circulation (e.g., an embolus is carried to the cerebral artery from the heart). Because it is difficult to discern whether a stroke is caused by thrombosis or embolism, the term thromboembolism is used to cover both these types of stroke. Systemic hypoperfusion may arise as a consequence of decreased blood levels, reduced hematocrit, low blood pressure or inability of the heart to pump blood adequately.

(97) In practicing the method of treatment or use of the present disclosure, a therapeutically effective amount of an agonist c-Met immunoglobulin is administered to a subject afflicted with a disease or disorder related to ischemia. The immunoglobulin may be administered in accordance with the method of the present disclosure either alone or in combination with other known therapies. When co-administered with one or more other therapies, the immunoglobulin may be administered either simultaneously with the other treatment(s), or sequentially. If administered sequentially, the attending physician will decide on the appropriate sequence of administration, which may be before or after a second therapy.

(98) G. Treatment of Pathologic Retinal Neovascularization

(99) In one aspect, methods for preventing or treating a neovascular retinal disease related to pathologic neovascularization in the retina is provided comprising administering to a subject in need thereof a polypeptide comprising the variable domains of the 1E4 antibody as described herein. Example 6 below describes the successful treatment of pathologic neovascularization in an animal model. Specifically, a laser-induced choroidal neovascularization model (CNV) was used with Chinchilla rabbits in which photocoagulation spots were created around the optic nerve. Treatment of the rabbits with 50 g 1E4 antibody by direct administration to the vitreous humor resulted in inhibition of laser-induced CNV formation (see FIG. 6), supporting embodiments in which a subject in need thereof is treated with 1E4 immunoglobulin compositions for the treatment or prevention of pathologic neovascularization in the retina.

(100) The pathologic growth of new blood vessels (neovascularization) in and around the tissues of the eye is associated with a variety of ocular diseases. In particular, hypoxia is known to be the primary stimulus for pathologic neovascularization of the choroid and Bruch's membrane that results in the often catastrophic vision loss associated with diabetic retinopathy, retinopathy of prematurity, and the wet form of AMD.

(101) Disclosed herein are methods for the treatment of diseases or conditions of the eye, especially retinopathies, ocular edema and ocular neovascularization. Non-limiting examples of these diseases or conditions include diabetic macular edema, age-related macular degeneration (wet form), choroidal neovascularization, diabetic retinopathy, ocular ischemia, uveitis, retinal vein occlusion (central or branch), ocular trauma, surgery induced edema, surgery induced neovascularization, cystoid macular edema, ocular ischemia, uveitis, and the like. These diseases or conditions are characterized by changes in the ocular vasculature whether progressive or non-progressive, whether a result of an acute disease or condition, or a chronic disease or condition. In other embodiments, the subject is suffering from ischemia-induced neovascularization. Ischemia-induced neovascularization need not necessarily be caused by disease. For example, injury or insult to the ocular tissue can lead to hypoxia of ocular tissues and thereby cause ischemia-induced neovascularization which results in loss of vision.

(102) One aspect of the disclosed methods relates to diseases that are a direct or indirect result of diabetes, including diabetic macular edema and diabetic retinopathy. Another condition that may occur is non-proliferative retinopathy in which vascular changes, such as microaneurysms, may occur outside the macular region of the eye. These conditions may or may not progress to diabetic proliferative retinopathy which is characterized by neovascularization. Typically, subjects having diabetic macular edema are suffering from the non-proliferative stage of diabetic retinopathy; however, it is not uncommon for subjects to only begin manifesting macular edema at the onset of the proliferative stage.

(103) In practicing the method of treatment or use of the present disclosure, a therapeutically effective amount of an agonist c-Met immunoglobulin is administered to a subject afflicted with a disease or disorder related to pathologic retinal neovascularization. The immunoglobulin may be administered in accordance with the method of the present disclosure either alone or in combination with other known therapies. When co-administered with one or more other therapies, the immunoglobulin may be administered either simultaneously with the other treatment(s), or sequentially. If administered sequentially, the attending physician will decide on the appropriate sequence of administration, which may be before or after a second therapy.

(104) H. Treatment of Neuronal Diseases

(105) In one aspect, methods for preventing or treating a neuronal disease or disorder is provided comprising administering to a subject in need thereof a polypeptide comprising the variable domains of the 1E4 antibody as described herein. Activation of c-Met by binding of HGF plays a role in development and maintenance of the nervous system, as c-Met is expressed in developing and adult brains including neurons of the cerebral cortex, hippocampus, cerebellum, brainstem motor nucleus, retina and sensory ganglia, and the spinal cord, as well as non-neuronal cells such as reactive astrocytes, oligodendrocyte progenitors, oligodendrocytes, and microglia (see Funakoshi and Nakamura, 2011, Current Signal Transduc Ther, 6:156-167 for review).

(106) Experiments described in Example 7 were done to study the effects of 1E4 agonist antibody administration on Schwann cell migration. Schwann cells are known to play important roles in nervous system development, function and maintenance. For example, re-myelination of damaged nerves requires migration of Schwann cells to the damaged nerves. As demonstrated in Example 7 and shown in FIGS. 7A and 7B, administration of 1E4 antibody to rat Schwann cells in culture significantly increased the migration activity of these cells as compared to cells treated only with buffer.

(107) The effects of an agonist c-Met antibody as disclosed herein were further studied using an animal model for amyotrophic lateral sclerosis. B6SJL-Tg (SOD1-G93A) mice expressing human mutant SOD1 are accepted as an animal model to study the therapeutic effect of agents on ALS and other neuromuscular diseases. Mice treated with 1E4 antibody intrathecally and intraperitoneally as described in Example 8 were found to have improved motor function when administered 1E4 antibody as compared to mice administered buffer alone (FIGS. 8A and 8B). 1E4 antibody treatment also improved survival rates (FIG. 8D).

(108) The experimental data provided in Examples 7 and 8 show that compositions comprising agonist c-Met antibodies as described herein can be used to treat subjects suffering from disorders involving neurological cells.

(109) The potential role of HGF and c-Met in neuronal systems have been summarized in Funakoshi and Nakamura, 2011, Current Signal Transduc Ther, 6:156-167. As an example, studies have shown the following. Mutations in the HGF and c-Met genes have been associated with autism, schizophrenia and nonsyndromic hearing loss. Increased serum HGF levels have been associated with efficacy of antidepressant therapy in patients with panic disorder. HGF has been shown to act as a potent cerebroprotective agent for functional recovery after ischemic brain injuries. HGF has been shown to prevent neuronal cells death by inhibiting apoptosis. HGF has been shown to have beneficial effects on motor neurons in vitro and in vivo and such effects have been considered as indicative of potential therapeutic value in treating amyotrophic lateral sclerosis (ALS). Beneficial effects have been reported for various studies which increased HGF levels in the hippocampus of animals suggesting a therapeutic role for a c-Met agonist in treating Alzheimer's disease. Additionally, neurotrophic effects of HGF in primary midbrain dopaminergic neurons and beneficial effects of a c-Met agonist on Parkinson's disease have been reported. Application of exogenous HGF genes into the injured spinal cord promoted survival of motor neurons and reduced the size of damaged area supporting the potential use of a c-Met agonist antibody to treat spinal cord injury.

(110) As activation of c-Met has been associated with a diverse array of beneficial effects on neuronal disease or damage, In practicing the method of treatment or use of the present disclosure, a therapeutically effective amount of an agonist c-Met immunoglobulin is administered to a subject afflicted with an indication which is a neuronal disease, disorder, or injury. Such indications include but are not limited to ischemic brain injury, Alzheimer's disease, Parkinson's disease, amyotrophic lateral sclerosis, spinal cord injury, multiple sclerosis, seizure, hydrocephalus, retinal injury, hearing impairment, peripheral nerve injury and neuropathy, and neuropathic pain.

(111) I. Pharmaceutical Compositions

(112) In a further aspect, the present disclosure provides a pharmaceutical composition comprising an antibody or a conjugate thereof and a pharmaceutically acceptable carrier.

(113) In some embodiments, a pharmaceutical composition for treating an ischemic disorder, a stroke, a kidney injury or disease, a retinal neovascularization disorder, a neurological disorder or disease, or a wound, comprising an antibody or fragment thereof which binds to c-Met (mesenchymal-epithelial transition factor) as an active ingredient and a pharmaceutically acceptable carrier is provided, wherein the antibody comprises: an heavy chain variable domain which comprises a CDR1 of SEQ ID NO:5, a CDR2 of SEQ ID NO:6, and a CDR3 of SEQ ID NO:7; and an light chain variable domain which comprises a CDR1 of SEQ ID NO:8, a CDR2 of SEQ ID NO:9 and a CDR3 of SEQ ID NO:10.

(114) In some embodiments, the heavy chain variable domain comprises SEQ ID NO:1 and the light chain variable domain comprises SEQ ID NO:2.

(115) In some embodiments, a pharmaceutical composition for treating an ischemic disorder, a stroke, a kidney injury or disease, a retinal neovascularization disorder, a neurological disorder or disease, or a wound, comprising a scFv which binds to c-Met as an active ingredient and a pharmaceutically acceptable carrier is provided, wherein the scFv comprises: an heavy chain variable domain comprises SEQ ID NO:1 and the light chain variable domain comprises SEQ ID NO:2.

(116) In some embodiments, the scFv comprises SEQ ID NO:3.

(117) The pharmaceutical composition can be brought into contact with the body through diverse administration routes, including intravenous administration, intramuscular administration, intra-arterial administration, intramedullary administration, intrathecal administration, intracardiac administration, intravitreal administration, percutaneous administration, hypodermic administration, intraperitoneal administration, sublingual administration, subcutaneous, transdermal, and topical administration.

(118) For such clinical administration, the pharmaceutical composition of the present invention can be prepared in an adequate product using conventional techniques.

(119) Pharmaceutical formulations of an anti-c-Met antibody as described herein are prepared by mixing such antibody having the desired degree of purity with one or more optional pharmaceutically acceptable carriers (Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)), in the form of lyophilized formulations or aqueous solutions. Pharmaceutically acceptable carriers are generally nontoxic to recipients at the dosages and concentrations employed, and include, but are not limited to: buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g. Zn-protein complexes); and/or non-ionic surfactants such as polyethylene glycol (PEG). Exemplary pharmaceutically acceptable carriers herein further include insterstitial drug dispersion agents such as soluble neutral-active hyaluronidase glycoproteins (sHASEGP), for example, human soluble PH-20 hyaluronidase glycoproteins, such as rHuPH2O (HYLENEX, Baxter International, Inc.). Certain exemplary sHASEGPs and methods of use, including rHuPH.sub.2O, are described in US Patent Publication Nos. 2005/0260186 and 2006/0104968. In one aspect, a sHASEGP is combined with one or more additional glycosaminoglycanases such as chondroitinases.

(120) Active ingredients may be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions. Such techniques are disclosed in Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980).

(121) Sustained-release preparations may be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g. films, or microcapsules.

(122) The formulations to be used for in vivo administration are generally sterile. Sterility may be readily accomplished, e.g., by filtration through sterile filtration membranes.

(123) For better administration, the composition can further comprise at least one kind of pharmaceutically acceptable carrier in addition to the above-described active ingredients. Examples of such carriers include saline solution, sterile water, Ringer's solution, buffered saline solution, dextrose solution, maltodextrin (aqueous) solution, glycerol, ethanol and mixtures thereof. If needed, typical additives, such as, an antioxidant, a buffer, a bacteriostatic agent and the like, can be added. Moreover, the composition can be pharmaceutically produced for injection in the form of an aqueous solution, suspension, emulsion and so forth by adding more additives, such as, a diluting agent, a dispersing agent, a surfactant, a bonding agent and a lubricant.

(124) J. Dosing

(125) Effective dosages and schedules for administering the 1E4 c-Met antibody may be determined empirically, and making such determinations is within the skill in the art. Those skilled in the art will understand that the dosage of the agent that must be administered will vary depending on, for example, the subject which will receive the agent, the route of administration, the particular type of agent used and other drugs being administered to the subject. For example, guidance in selecting appropriate doses for antibodies is found in the literature on therapeutic uses of antibodies, e.g., Handbook of Monoclonal Antibodies, Ferrone et al., eds., Noges Publications, Park Ridge, N.J., (1985) ch. 22 and pp. 303-357; Smith et al., Antibodies in Human Diagnosis and Therapy, Haber et al., eds., Raven Press, New York (1977) pp. 365-389. A typical dose of the agent used alone might range from about 0.01 mg/kg to up to 500 mg/kg of body weight or more per day, or from about 0.01 mg/kg to about 50 mg/kg, or from 0.1 mg/kg to about 50 mg/kg, or from about 0.1 mg/kg to up to about 10 mg/kg, or from about 0.1 mg/kg to up to about 5 mg/kg, or from about 5 mg/kg to up to about 10 mg/kg or from about 0.2 mg/kg to about 1 mg/kg, depending on the factors mentioned above.

(126) The dosing schedules for administration of a 1E4 antibody include, but are not limited to, once daily, three-times weekly, twice weekly, once weekly, three times, twice monthly, once monthly and once every other month.

IV. EXAMPLES

(127) The following examples are illustrative in nature and are in no way intended to be limiting.

Example 1

Preparation of a c-Met Antibody

(128) The 1E4 IgG1 antibody used in the Examples below was generated by recombinant expression in HEK-293T cells. A pIgGHD vector (Aprogen, South Korea) was constructed to contain the nucleic acid encoding the full-length 1E4 antibody heavy chain and a separate pIgGLD vector (Aproge, South Korea) was constructed to contain the nucleic acid encoding the full-length 1E4 antibody light chain. The nucleic acids encoding the heavy and light chain variable domains of the 1E4 antibody had been obtained from ScFv polypeptides generated by biopanning of a phage display library. This generation of the 1E4 heavy and light chain variable domains is described in PCT Application No. PCT/KR2015/007899, the contents of which are incorporated herein by reference in their entirety. The 1E4 light chain variable domain has the amino acid sequence described herein as SEQ ID NO:2 and the 1E4 heavy chain variable domain has the amino acid sequence described herein as SEQ ID NO:1. The nucleic acid encoding the 1E4 light chain variable domain was ligated to the pIgGLD vector which had been digested with the SfiI endonuclease, and the nucleic acid encoding the 1E4 heavy chain variable domain was ligated to the pIgGHD vector which had been digested with the SfiI endonuclease. recombinantly express the full length 1E4 antibody used for the examples below, the pIgGHD vector was digested with the SfiI endonuclease and the pIgGLD vector was digested with the BstXI endonuclease. To produce the 1E4 IgG antibody, HEK-293T cells were co-transfected with equal amounts of the light chain and heavy chain expression vectors.

(129) The co-transfected cells were incubated in serum free medium free style 293 media (37C, 5% CO.sub.2) then the media was collected. 1E4 IgG antibody was purified from the media supernatant by protein A affinity chromatography (GE healthcare, US), following the manufacturer's protocol: the supernatant was equilibrated with 20 mM sodium phosphate (pH 7.0) and 100 mM NaCl, injected into a protein A column, the column was washed with 20 mM sodium phosphate (pH 7.0), 1 mM EDTA, 500 mM NaCl, then the antibody was eluted from the column with 0.1 M Glycine-HCl (pH 3.3) containing 100 mM NaCl. The eluted protein was neutralized with 1M Tris solution. The neutralized protein was then mixed with 5 mM sodium phosphate (pH 6.0) at a 1:1 ratio then injected into a prepacked SP-sepharose column (GE healthcare) equilibrated with 5 mM sodium phosphate (pH 6.0) containing 50 mM NaCl. The column-bound protein was eluted using sodium phosphate buffer (pH 7.0) containing 50 mM NaCl, and the unbound protein was obtained from a prepacked Q-sepharose column (GE healthcare) that had been equilibrated with release buffer. The protein eluate was concentrated with 30 kDa vivaspin20 (Sartorius) and dialyzed with PBS.

Example 2

Effects of Anti c-Met Agonist Antibodies on Wound Healing

(130) The ability of the 1E4 antibody to promote wound healing in an animal was studied. Under sterile condition, mice (Balb/C, 8-week-old female) were anesthetized. After depilation of the dorsal fur, 6 mm circular wounds were made on either side of the dorsal skin of the mice using a 6 mm biopsy punch (Integra Miltex, cat #11L48). In order to preserve the original form of the wound and measure a wound-healing effect of the test substance more accurately, the wound site was bonded and sealed with the wound splint (inner diameter 7 mm, Grace Bio-Labs, Cat #1213138) as described in Galiano et al. (Wound Repair Regen July-August; 12(4):485-92, 2004; also see Li et al., J Diabetes Res 2015:512959, 2015). 20 l of PBS (for control) or 1E4 was evenly applied to the wound area in different doses (3 g, 6 g, 12 g per wound per day) using a micropipette. The wound site was then covered with TegaDerm (3M, Cat #2016-07PK) to protect the injured area. PBS or doses of 1E4 were administered daily for 14 days. Images were captured every 2 to 3 days to analyze the progression of wound closure.

(131) Photographs of the wound before and during treatment are provided in FIG. 1A. Corresponding measurements of wound closure are provided in the graph shown in FIG. 1B. As illustrated in FIGS. 1A and 1B, the anti c-Met antibody efficiently reduced the wound area by at least 20% more than PBS at all doses of the antibody. Accordingly, the anti c-Met antibody is effective in enhancing the wound healing process.

Example 3

Renoprotective Effects of Anti c-Met Agonist Antibodies

(132) The anti-cancer drug adriamycin (ADR) has been reported to be nephrotoxic, and when administered to mice, levels of both blood urea nitrogen (BUN) and creatinine in blood increase due to the resulting kidney damage, as many studies have demonstrated (Rossmann et al. J Pathol. 169 (1):99-108, 1993; Wang et al.; Kidney Int. 58(4):1797-1804, 2000; Okuda et al Kidney Int 29, 502-510, 1986). Studies were done to test the ability of an agonist anti c-Met antibody to protect the kidneys from damage such as that caused by a chemotherapeutic.

(133) Prior to administration of the 1E4 antibody, BALB/c mice (6-week-old males) underwent an acclimatization period for one week. Afterwards, PBS (control) or different doses of 1E4 (2 mg/kg, 5 mg/kg, and 10 mg/kg) were administered through tail-vein injections (Day 1). The next day (Day 0), kidney injury was induced by a single tail injection of 15 mg/kg of ADR in all animals. Two and five days after ADR injection (Days 2 and 5, respectively), PBS or corresponding doses of 1E4 were intravenously administered to the mice, respectively. On Day 7 post-ADR injection, all animals were sacrificed, and blood samples were collected to assess BUN and creatinine levels in the blood. Then the abdomen was surgically opened and a kidney was excised and fixed in 4% formaldehyde. Several slides from each kidney were prepared and stained with hematoxylin and eosin (H&E) for routine histological examination using a light microscope.

(134) The administration of 5 mg/kg or more of the 1E4 antibody effectively reduced the increasing levels of BUN (FIG. 2A) and creatinine (FIG. 2B) in the animal model of ADR-induced kidney injury. Also, 1E4 administration at doses of 5 mg/kg and 10 mg/kg were observed to significantly improve the histologic impairment in the kidney. Images of renal H & E-stained sections are shown for tissues from naive animals, animals treated with PBS, and animals treated with 10 mg/kg 1E4 antibody (FIG. 3A). The histology analysis included assigning scores to the imaged tissues as shown in FIG. 3B. Score of 1 means the injured area is below 10% of the whole kidney tissue; score of 2 means the injured area is between 10-40% of the whole kidney tissue; score of 3 means the injured area is between 40-70% of the whole kidney tissue; score of 4 means the injured area is more than 70% of the whole kidney tissue. The asterisk indicates a significant difference at p<0.05 compared to treatment with PBS (no antibody). While an image for tissue from animals treated with 5 mg/kg 1E4 antibody is not provided here, histological analysis of these animals showed that tissue from animals treated with 5 mg/kg 1E4 antibody had a score of 2.44 with a significant difference of p<0.05, showing that both 5 mg/kg and 10 mg/kg 1E4 is effective in reducing ADR-induced kidney injury.

Example 4

Anti-Fibrotic Effects of Anti c-Met Agonist Antibodies

(135) Unilateral ureteral obstruction (UUO) is a well-described model of renal fibrosis, a pathological hallmark of chronic kidney disease (Klahr et al. Am Physiological Soc, Vol. 283 no. 5, F861-F875, 2002; Klahr et al Nephrology Forum, Kidney Int 54:286-300, 1998). Accordingly, this animal model was used to study the effects of anti c-Met antibodies having agonist effects on fibrotic lesions in kidneys.

(136) A day before UUO surgery, 10 mg/kg of 1E4 was injected into the tail vein of BALB/c mice. The next day, UUO surgery was performed under sterile conditions. A midline incision was made in the abdomen, and the left ureter was ligated at two points. Afterwards, the proximal segment between the two ligation points was excised. After the dissection, the abdomen was closed. Thereafter, 1E4 was administered weekly through tail vein. At 3 weeks after surgery, the left kidney was removed and fixed in 4% formaldehyde. Then, the area of the fibrotic lesion in the tissue samples was evaluated by Masson's trichrome staining and imaging of the renal sections.

(137) Images of the Masson's trichrome staining are provided in FIG. 4A with the corresponding quantitative analysis depicted in FIG. 4B. As shown in FIGS. 4A and 4B, administration of 1E4 is therapeutically effective in protecting the kidney from renal fibrosis.

Example 5

Treatment of Ischemic Stroke Using Anti c-Met Agonist Antibodies

(138) The middle cerebral artery occlusion model (MCAO) is a widely utilized model in the research field of stroke. This model serves as an excellent tool to investigate underlying mechanisms of ischemic stroke and a therapeutic effect of a test substance or drug to treat the disease. (Badr et al. Am Physiological Soc, Vol. 280 no. 3:R766-R770, 2001; Zhao et al Blood, 114(15):3329-3334, 2009). Studies were performed to test the ability of the anti c-Met agonist antibody 1E4 to minimize tissue damage due to ischemic stroke or other ischemia related disorders.

(139) The study was performed in Wistar rats (7 weeks old). A day before the induction of MCAO, 10 mg/kg of 1E4 was administered to the rats through the tail vein. The following day, the animals were anesthetized and the fur on the ventral neck region was shaved off. After the depilation, each rat was placed in a supine position. A midline incision was made above the right clavicle. The right common carotid artery (CCA) was identified and segregated from the neighboring vagus nerve. The distal branches of CCA ascending from the heart were loosely tied with a 2-0 silk. Generally, the common carotid artery bifurcates into two branches, the external carotid artery (ECA) and internal carotid artery (ICA). The ECA was tightly ligated at two points using the silk, while the ICA was loosely knotted. Subsequently, the ECA was cut between the knots. A 4-0 nylon probe with its front portion coated with silicon was inserted into the severed blood vessel for 30 minutes. After removal of the probe, the insertion site was completely sutured. 1 hour after the induction of MCAO, 10 mg/kg of 1E4 was injected intravenously using an infusion pump. Another intravenous administration of the same dose of 1E4 was performed 3 days after MCAO induction. Thereafter, 1E4 of the same dose was injected at intervals of 7 days, on Day 10, 17, and 24. The extent of infarction was quantified using an MRI (MAGNETOM ESSENZA 1.5 Tesla, SIEMENS Co., Germany) on Day 3, 7, 14, 21, and 28 after surgery.

(140) The effects as measured by MRI are shown as the measurement of infarct size in animals which were untreated or treated with PBS or 1E4 (FIG. 5). The data show that 1E4 effectively reduces brain damage caused by ischemia in the MCAO model.

Example 6

Treatment of Neovascular Retinal Diseases Using Anti c-Met Agonist Antibodies

(141) The laser-induced choroidal neovascularization model (CNV) provides an excellent platform to examine a therapeutic effect of a drug on the pathogenic neovascularization in retina. (Marano et al. Gene Therapy, 12, 1544-1550, 2005; Zhan et al. Arch Ophthalmol, October; 127 (10): 1329-35, 2009). The CNV model was thus used to study effects of an anti c-Met agonist antibody on retinal neovascularization.

(142) After undergoing papillary dilation with the topical application of Mydriacyl Eye Drops 1%, Chinchilla rabbits (male, 2-2.5 kg, colored) were anesthetized. A laser system (Elite, Lumenis, USA) was used to induce photocoagulation (532 nm wavelength, 150 mW power, 0.1 second duration) in the eye. Consequently, a total of 6 photocoagulation spots were created in the six o'clock position around the optic nerve. On the day of CNV induction, 50 g of 1E4 was directly administered to the vitreous humor. On Day 0, 3, 7, 10, and 14, the animals were subjected to anesthesia after the instillation with Mydriacyl Eye Drops 1% to the right eye. The animals received 1 ml of 2% fluorescein sodium salt solution through a tail-vein injection. The fundus was visualized with an opthalmoscope (TRC-50IX, TOPCON, Japan), and images were captured within two minutes after the injection. CNV formation and efficacy of the drug were determined by measuring of the extent of diffusing fluorescence in fundus photography. Fundus images were assessed using the ImageJ software (NIH, Bethesda, Md.) to quantify the fluorescence intensity in the region with CNV. In every image, the fluorescence intensity in the region with normal blood vessels or no blood vessels was converted into the same value. The change in the final CNV value was obtained by comparing each value to that of the naive control.

(143) The data analysis is provided in FIG. 6 and shows that the 1E4 antibody has inhibitory effects on laser-induced CNV formation.

Example 7

Treatment of Neuronal Diseases Using Anti c-Met Agonist Antibodies

(144) Schwann cells are known to play important roles in various aspects of the nervous system such as the nerve development, conduction (through myelination), and regeneration. Under pathological conditions, Schwann cells migrate to re-myelinate damaged nerves (Whalley Katherine, 2014, Nat Rev Neurosci.; 15(11):698-99, 2014; Jessen K R et al., 2015, Cold Spring Harb Perspect Biol.; 7(7):a020487, 2015). To examine the impact of the anti-c-Met antibody 1E4 on Schwann cell migration, Rat Schwann cells (iSC) were cultured in complete medium containing Dulbecco's modified eagle's medium supplemented with 10% fetal bovine serum (FBS), glutamine, penicillin/streptomycin, and HEPES. For the migration assay, the Transwell (Corning, 3422) inserts were coated with 0.1% gelatin (Sigma, G1393) for 45 min in cell incubator (37 C. and 5% CO.sub.2). Rat Schwann cells were seeded onto the upper compartments of the Transwell system in 100 ul of complete medium after digestion by 0.25% trypsin-EDTA. The bottom chambers were filled with 600 l of full growth medium with 2% FBS. The Transwell system was then incubated for 50 min at 37 C. and 5% CO.sub.2 for the cells to settle down. Subsequently, the growth medium at the bottom chambers was supplemented with 50 ng/ml recombinant human HGF (R&D systems, 294-HGF-025/CF) or different concentrations of 1E4 as follows: 900 ng/ml, 450 ng/ml, 90 ng/ml, and 18 ng/ml. Cell migration across the Transwell filter was allowed to proceed for 4 hr. Cells on the Transwell inserts were fixed with 4% formaldehyde overnight at 4 C. After fixation, cells were stained with 0.2% crystal violet with the non-migrated cells on the top of the filters removed with a cotton swab. Five images were taken using Olympus microscope to count the number of migrated cells and determine an average for the filter.

(145) As shown in FIGS. 7A and 7B, 1E4 at all indicated concentrations significantly increased migration of Schwann cells as compared to cells treated with PBS (no 1E4).

Example 8

Treatment of Amyotrophic Lateral Sclerosis Using Anti c-Met Agonist Antibodies

(146) B6SJL-Tg (SOD1-G93A) mice expressing human mutant SOD1 are transgenic animals which are an accepted animal model for evaluating therapeutic efficacy of a drug for treating ALS: (Ji-Seon Seo et al, Exp Neurobiol., December; 24(4): 341-350, 2015; Gurney M E et al., Science., 264:1772-1775, 1994) and other neuromuscular disorders. Accordingly, studies were done to test the effects of 1E4 antibody administration on the onset of ALS symptoms in the model animals. Based on behavioral assessment with the Rotarod, the mice were divided into groups. After classification, 1E4 was intra-thecally administered at 20 g per mouse. One week later, each mouse received 10 mg/kg of 1E4 through intra-peritoneal injection. This alternate treatment of intra-thecal and intra-peritoneal 1E4 injection was continued for the following 2 weeks. After that 2 week period, 10 mg/kg of 1E4 was only peritoneally administered to the mice every week until the end of the experiment. Motor function was measured with the Rotarod and grip strength tests once per week and survival was monitored three times per week.

(147) After the fourth week, when the onset of ALS-related symptoms are expected to appear, the mice started to show an improved motor function in response to 1E4 administration (FIGS. 8A and 8B) as compared to treatment with PBS alone. Also, 1E4 treatment increased the survival of the mice (FIG. 8D).

(148) While a number of exemplary aspects and embodiments have been discussed above, those of skill in the art will recognize certain modifications, permutations, additions and sub-combinations thereof. It is therefore intended that the following appended claims and claims hereafter introduced are interpreted to include all such modifications, permutations, additions and sub-combinations as are within their true spirit and scope.