WNT6 AS GLIOBLASTOMA ONCOGENIC BIOMARKER, AND USES OF INHIBITORS THEREOF
20210041443 · 2021-02-11
Inventors
- Bruno Filipe MARQUES DA COSTA (Braga, PT)
- Céline SARAIVA GONÇALVES (Pico De Regalados, PT)
- Nuno Jorge Carvalho de Sousa (Porto, PT)
Cpc classification
A61K31/4709
HUMAN NECESSITIES
A61K31/192
HUMAN NECESSITIES
International classification
Abstract
The present disclosure relates to a novel biomarker for use in human glioblastoma, namely to a compound inhibiting WNT6 biomarker for the treatment of glioblastoma; preferably proneural glioblastoma, classic glioblastoma, neural glioblastoma, or mesenchymal glioblastoma. The present disclosure also relates to a WNT pathway inhibitor for use in a method of treating glioblastoma, pharmaceutical compositions and a kit for use in the treatment of glioblastoma.
Claims
1. A method of treating glioblastoma in a subject in need thereof using a WNT6 pathway inhibitor, comprising: determining the level of a WNT6 biomarker in a sample from the subject, and comparing the level of the biomarker WNT6 in the sample to a predetermined level of WNT6, wherein, if the level of the WNT6 in the sample is higher than the predetermined level of the WNT6, then the subject is administered a therapeutically effective amount of a WNT6 pathway inhibitor.
2. The method of claim 1, wherein the treatment of gliobastoma is one of a proneural glioblastoma, a classic glioblastoma, a neural glioblastoma, and a mesenchymal glioblastoma.
3. A method of treating glioblastoma in a subject in need thereof, comprising: administering a therapeutically effective amount of a compound inhibitor of WNT6 pathway to the subject, wherein the compound is selected from the group consisting of: vantictumab, GNF-1331, ipafricept, XAV-939, IWR-1, pyrivinium, DKN-01, IWP-2, WNT974, niclosamide, sulindac, NSC668036, J01-017a, PR1-724, ICG-001, Calphostin C, Toxoflavin, Xanthothricin, NCB-0846-, Cercosporin, StAX-35, NVP-TNKS656, JW74, Foxy-5, OTSA 101, CWP232291, ETC 159, Rosmantuzumab, R04929097, MK0752, PF-03084014, and combinations thereof.
4. The method of claim 3, wherein the glioblastoma is proneural glioblastoma, classic glioblastoma, neural glioblastoma, or mesenchymal glioblastoma.
5. (canceled)
6. The method of claim 3, wherein the compound is WNT974.
7. The method of claim 3, wherein the compound is administered as a pharmaceutical composition that further comprises a pharmaceutical acceptable excipient.
8. A kit for use in a method of treating glioblastoma, the kit comprising: a pharmaceutical composition comprising a compound is selected from the group consisting of: vantictumab, GNF-1331, ipafricept, XAV-939, IWR-1, pyrivinium, DKN-01, IWP-2, WNT974, niclosamide, sulindac, NSC668036, J01-017a, PRl-724, ICG-001, Calphostin C, Toxoflavin, Xanthothricin, NCB-0846 Cercosporin, StAX-35, NVP-TNKS656, JW74, Foxy-5, OTSA 101, CWP232291, ETC 159, Rosmantuzumab, R04929097, MK0752, PF-03084014, and combinations thereof, and a pharmaceutically acceptable excipient, and a biomarker of WNT pathway.
9. The kit of claim 8, wherein the biomarker is WNT6 and the compound is WNT974.
10. The method of claim 1, wherein the WNT6 pathway inhibitor is selection from the group consisting of: vantictumab, GNF-1331, ipafricept, XAV-939, IWR-1, pyrivinium, DKN-01, IWP-2, WNT974, niclosamide, sulindac, NSC668036, J01-017a, PR1-724, ICG-001, Calphostin C, Toxoflavin, Xanthothricin, NCB-0846 Cercosporin, StAX-35, NVP-TNKS656, JW74, Foxy-5, OTSA 101, CWP232291, ETC 159, Rosmantuzumab, R04929097, MK0752, PF-03084014, and combinations thereof.
11. The method of claim 1, wherein the WNT6 pathway inhibitor is WNT974.
12. The method of claim 3, wherein the compound is WNT974 and wherein WNT6 is overexpressed in the glioblastoma of the subject.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0020] The following figures provide preferred embodiments for illustrating the description and should not be seen as limiting the scope of disclosure.
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
DETAILED DESCRIPTION
[0034] The present disclosure relates to a novel biomarker for use in human glioblastoma, namely to a compound inhibiting WNT6 biomarker for the treatment of glioblastoma; preferably proneural glioblastoma, classic glioblastoma, neural glioblastoma, or mesenchymal glioblastoma.
[0035] The present disclosure also relates to a WNT pathway inhibitor for use in a method of treating glioblastoma, pharmaceutical compositions and a kit for use in the treatment of glioblastoma.
[0036] In an embodiment, while high WNT6 expression levels were observed in different human cancer cell lines (1, 5), little is known about its specific role in tumors, particularly in GBM. In order to address this, first the gene expression array data from normal brains, lower-grade gliomas (LGG, WHO grades II and III) and GBM (WHO grade IV) patients deposited in TCGA were analysed. When compared to non-tumor samples, WNT6 was not overexpressed in any of the LGG patients (0/27), while 15.6% of GBM patients (89/572) presented high WNT6 levels (
[0037] The levels of WNT6 expression were analysed among the GBM subtypes described by Verhaak et al (classical, mesenchymal, neural and proneural) in a total of 4 independent cohorts, totalizing 201 patients from TCGA, 59 from Freije, 159 from Gravendeel and 26 from Vital datasets. High levels of WNT6 were detected with no significant differences in subsets of patients of each GBM molecular subtype in all datasets (
[0038] In an embodiment, to address whether WNT6 expression influences typical cancer hallmark features of GBM cells, WNT6 expression was silenced in U373MG and SNB19 cell lines by shRNA (
[0039] It was also tested whether WNT6 expression may have an impact in the resistance of GBM cells to clinically-relevant therapies, including temozolomide (TMZ) chemotherapy and radiation. Interestingly, both U373 and SNB19 WNT6-silenced GBM cells were significantly more sensitive to TMZ mediated cell death than control cells (
[0040] In an embodiment, due to the critical roles of GBM stem cells (GSC) in the pathophysiology and clinical outcome of GBM patients, it was investigated how WNT6 may affect GBM cells' sternness. Interestingly, WNT6-silenced U373 and SNB19 cells showed prominent decreased levels of NESTIN and SOX2 proteins, two common markers of GSCs (
[0041] In an embodiment, in addition to sphere-based stem cell assays, it was also tested U373 and SNB19 cells cultured under specific adherent conditions that allow GSC expansion (neurosphere medium supplemented with B27, EGF and FGF in laminin-coated wells). In these conditions, GBM cells acquired a more elongated phenotype (
[0042] To further translate the above-mentioned results to the clinical setting, it was evaluated correlations between the expression levels of WNT6 and typical stem cell-related genes in GBM patient data from TCGA. Interestingly, heatmap analyses revealed common patterns of gene expression between some stem cell-related genes and WNT6 (
[0043] In an embodiment, to pinpoint the underlying molecular mechanisms by which WNT6 influences GBM aggressiveness, the activation status of a large variety of cancer-related kinases was evaluated in U373 and SNB19 cell lines using a human phospho-kinase antibody array (
[0044] Of note, other signaling pathways were concordantly affected upon WNT6 silencing in both cell lines, but at the level of different proteins. For example, the PI3K/AKT/mTOR pathway activation was decreased in U373 cells by directly affecting the phosphorylation of activating residues of AKT and mTOR, two of the major mediators of this pathway. While these specific proteins were not significantly altered in SNB19 cells, other downstream targets of this pathway, such as p70 S6K and eNOS, showed decreased phosphorylation levels, globally resulting in similar decreased signaling of the PI3K pathway. It is also interesting to note that STAT3 phosphorylation levels were altered in WNT6-silenced U373 and SNB19 cells, but at different residues: serine 727 (S727) phosphorylation was increased in U373 cells, while tyrosine 705 (Y705) phosphorylation was decreased in SNB19 cells (
[0045] In addition to these signalling pathways concordantly affected in both cell lines, cell-line specific effects were also observed, such as alterations in the phosphorylation of JNK, GSK-3a/b, and EGFR in U373 cells, and of STAT2, STAT5a, STAT5a/b, PDGFRb, and c-Jun in SNB19 cells. Again, despite these examples of cell-specific effects, the silencing of WNT6 consistently resulted in a decreased activation status of these cancer-related pathways in GBM.
[0046] To further validate the results obtained in the phospho-kinase arrays, the phosphorylation status of 3 proteins was assessed by western blot (WB) and normalized to -tubulin (reference protein;
[0047] Together, these results suggest that WNT6 acts not only through -catenin dependent WNT signalling, but also through the activation of downstream targets of SFKs/STAT pathways, highlighting WNT6 as a critical molecule involved in a variety of crucial signaling pathways in GBM, which associate with the observed oncogenic functional effects in vitro and in vivo, and reveal putative novel targets for therapeutic interventions in WNT6-high GBMs. Thus, WNT6 acts through -catenin-dependent WNT signaling and activates downstream targets of SFKs/STAT pathways.
[0048] In an embodiment, to expand the WNT6-associated molecular mechanisms detected in vitro phosphorylation data (
[0049] Since the data demonstrated critical roles of WNT6 in GBM aggressiveness in vitro and in vivo, and its association with GBM's key signaling pathways, it was also investigated the clinical significance of WNT6 expression in a variety of GBM patient datasets. In the Portuguese dataset (Hospital Braga and Hospital Santa Maria, n=51), high levels of WNT6 mRNA were significantly associated with shorter overall survival (OS) of GBM patients (p=0.032; log-rank test;
TABLE-US-00001 TABLE 1 High levels of WNT6 expression are significantly associated with shorter survival of GBM patients (n = 407; microarray data). Overall survival p-value Exp(B) WNT6 expression 0.03 1.288 Age <0.0001 1.029 KPS 0.001 0.984 Gender.sup.A,B 0.037 0.771 Chemo- or Radiotherapy.sup.A,C <0.001 0.192 .sup.AGender and Chemo- or Radiotherapy was used as categorical variables; .sup.BFemale (n = 154) vs Male (n = 253); .sup.CTreatment (n = 383) vs No treatment (n = 24).
[0050] Together, these results suggest that WNT6 expression may be a new prognostic factor useful for the stratification of GBM patients.
[0051] In physiological conditions, the WNT pathway controls cell fate, proliferation, migration, polarity and death. Deregulated WNT pathway has been reported in several cancers, including GBM, and has been implicated in promoting resistance to current therapies. This increased resistance has been attributed to stem-cell features sustained by WNT signaling, such as increased proliferation and migration, and decreased adhesion. Although the importance of the WNT pathway has been explored in several tumor types, little is known about WNT6 in cancer (1-4). Indeed, to the best of our knowledge, this is the first study focusing on the roles and mechanisms of WNT6 in human gliomas. Due to its critical function during embryogenesis, deregulated expression of WNT6 in adults may favor tumorigenesis.
[0052] This is the first comprehensive study dissecting the functional roles and underlying molecular mechanisms mediated by WNT6 activation in human GBM, establishing it as a clinically-relevant prognostic biomarker (
[0053] Considering the global effects of WNT6 in GSC phenotypes (
[0054] Taking into consideration that (i) the first step for designing novel therapeutic strategies requires not only the identification of new molecular targets, but also the understanding of their functional mechanisms, and (ii) nothing was still known on WNT6-mediated signaling mechanisms in GBM or any other cancer type, our phospho-kinase arrays provide the first data on the activation status of several cancer-related pathways that may be regulated by WNT6 (
[0055] In summary, this work provides significant contributions to the neuro-oncology field, profiting from the understanding of WNT6-mediated signalling pathways and from the portrayal of the functional roles and clinical value of WNT6 in GBM, potentially impacting on the prognostic stratification and aiding in rationale treatment decisions for GBM patients.
[0056] All gene expression data from TCGA samples hybridized by the University of North Carolina, Lineberger Comprehensive Cancer Center, using Agilent G4502A 244K, were downloaded from TCGA (https://portal.gdc.cancer.gov/), including 572 GBMs, 27 LGGs, and 10 unmatched non-tumoral patient samples. To prevent duplicated entries from the same patientwhen more than one portion per patient was availablethe median expression value was used. Three probe sets hit WNT6 gene (A_23_P119916, A_32_P159877 and A_24_P208513). The provided value was pre-processed and normalized according to level 3 specifications of TCGA. WNT6 overexpression in glioma samples was considered when higher than in non-tumoral samples (level 3 value 0.41). Clinical data of each patient was provided by the biospecimen core resources and includes information about patients' age at diagnosis, gender, KPS and days to death and to last follow-up.
[0057] WNT6 expression microarray data from Freije (n=59), Gravendeel n=159, and Vital (n=26) datasets of GBM patients were obtained in the GlioVis data portal. The top 17% of tumors expressing highest levels of WNT6 were classified as WNT6-high in Freije (n=10/59) and Gravendeel (n=27/159) datasets, similarly to the cutoff used for TCGA, and the top 39% for the Vital (n=10/26) dataset due to the small number of patients. Clinical data included GBM subtype classification, OS and vital status of the patients.
[0058] Glioma tumor specimens were obtained from patients who performed a craniotomy for tumor removal or stereotaxic biopsy at 4 different hospitals: Hospital Braga (HB), Hospital Santa Maria (HSM, Centro Hospitalar Lisboa Norte; samples requested from Biobanco-iMM, Lisbon Academic Medical Center, Lisbon, Portugal) and Hospital Santo Antonio (HSA, Centro Hospitalar Porto), Portugal, and Hospital de Cancer de Barretos, Brazil. Samples from HB and HSM were reserved for RNA-based studies, transported in dry ice to the lab and stored at 80 C. Samples from HSA and Brazil were formalin-fixed and paraffin-embedded and used for IHC analysis. Samples from Brazil were organized in triplicates into tissue microarrays (TMAs). Tumors were classified according to WHO 2007 and only patients with glial tumor histological diagnosis were included in the study.
[0059] Tissues sections for immunohistochemistry were deparaffinized and rehydrated by xylene and ethanol series. Sodium citrate buffer (10 mM, 0.05% Tween 20, pH 6) was used for antigen retrieval. Endogenous peroxidase activity was blocked with 3% H.sub.2O.sub.2 in TBS 1 for 10 min. Immunohistochemical staining was performed using the LabVision kit (UltraVision Large Volume Detection System Anti-polyvalent, HRP) according to the manufacturer's instructions. WNT6 (#ab50030, abcam; 1:450), Ki-67 (#550609, BD Biosciences; 1:200), Cyclin D1 (#2978, Cell Signaling; 1:100), SOX2 (#AB5603, EMD Millipore; 1:500), Nestin (#MAB5326, EMD Millipore; 1:100) and BCL2 (#2870, Cell Signaling; 1:200) antibodies were used. Concerning Ki-67 staining, before antigen retrieval, tissues were permeabilized using TBS-Tween 0.5%, for 10 min. DAB substrate (DAKO) was used as chromogen, followed by counterstaining with hematoxylin. The TMA from Brazil patients was blind-scored by a pathologist based on WNT6 staining intensity: 1=weak, 2=moderate and 3=strong. The average of the triplicate spots was calculated and used for the survival analysis. An average above 2 was considered as WNT6 high expression.
[0060] Human GBM cell lines U373MG and U87MG (kindly provided by Dr. Joseph Costello, University of California, San Francisco) and SNB19 (obtained from German Collection of Microorganisms and Cell Cultures) were cultured in DMEM (Biochrom) supplemented with 10% Fetal Bovine Serum (FBS; Biochrom). Cells were maintained in a humidified atmosphere at 37 C. and 5% (v/v) CO.sub.2. These conditions were maintained throughout the studies, unless otherwise stated. Testing for mycoplasma contamination was performed every month.
[0061] In an embodiment, the WNT6-silencing by shRNA in GBM cells was carried out as follows. U373MG and SNB19 cell lines were plated at 70 000 cell/well (24-well plate) and 100000 cells/well (12-well plate), respectively. Cells were transfected with WNT6 gene specific shRNA expression vector inserted in a pRS plasmid (TR308360, clones TI333434 and TI333435 from Origene; named U373 shWNT6 or SNB19 shWNT6, respectively) or with a scrambled negative control non-effective shRNA in a pRS plasmid (TR30012, Origene; named U373 shCtrl or SNB19 shCtrl). Lipofectamine 3000 (Invitrogen) transfection reagent was used according to manufacturer's recommendations (ratio plasmid/lipofectamine, 1:2.5). Stable transfection was achieved by selecting transfected clones with puromycin (1 g/mL).
[0062] In and embodiment, the WNT6 overexpression in GBM cells was carried out as follows. U87MG cells were plated at 200 000 cell/well (6-well plate). Cells were transfected with the pcDNA-Wnt6 vector (gift from Dr. Marian Waterman; Addgene plasmid #35913) or with the respective empty vector (pcDNA3.2 GW delCMV; gift from Dr. Edward Hsiao; Addgene plasmid #29496). Lipofectamine 3000 (Invitrogen) transfection reagent was used according to manufacturer's recommendations (4 L of Lipofectamine 3000 per 1 g of DNA). Stable transfection was achieved by selecting transfected clones with geneticin (800 g/mL).
[0063] In an embodiment, the qRT-PCR was carried out as follows. Total RNA was extracted from GBM patients' tissues and cell lines using the TRIzol method (Invitrogen) and cDNA from 1 g of the total RNA was then synthesized (RT-Phusion Kit, Thermo Scientific). The levels of WNT6 and TBP (reference gene) were assessed by quantitative reverse transcription-PCR (qRT-PCR; KAPA SYBR FAST qPCR Kit, KAPABIOSYSTEMS or PowerUp SYBR Green Master Mix, ThermoFisher Scientific, for cell lines and GBM patient's samples, respectively) with the following sets of primers: WNT6 Fwd 5-GACGAGAAGTCGAGGCTCTTT-3 and Rev 5-CGAAATGGAGGCAGCTTCT-3; TBP Fwd 5-GAGCTGTGATGTGAAGTTTCC-3 and Rev 5-TCTGGGTTTGATCATTCTGTAG-3. The annealing temperature was 60 C. for both. Levels were determined based on the 2-ct method.
[0064] In an embodiment, the immunofluorescence (IF) studies were carried out as follows. U373 (shCtrl/shWNT6) and SNB19 (shCtrl/shWNT6) cells were plated in coverslips in DMEM supplemented with 10% FBS. Cells were fixed with paraformaldehyde 4% and then incubated in 1% BSA in PBS0.1% Tween for 1 hour. Afterwards, cells were incubated overnight at 4 C. with the primary antibody against WNT6 (ab50030, abcam; 1:1 000) or SOX2 (AB5603, EMD Millipore, 1:300). Alexa Fluor 594 goat anti-rabbit IgG (H+L; A-11012, ThermoFisher Scientific) secondary antibody was used at a dilution of 1:1 000 for 1 hour, at room temperature (RT), in the dark. Additionally, SOX2-coverslips were incubated with anti-NESTIN primary antibody (MAB5326, EMD Millipore, 1:100), for 1 hour at RT, in the dark. Next, Alexa Fluor 488 goat anti-mouse IgG (H+L; A-11001, ThermoFisher Scientific) secondary antibody was used at a dilution of 1:1 000 for 1 hour, at RT, in the dark. DAPI (VECTASHIELD Mounting Medium with DAPI, Vector Laboratories) was used to stain the cell nucleus (blue) at a concentration of 1.5 g/m L.
[0065] In an embodiment, cell viability assays were carried out as follows. Cell viability was determined 6 days after plating by both trypan blue and MTT (U373 and SNB19 cells) or MTS (U87 cells) assays. For trypan blue assay, cells were plated, in triplicate, at an initial density of 20 000 cells/well in 6-well plates. For MTT/MTS assay, U373 and SNB19 transfected cells were plated in 12-well plates, in triplicate, at an initial density of 6 000 (for U373 and U87 cells) or 10 000 cells/well (SNB19). For the MTT assay, cells were incubated with 0.5 mg of MTT (ThermoFisher Scientific) per mL of PBS 1, during up to 2 hours in a humidified atmosphere at 37 C. and 5% (v/v) CO.sub.2. Subsequently, the formed crystals were dissolved using an acidified isopropanol solution (0.04 M HCl in isopropanol), and the absorbance was read at 570 nm. For the MTS assay, cells were incubated with 10% of the MTS solution (CellTiter 96 AQueous One Solution Cell Proliferation Assay; Promega) in DMEM supplemented with 10% FBS, during up to 1 h in a humidified atmosphere at 37 C. and 5% CO.sub.2. Absorbance was recorded at 490 nm.
[0066] In an embodiment, cell proliferation was carried out as follows. Cell proliferation was evaluated based on the measurement of BrdU incorporation during DNA synthesis (Cell Proliferation ELISA, BrdU colorimetric assay, Roche), as recommended by the manufacturer. Briefly, cells were cultured in DMEM (Gibco) supplemented with 10% FBS (Biochrom) in 96-well plates (cell density: 2 000 cells/well) for 4 days. After that, BrdU was added to the cells and they were re-incubated for 4 hours.
[0067] In an embodiment, the cell migration was carried out as follows. Ibidi 2-well inserts (Ibidi) with a cell-free gap were used in 12-well plates to evaluate cell migration by wound healing assay. U373 and SNB19 transfected cells were plated in triplicate, at an initial density of 70 000 and 60 000 cells in each side of the insert, respectively, and left to adhere overnight. After that, inserts were removed (0 hours' timepoint) and wells were washed with PBS to remove dead cells and debris. The migration of the cells into the gap was imaged (2 images/well) over hours until the wound closure was achieved (images were captured at the same localizations over time). The gap size (pixels) was measured using an automated software (beWoundCell Migration Tool, v1.7, BESURG, Portugal; www.besurg.com) and manually verified and corrected when deemed necessary. At least 15 lines equally-spaced across the image and perpendicular to the gap main axis were used for increased measurement representativeness.
[0068] In an embodiment, cell invasion studies were performed as follows. Cell invasion was assessed using the BD BioCoat Matrigel Invasion Chambers (Corning) as recommended by the manufacturer. Briefly, cells were seeded into the top (insert) at the initial density of 50 000 cells/well (U373 and SNB19) or 25 000 cells/well (U87; 24-well chambers) in DMEM (Gibco) supplemented with 1% FBS. EGF was added to the medium of the lower chamber (DMEM supplemented with 10% FBS) at the concentration of 20 ng/mL, as chemoattractant. Cells were incubated for 22 hours. Henceforth, cells that invaded through the membrane were stained using VECTASHIELD Mounting Medium with DAPI (Vector Laboratories) and a picture from the entire membrane was obtained using the Olympus Upright BX61 microscope. The total cell number was counted with the help of the ImageJ software (version 1.49).
[0069] In an embodiment, cell death studies were carried out as follows. Cell death was evaluated after 6 days of treatment with TMZ (400 M and 800 M, for U373 and SNB19 transfected cells, respectively). TMZ treatment was applied 24 hours after plating and was renewed 2 days after. Cells were stained with Annexin V-FITC (BD Bioscience) and propidium iodide (PI; TermoFisher Scientific), according to manufacturer's protocol, followed by flow cytometry analysis. A total of at least 10 000 events were acquired. Results were analyzed using the FlowJo software (version 10).
[0070] In an embodiment, for clonogenic cell survival assay, cells were seeded at a density of 1 000 to 2 000 per 25-cm.sub.2 flask, in triplicates. Twenty-four hours after seeding, irradiation was performed at RT in single exposure doses, delivered by a Novalis TX linear accelerator, with a nominal energy of 6 MV at a dose rate of about 400 cGy/min. Doses of 2 and 4 Gy were calculated using a dedicated treatment planning system to a depth of water of 1.5 cm. The plating efficiency (PE) represents the percentage of seeded cells that grew into colonies. Colonies with more than 50 cells were counted by microscopic inspection and PE, as well as the radiation-surviving fraction (PE of experimental group/PE of control group), were determined. Survival data were obtained with data from 3 independent experiments.
[0071] In an embodiment, the cell viability assay (MTT) under stem cell conditions was carried out as follows. Culture vessels were coated with natural mouse laminin (Invitrogen) for 3 hours at 37 C. or overnight at 4 C. at 10 g/m L, as previously described. U373 and SNB19 transfected cells were plated in 12-well laminin-coated plates, in triplicate, at an initial density of 6 000 and 10 000 cells per well, respectively. Cells were cultured in DMEM-F12 (Gibco) supplemented with 1B27 (Invitrogen), 20 ng/mL of EGF (Invitrogen), and 20 ng/mL of basic fibroblast growth factor (b-FGF, Invitrogen). After 4 days in culture, cells were incubated with MTT as detailed above (section Cell viability assays).
[0072] In an embodiment, the neurosphere formation assay was carried out as follows. U373, SNB19 and U87 transfected cells were plated at the maximum density of 4 000 cells/mL in low-attachment 24-well plates (Corning). Cells were cultured in DMEM-F12 (Gibco) supplemented with 1 B27, 20 ng/mL of EGF, and 20 ng/mL of b-FGF. Neurospheres were supplemented with fresh media every 4-5 days (250 L/well). The number of neurospheres was counted after 10 days for U373 and U87 cell lines and 15 days for the SNB19 ones.
[0073] In an embodiment, the limiting dilution assay was carried out as follows. Cell numbers of U373 and U87 transfected cells were adjusted to a starting concentration of 40 000 cells/mL and 160 000 cells/mL, respectively, from which multiple serial dilutions were performed and plated in low-attachment 96-well plates (Corning). At the end, cell densities ranged from 1 000 to 1 cells per well in a final volume of 100 L for U373 cells and from 4 000 to 8 cells per well for U87 cells. Cells were cultured in DMEM-F12 (Gibco) supplemented with 1 B27, 20 ng/mL EGF, and 20 ng/mL b-FGF. Cultures were disturbed only for media supplementation every 5 days. After 15 days, the fraction of wells not containing neurospheres was determined for each condition and plotted against the initially plated cellular density. Stem cell frequencies and statistical significance were calculated using the Extreme Limiting Dilution Assay (ELDA) software available at http://bioinf.wehi.edu.au/software/elda/.
[0074] In an embodiment, the stereotactic orthotopic xenografts was performed as follows. NSG (NOD.Cg-Prkdcscid ll2rgtm1Wjl/SzJ) mice aged 4 months were anesthetized with a mixture of ketamine (75 mg/kg) and medetomidine (1 mg/kg) supplemented with Butorphanol (5 mg/kg) for its analgesic properties and placed into the digital 3-axis stereotaxic apparatus (Stoelting). A total of 510.sup.5 U373- or 210.sup.5 U87-transfected cells (resuspended in 5 L PBS 1) were injected into the brain striatum (1.8 mm medial-lateral right, 0.4 mm anterior-posterior and 2.5 mm dorsal-ventral from the bregma) using a 10 L Hamilton syringe with a point style 4 beveled 26s-gauge needle. A total of 8 male and 6 female mice per group were used for U373- and U87-transfected cells, respectively. U373 and U87 cells were used as no reports were found for SNB19 tumorigenic capacity when orthotopically injected in immunocompromised mice. Mice were maintained under standard laboratory conditions, which includes artificial 12 hours' light/dark cycle, controlled ambient temperature (211 C.) and a relative humidity of 50-60%. The confirmation of specified pathogen free health status of sentinels' mice maintained within the same animal room was performed according to FELASA guidelines. Experimental mice were always manipulated in a flow hood chamber, except during the surgery. Mice body weight was evaluated 3 times per week, while general behavior and symptomatology were registered daily. The pre-established humane endpoint was performed when mice presented severe weight loss (>30% from maximum weight). Death was used for Kaplan-Meyer representation.
[0075] In an embodiment, the human phospho-kinase antibody arrays (ARY003B; R&D systems) were used to simultaneously detect the relative levels of phosphorylation of 43 kinase phosphorylation sites and 2 related total proteins. Capture and control antibodies have been spotted in duplicate on nitrocellulose membranes. The entire protocol was done following manufacturer's recommendations. In this case, 400 g of total protein from all cell lines (U373 shCtrl/shWNT6 and SNB19 shCtrl/shWNT6) was used. The obtained chemiluminescence was measured using the ChemiDoc imaging system (Biorad). Adjusted volume per spot (i.e. average pixel intensity of the spot times its area, corrected for the background) was measured using the Quantity One image analysis software. Background was eliminated using the local option. The average of each duplicated spot was calculated, normalized to HSP60 (reference protein) and used to determine the relative change in phosphorylated kinase proteins between shCtrl and shWNT6 conditions. Two sets of arrays were performed for U373 shCtrl/shWNT6, while only 1 was used for SNB19 shCtrl/shWNT6.
[0076] In an embodiment, western blot analysis was carried out as follows. Cells were washed with PBS 1 and removed by scratch in a lysis buffer containing 50 mM Tris pH 8, 2 mM EDTA pH 7.4, 0.1% SDS, 1% NP-40 and 150 mM NaCl, inhibitors of proteases 1 (B14001, Biotool) and phosphatases 1 (B15001, Biotool). After a 15-min incubation on ice, whole cell lysate was centrifuged at 13 000g for 15 min at 4 C. The total protein concentration was determined from the obtained supernatant using the Pierce BCA protein assay kit (ThermoFisher Scientific), according to manufacturer's protocol. Protein extracts (denatured and reduced; 20 g/lane) were separated in a 10% SDS polyacrylamide gel by electrophoresis and transferred to nitrocellulose membranes (Hybond-C Extra, GE Healthcare Life Sciences), using the Trans-blot turbo transferring system (Bio-rad), following manufacturer's instructions. A protein ladder (Page ruler prestained protein ladder; Fermentas) was used to determine the approximate protein size, to monitor the progress of the electrophoretic run and the success of the transfer. Before starting the immunodetection, membranes were blocked with BSA (5% in TBS 1), for 1 hour at RT. The immunodetection was achieved using antibodies against p-STAT3 Y705 (#9145, Cell Signaling; 1:2 000), STAT3 (#9132, Cell Signaling; 1:1 000), non-p--catenin 533/537/T41 (#4270, Cell Signaling; 1:5 000), -catenin (#610153, BD Biosciences; 1:2 000), p-AKT 5473 (#4051, Cell Signaling; 1:1 000), AKT (#2920, Cell Signaling; 1:2 000), p-ERK T202/Y204 (#4370, Cell Signaling; 1:2 000), ERK (#4695, Cell Signaling; 1:1 000) and -tubulin (#sc-23948, Santa Cruz Biotechnology, 1:1 000). Blots were revealed with peroxidase-conjugated secondary anti-mouse and anti-rabbit IgG antibodies (#sc-2031 and #sc-2004, respectively, Santa Cruz Biotechnology, 1:1 000), followed by enhanced chemiluminescence (ECL) solution (SuperSignal West Femto Chemiluminescent Substrate; Thermo Scientific). The obtained chemiluminescence was measured using the ChemiDoc imaging system (Biorad). If necessary, membranes were stripped using the Restore PLUS Western Blot Stripping Buffer (Thermo Fisher Scientific), following manufacturer's recommendations. As for the phospho-kinase arrays, adjusted volume per band was measured using the Quantity One image analysis software. Phosphorylated protein values were normalized to -tubulin (reference protein).
[0077] In an embodiment, the gene set enrichment analysis (GSEA) was performed as follows. The raw expression data profile (Agilent G4502A 244K) of all GBM patients from TCGA (n=573) was extracted as detailed above. GSEA (www.broad.mit.edu/gsea/) software was then used. In this work, a continuous phenotype profile was employed to find gene sets that correlate with WNT6 (gene neighbors). Accordingly, the Pearson's correlation was used to score and rank the genes. Gene sets from the Molecular Signature Database (MSigDb) C6 collection were used. Default options were used, unless otherwise stated. Significant enrichments were considered when false discovery rate (FDR)<0.30.
[0078] In an embodiment, the statistical analyses were performed as follows. Homoscedasticity was verified with the Levene's test and differences between groups were assessed by a two-sided unpaired t-test, with the Welch's correction being applied accordingly. For the wound healing assay and radiation treatment sensitivity assay, a two-way ANOVA followed by the post-hoc Sidak's test for multiple comparison testing was used. For the TMZ treatment cell death assay, a two-way ANOVA followed by the post-hoc Tukey's test for multiple comparison testing was used. The correlation between the expressions of WNT6 and stem-related genes (from the gene ontology gene-set GO_Positive_regulation_of_stem_cell_proliferation) was calculated using the Pearson's correlation coefficient (r). The effects of WNT6 on mice OS was assessed by log-rank test. These analyses were performed with the GraphPad Prism 6.01 software (GraphPad software, Inc.).
[0079] The Chi-square test was used to assess the difference between the distributions of tumors with high and low WNT6 expression stratified for LGGs and GBMs. To evaluate the prognostic value of WNT6 expression, univariate or multivariate analysis of survival were performed using, respectively, the log-rank test or the Cox proportional hazard model, where the potential confounding effect of some variables is considered. These analyses were made with SPSS 22.0 software (SPSS, Inc.).
[0080] For all statistical tests, significance was considered when p<0.05.
[0081] The term comprising whenever used in this document is intended to indicate the presence of stated features, integers, steps, components, but not to preclude the presence or addition of one or more other features, integers, steps, components or groups thereof.
[0082] The disclosure should not be seen in any way restricted to the embodiments described and a person with ordinary skill in the art will foresee many possibilities to modifications thereof.
[0083] The above described embodiments are combinable.
[0084] The following claims further set out particular embodiments of the disclosure.
[0085] List of Sequences:
TABLE-US-00002 SEQID1:WNT6mRNA >uc002vjc.2(WNT6)length=1703 TCCGCAGGAGACACAGGCGCTGGCTGCCCCGTCCGCTCTCCGCCTCCGCC GCGCCCTCCTCGCCCGGGATGGGCCCCCCCGCCGCCGCCGGATCCCTCGC CTCCCGGCCGCCGCCGTTGCGCTCGCCGCGCTCGCACTGAAGCCCGGGCC CTCGCGCGCCGCGGTTCGCCCCGCAGCCTCGCCCCCTGCCCACCCGGGCG GCCGTAGGGCGGTCACGATGCTGCCGCCCTTACCCTCCCGCCTCGGgctg ctgctgctgctgctcctgtgcCCGGCGCACGTCGGCGGACTGTGGTGGGC TGTGGGCAGCCCCTTGGTTATGGACCCTACCAGCATCTGCAGGAAGGCAC GGCGGCTGGCCGGGCGGCAGGCCGAGTTGTGCCAGGCTGAGCCGGAAGTG GTGGCAGAGCTAGCTCGGGGCGCCCGGCTCGGGGTGCGAGAGTGCCAGTT CCAGTTCCGCTTCCGCCGCTGGAATTGCTCCAGCCACAGCAAGGCCTTTG GACGCATCCTGCAACAGGACATTCGGGAGACGGCCTTCGTGTTCGCCATC ACTGCGGCCGGCGCCAGCCACGCCGTCACGCAGGCCTGTTCTATGGGCGA GCTGCTGCAGTGCGGCTGCCAGGCGCCCCGCGGGCGGGCCCCTCCCCGGC CCTCCGGCCTGCCCGGCACCCCCGGACCCCCTGGCCCCGCGGGCTCCCCG GAAGGCAGCGCCGCCTGGGAGTGGGGAGGCTGCGGCGACGACGTGGACTT CGGGGACGAGAAGTCGAGGCTCTTTATGGACGCGCGGCACAAGCGGGGAC GCGGAGACATCCGCGCGTTGGTGCAACTGCACAACAACGAGGCGGGCAGG CTGGCCGTGCGGAGCCACACGCGCACCGAGTGCAAATGCCACGGGCTGTC GGGATCATGCGCGCTGCGCACCTGCTGGCAGAAGCTGCCTCCATTTCGCG AGGTGGGCGCGCGGCTGCTGGAGCGCTTCCACGGCGCCTCACGCGTCATG GGCACCAACGACGGCAAGGCCCTGCTGCCCGCCGTCCGCACGCTCAAGCC GCCGGGCCGAGCGGACCTCCTCTACGCCGCCGATTCGCCCGACTTCTGCG CCCCCAACCGACGCACCGGCTCCCCCGGCACGCGCGGTCGCGCCTGCAAT AGCAGCGCCCCGGACCTCAGCGGCTGCGACCTGCTGTGCTGCGGCCGCGG GCACCGCCAGGAGAGCGTGCAGCTCGAAGAGAACTGCCTGTGCCGCTTCC ACTGGTGCTGCGTAGTACAGTGCCACCGCTGCCGTGTGCGCAAGGAGCTC AGCCTCTGCCTGTGACCCGCCGCCCGGCCGCTAGACTGACTTCGCGCAGC GGTGGCTCGCACCTGTGGGACCTCAGGGCACCGGCACCGGGCGCCTCTCG CCGCTCGAGCCCAGCCTCTCCCTGCCAAAGCCCAACTCCCAGGGCTCTGG AAATGGTGAGGCGAGGGGCTTGAGAGGAACGCCCACCCACGAAGGCCCAG GGCGCCAGACGGCCCCGAAAAGGCGCTCGGGGAGCGTTTAAAGGACACTG TACAGGCCCTCCCTCCCCTTGGCCTCTAGGAGGAAACAGTTTTTTAGACT GGAAAAAAGCCAGTCTAAAGGCCTCTGGATACTGGGCTCCCCAGAACTGC TGGCCACAGGATGGTGGGTGAGGTTAGTATCAATAAAGATATTTAAACCA CCA SEQID2:WNT6protein MLPPLPSRLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGR QAELCQAEPEVVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQ DIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAPRGRAPPRPSGLPG TPGPPGPAGSPEGSAAWEWGGCGDDVDFGDEKSRLFMDARHKRGRGDIRA LVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARL LERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRT GSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVV QCHRCRVRKELSLCL
REFERENCES
[0086] 1. Yuan G, Regel I, Lian F, Friedrich T, Hitkova I, Hofheinz R D, Strobel P, Langer R, Keller G, Rocken C, et al. WNT6 is a novel target gene of caveolin-1 promoting chemoresistance to epirubicin in human gastric cancer cells. Oncogene. 2013; 32(3):375-87. [0087] 2. Fan Y, Shen B, Tan M, Mu X, Qin Y, Zhang F, and Liu Y. Long non-coding RNA UCA1 increases chemoresistance of bladder cancer cells by regulating Wnt signaling. The FEBS journal. 2014; 281(7):1750-8. [0088] 3. Zhang L, Yuan G, Fang Y, Qiu M, Lin J, Sun J, and Yang D. Increased WNT6 expression in tumor cells predicts unfavorable survival in esophageal squamous cell carcinoma patients. International journal of clinical and experimental pathology. 2015; 8(9):11421-7. [0089] 4. Galbraith R L, Poole E M, Duggan D, Muehling J, Hsu L, Makar K, Xiao L, Potter J D, and Ulrich C M. Polymorphisms in WNT6 and WNT10A and colorectal adenoma risk. Nutrition and cancer. 2011; 63(4):558-64. [0090] 5. Kirikoshi H, Sekihara H, and Katoh M. WNT10A and WNT6, clustered in human chromosome 2q35 region with head-to-tail manner, are strongly coexpressed in SW480 cells. Biochemical and biophysical research communications. 2001; 283(4):798-805.