RESPIRATORY SYNCYTIAL VIRUS (RSV) VACCINES
20210052718 ยท 2021-02-25
Inventors
- Sang-Moo Kang (Lilburn, GA, US)
- Youri Lee (Norcross, GA, US)
- Eunju Ko (Rockville, MD, US)
- Young-Man Kwon (Johns Creek, GA, US)
- Ki-Hye Kim (Atlanta, GA, US)
Cpc classification
C12N7/00
CHEMISTRY; METALLURGY
C12N2760/18522
CHEMISTRY; METALLURGY
C12N2760/18534
CHEMISTRY; METALLURGY
C12N2760/16122
CHEMISTRY; METALLURGY
A61K2039/55561
HUMAN NECESSITIES
International classification
Abstract
Disclosed are vaccines capable of achieving protection against RSV while avoiding vaccine-enhanced disease (VED). In particular, vaccine constructs have been molecularly designed and genetically engineered to comprise RSV fusion (F) protein displayed on the surface of a particle, such as a virus-like particles (VLP) and low temperature-prepared split RSV. In some embodiments, the RSV F protein is in a pre-fusion F conformation. Also disclosed a variants and combinations of split RSV and RSV F DNA vaccine with pre-fusion F and enhanced efficacy. In addition, disclosed split RSV vaccines containing pre-fusion F conformation and combination adjuvants MPL and CpG.
Claims
1. A respiratory syncytial virus (RSV) vaccine comprising a modified RSV F protein in a predominantly pre-fusion conformation (RSV pre-fusion F protein) presented on the surface of a particle.
2. The vaccine of claim 0, wherein the RSV pre-fusion F protein comprises the amino acid sequence SEQ ID NO:2 or 3 or an amino acid sequence having at least 90% sequence identity to SEQ ID NO:2 or 3.
3. The vaccine of claim 1, wherein the particle is a virus-like particle (VLP).
4. The vaccine of claim 0, wherein the RSV pre-fusion F protein is a fusion protein further comprising a membrane anchor domain of RSV or an influenza A hemagglutinin (HA).
5. The vaccine of claim 0, wherein the VLP comprises an influenza matrix protein 1 (M1).
6. The vaccine of claim 3, wherein the VLP is produced by co-infecting insect cells with one or more recombinant baculoviruses expressing the M1 proteins and the RSV pre-fusion F protein, culturing the insect cells under physiological conditions, and purifying the VLPs from insect cell culture supernatants.
7. The vaccine of claim 1, wherein the particle is a recombinant RSV virus.
8. A split respiratory syncytial virus (RSV) vaccine, wherein the vaccine is produced by inactivating and splitting an RSV virus at a temperature range of 1 C. to 37 C.
9-17. (canceled)
18. A polypeptide, comprising an RSV pre-fusion F protein having the amino acid sequence SEQ ID NO:3 or an amino acid sequence having at least 90% sequence identity to SEQ ID NO:3
19. A polynucleotide, comprising a nucleic acid sequence encoding the polypeptide of claim 0 operably linked to an expression control sequence.
20. A DNA vaccine comprising the polynucleotide of claim 19.
21. A vaccine composition, comprising the vaccine of any one of claim 1 in a pharmaceutically acceptable carrier.
22. A vaccine composition of claim 21, further comprising an adjuvant.
23. The vaccine composition of claim 22, wherein the adjuvant comprises low dose MPL+CpG, killed lactic acid bacteria, or cell wall skeleton of BCG.
24. A method of vaccinating a subject for respiratory syncytial virus (RSV) comprising administering the vaccine composition of claim 21 to a subject in need thereof.
25. (canceled)
26. The vaccine of claim 1, wherein the vaccine is produced by inactivating and splitting an RSV virus at a temperature range of 1 C. to 37 C.
27. The vaccine of claim 1, wherein the vaccine is produced by inactivating and splitting an RSV virus at a temperature range of 2 C. to 5 C.
Description
DESCRIPTION OF DRAWINGS
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
DETAILED DESCRIPTION
[0038] A vaccine against RSV is currently not available, but is desired due to the high disease burden. A safe and effective RSV vaccine should induce RSV neutralizing (NA) antibodies, control lung viral titers below the detection limit, and avoid RSV VED (no VED-prone T helper type 2 (Th2) responses). Disclosed are vaccines capable of achieving protection against RSV while avoiding vaccine-enhanced disease (VED).
Definitions
[0039] It must be noted that as used herein and in the appended claims, the singular forms a, an, and the include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to a peptide includes a plurality of such peptides, reference to the peptide is a reference to one or more peptides and equivalents thereof known to those skilled in the art, and so forth.
[0040] In this specification and in the claims that follow, reference will be made to a number of terms that shall be defined to have the following meanings:
[0041] Optional or optionally means that the subsequently described event or circumstance can or cannot occur, and that the description includes instances where the event or circumstance occurs and instances where it does not. For example, the phrase optionally a signal peptide means that the signal peptide may or may not be included. As used herein the term adjuvant refers to a compound that, when used in combination with a specific immunogen (e.g. a VLP) in a formulation, will augment or otherwise alter or modify the resultant immune response. Modification of the immune response includes intensification or broadening the specificity of either or both antibody and cellular immune responses. Modification of the immune response can also mean decreasing or suppressing certain antigen-specific immune responses.
[0042] The term carrier means a compound, composition, substance, or structure that, when in combination with a compound or composition, aids or facilitates preparation, storage, administration, delivery, effectiveness, selectivity, or any other feature of the compound or composition for its intended use or purpose. For example, a carrier can be selected to minimize any degradation of the active ingredient and to minimize any adverse side effects in the subject.
[0043] As used herein an effective amount or effective dose generally refers to that amount of the disclosed VLPs sufficient to induce immunity, to prevent and/or ameliorate an infection or to reduce at least one symptom of an infection and/or to enhance the efficacy of another dose of a VLP. An effective dose may refer to the amount of VLPs sufficient to delay or minimize the onset of an infection. An effective dose may also refer to the amount of VLPs that provides a therapeutic benefit in the treatment or management of an infection. Further, an effective dose is the amount with respect to VLPs of the invention alone, or in combination with other therapies, that provides a therapeutic benefit in the treatment or management of an infection. An effective dose may also be the amount sufficient to enhance a subject's (e.g., a human's) own immune response against a subsequent exposure to an infectious agent. Levels of immunity can be monitored, e.g., by measuring amounts of neutralizing secretory and/or serum antibodies, e.g., by plaque neutralization, complement fixation, enzyme-linked immunosorbent, or microneutralization assay. In the case of a vaccine, an effective dose is one that prevents disease and/or reduces the severity of symptoms.
[0044] The term fusion protein in some instances refers to a viral surface glycoproteins (a.k.a F protein) that mediate virus entry to the target cells via fusion between virus and target cell membranes. Antibodies binding to the RSV fusion proteins are known to neutralize the virus and block the virus entry to the target cells, thereby preventing the viral infection. The term fusion protein in other instances refers to a chimeric polypeptide formed by the joining of two or more polypeptides through a peptide bond formed between the amino terminus of one polypeptide and the carboxyl terminus of another polypeptide. The fusion protein can be expressed as a single polypeptide from nucleic acid sequence encoding the single contiguous fusion protein.
[0045] As used herein the term immune stimulator refers to a compound that enhances an immune response. These molecules comprise various cytokines, and chemokines with immunostimulatory, and pro-inflammatory activities, such as vaccine adjuvants, interferons, interleukins; growth factors (e.g., granulocyte-macrophage (GM)-colony stimulating factor (CSF)); and other immunostimulatory molecules. The immune stimulator molecules can be administered in the same formulation as the disclosed split RSV and VLPs, or can be administered separately.
[0046] The term nucleic acid refers to a natural or synthetic molecule comprising two or more nucleotides linked by a phosphate group at the 3 position of one nucleotide to the 5 end of another nucleotide. The nucleic acid is not limited by length, and thus the nucleic acid can include deoxyribonucleic acid (DNA) or ribonucleic acid (RNA).
[0047] The terms peptide, protein, and polypeptide are used interchangeably to refer to a natural or synthetic molecule comprising two or more amino acids linked by the carboxyl group of one amino acid to the alpha amino group of another.
[0048] The term protein domain refers to a portion of a protein, portions of a protein, or an entire protein showing structural integrity; this determination may be based on amino acid composition of a portion of a protein, portions of a protein, or the entire protein.
[0049] The term pharmaceutically acceptable refers to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problems or complications commensurate with a reasonable benefit/risk ratio.
[0050] As used herein the term protective immune response or protective response refers to an immune response mediated by antibodies against an infectious agent, which is exhibited by a vertebrate (e.g., a human), that prevents or ameliorates an RSV infection or reduces at least one symptom thereof. The disclosed vaccines can stimulate the production of antibodies that, for example, neutralize infectious agents, blocks infectious agents from entering cells, blocks replication of said infectious agents, and/or protect host cells from infection and destruction. The term can also refer to an immune response that is mediated by T-lymphocytes and/or other white blood cells against an infectious agent, exhibited by a vertebrate (e.g., a human), that prevents or ameliorates RSV infection or reduces at least one symptom thereof.
[0051] The term split refers to splitting the enveloped virus particles. Current influenza vaccines are a platform of inactivated split influenza virus particles. Preparations of split RSV vaccines involve the process of inactivation of RSV by using formaldehyde. Inactivated RSV particles are further treated with detergents such as Triton X-100 to split the inactivated RSV. After dialysis to remove detergents and formalin, split RSV vaccines are prepared.
[0052] The term subject refers to any individual who is the target of administration, treatment, or vaccination. The subject can be a vertebrate, for example, a mammal. Thus, the subject can be a human or veterinary patient. The term patient refers to a subject under the treatment of a clinician, e.g., physician. All ages of subjects are intended to be covered. In particular, infants and young children are appropriate subjects or patients for a RSV vaccine.
[0053] The term treatment refers to the medical management of a patient with the intent to cure, ameliorate, stabilize, or prevent a disease, pathological condition, or disorder. This term includes active treatment, that is, treatment directed specifically toward the improvement of a disease, pathological condition, or disorder, and also includes causal treatment, that is, treatment directed toward removal of the cause of the associated disease, pathological condition, or disorder. In addition, this term includes palliative treatment, that is, treatment designed for the relief of symptoms rather than the curing of the disease, pathological condition, or disorder; preventative treatment, that is, treatment directed to minimizing or partially or completely inhibiting the development of the associated disease, pathological condition, or disorder; and supportive treatment, that is, treatment employed to supplement another specific therapy directed toward the improvement of the associated disease, pathological condition, or disorder.
[0054] The term vaccine refers to a formulation, e.g. containing a disclosed VLP, which is in a form that is capable of being administered to a vertebrate and which induces a protective immune response sufficient to induce immunity to prevent and/or ameliorate an infection and/or to reduce at least one symptom of an infection. Typically, the vaccine comprises a conventional saline or buffered aqueous solution medium, e.g. in which the disclosed VLPs are suspended or dissolved. Upon introduction into a host, the vaccine is able to provoke an immune response including, but not limited to, the production of antibodies and/or cytokines and/or the activation of cytotoxic T cells, antigen presenting cells, helper T cells, dendritic cells and/or other cellular responses.
[0055] The term virus-like particle (VLP) refers to a structure that in at least one attribute resembles a virus but which has not been demonstrated to be infectious. Virus-like particles do not carry genetic information encoding for the proteins of the virus-like particles. In general, virus-like particles lack a viral genome and, therefore, are noninfectious. In addition, virus-like particles can often be produced in large quantities by heterologous expression and can be easily purified.
[0056] RSV F VLP Constructs
[0057] The RSV fusion glycoprotein (RSV F) is an attractive vaccine antigen, since it is the principal target of RSV neutralizing antibodies in human sera. A neutralizing monoclonal antibody against RSV F (palivizumab) can prevent severe disease and has been approved for prophylaxis in preterm infants. RSV F fuses the viral and host cell membranes by irreversible protein refolding from the labile pre-fusion conformation to the stable post-fusion conformation. Structures of both conformations have been determined for RSV F.
[0058] The RSV F protein directs penetration of RSV by fusion between the virion's envelope protein and the host cell plasma membrane. Later in infection, the F protein expressed on the cell surface can mediate fusion with neighboring cells to form syncytia. The F protein is a type I transmembrane surface protein that has an N-terminal cleaved signal peptide and a membrane anchor near the C-terminus. RSV F is synthesized as an inactive F0 precursor that assembles into a homotrimer and is activated by cleavage in the trans-Golgi complex by a cellular endoprotease to yield two disulfide-linked subunits. The N-terminus of the F1 subunit that is created by cleavage contains a hydrophobic domain (the fusion peptide) that inserts directly into the target membrane to initiate fusion. The F1 subunit also contains heptad repeats that associate during fusion, driving a conformational shift that brings the viral and cellular membranes into close proximity.
[0059] Since RSV infection can be prevented by providing neutralizing antibodies to a vertebrate, a vaccine comprising RSV F proteins may induce, when administered to a vertebrate, neutralizing antibodies in vivo. Thus, disclosed herein are RSV F VLPs that can be formulated into vaccines or antigenic formulations for protecting vertebrates (e.g. humans) against RSV infection or at least one symptom thereof. Also disclosed are vectors that when transfected into host cells, will produce virus like particles (VLPs) comprising RSV F proteins. In some embodiments, RSV F VLPs may include at least a viral core protein (e.g. influenza M1 protein) and at least one F protein in either RSV pre-fusion or post-fusion conformation.
[0060] Immunization with post-fusion F (post-F) proteins, which present the antigenic sites (I, II, IV), induces neutralizing antibodies clearing lung viral replication in mice and cotton rats after challenge (Hwang, H. S., et al., 2014. Antiviral Res 110C:115-123; Hwang, H. S., et al., 2017. Virology 511:142-151; Hwang, H. S., et al., 2016. Virology 494:215-224; Raghunandan, R., et al., 2014. Vaccine 32:6485-6492; Schneider-Ohrum, K., et al., 2017. J Virol 91; Smith, G., et al., 2012. PloS one 7:e50852; Swanson, K. A., et al., 2011. Proc Natl Acad Sci USA 108:9619-9624).
[0061] The results of antigenicity tests (concentration at 0.05 g/well, Table 1) suggest that RSV vaccines [F VLP (F-WT or wild type F VLP), FI-RSV, or split RSV] with post-F protein display high reactivity to palivizumab (site II) and 131-2a (site I) antibodies, but low reactivity to prefusion F (pre-F) specific 5C4 monoclonal antibody (mAb). A preferred F protein for use in the disclosed VLPs should be reactive to both 5C4 mAb (pre-F) and palivizumab (post-F).
[0062] Therefore, disclosed herein is a recombinant RSV F protein that is stabilized in a pre-F conformation for use in the disclosed vaccine compositions. Pre-F conformation stabilizing mutations are known in the art, and are described in McLellan, J. S., 2015. Curr Opin Virol 11:70-75, and McLellan, J. S., et al., 2013. Science 342:592-598, which are incorporated by reference in their entireties for the teaching of these mutations. Examples of conformation stabilizing mutations include mutation selected from the group comprising S155C, S290C, 5190F, V207L, and any combination thereof.
[0063] In some embodiments to further stabilize the pre-fusion conformation of F on VLP platforms, the disclosed recombinant RSV F protein has additional mutations in the furin cleave sites 1 and 2. For example, the furin cleavage site 1 mutation can be an arginine to glutamine substitution at amino acids 131-136 (i.e., KKRKRR (SEQ ID NO:7) to KKQKQQ (SEQ ID NO:8)). The furin cleavage site 2 mutation can be a 106-109 (KAKK).
[0064] In some embodiments, the disclosed recombinant RSV F protein has an additional mutation in the fusion peptide region for stabilizing the pre-fusion conformation of F on VLP platforms. For example, the protein can have a deletion of at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids in the fusion peptide region between the amino acid residues 138-147.
[0065] The F protein can be derived from any available strain of RSV, such as A2, L19F, or DB1 (Rostad, C. A., et al., 2017. J Virol. 92(6); Stobart, C. C., et al., 2016. Nat Commun 7:13916). In some cases, the VLP comprises F proteins from more than one strain of RSV, e.g. a dual F protein. In some embodiments, the VLP comprises F proteins from both A2 and L19F strains. In some cases, one or both of these F proteins are in a pre-fusion F conformation.
[0066] Therefore, in some embodiments, the RSV F comprises an amino acid sequence that is at least 85%, 90%, 95%, 96%, 97%, 98% 99%, or 100% identical to MELLI LKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYT SVITIELSNIKKNKCNGTDAKIKLIKQELDKYKNAVTELQLLMQSTPATNNKAK KELPRFMNYTLNNAKKTNVTLSKKQKQQTSAIASGVAVCKVLHLEGEVNKIK SALLSTNKAVVSLSNGVSVLTFKVLDLKNYIDKQLLPILNKQSCSISNIETVIEF QQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSN NVQIVRQQSYSIMCIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEG SNICLTRTDRGVVYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVN LCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKT FSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSD EFDASISQVNEKINQSLAFIRKSDELLHNVNAVKSTTNIMITTIIIVIIVILLSLIAV GLLLYCKARSTPVTLSKDQLSGINNIAFSN (F1-WT, SEQ ID NO:1), or an immunogenic fragment thereof.
[0067] Therefore, in some embodiments, the RSV F comprises an amino acid sequence that is at least 85%, 90%, 95%, 96%, 97%, 98% 99%, or 100% identical to MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYT SVITIELSNIKKNKCNGTDAKIKLIKQELDKYKNAVTELQLLMQSTPATNNRAR RELPRFMNYTLNNAKKTNVTLSKKQKQQFLGFLLGVGSAIASGVAVSKVLHL EGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSI SNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITN DQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPL CTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMN SLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTAS NKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINF YDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAVKSTTNIMITTIIIV IIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN (F1mTM, SEQ ID NO:2), or an immunogenic fragment thereof.
[0068] Therefore, in some embodiments, the RSV F comprises an amino acid sequence that is at least 85%, 90%, 95%, 96%, 97%, 98% 99%, or 100% identical to MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGVVYT SVITIELSNIKKNKCNGTDAKIKLIKQELDKYKNAVTELQLLMQSTPATNNKAK KELPRFMNYTLNNAKKTNVTLSKKQKQQ[T]SAIASGVAVCKVLHLEGEVNKI KSALLSTNKAVVSLSNGVSVLTFKVLDLKNYIDKQLLPILNKQSCSISNIETVIE FQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMS NNVQIVRQQSYSIMCIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKE GSNICLTRTDRGVVYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEV NLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIK TFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPS DEFDASISQVNEKINQSLAFIRKSDELLHNVNAVKSTTNIMITTIIIVIIVILLSLIAV GLLLYCKARSTPVTLSKDQLSGINNIAFSN (F12dm-dcmTMrsv, SEQ ID NO:3), or an immunogenic fragment thereof. Mutated amino acids are underlined and the residyu replacing the deleted amino acids is bracketed.
[0069] To anchor multiple copies of one RSV pre-fusion F protein on the surface of a particle, the one RSV pre-fusion F protein may be expressed in a membrane-anchored form and incorporated in virus-like particles (VLPs). Therefore, in some embodiments, the disclosed RSV pre-fusion F protein further comprises a membrane anchor domain, such as a transmembrane domain and optional cytoplasmic domain of a viral envelope protein.
[0070] In some embodiments, the membrane anchor domain comprises the full HA protein sequence.
[0071] Also disclosed are polynucleotides comprising nucleic acid sequences encoding the disclosed RSV pre-fusion F proteins. For example, the nucleic acid sequences can be operably linked to expression control sequences. Thus, also disclosed are expression vectors for producing the disclosed proteins as well as cells containing these polynucleotides and vectors for replicating the polynucleotides and vectors or to produce the disclose proteins and/or VLPs. Therefore, the disclosed cell can also contain nucleic acid sequences encoding an M1 protein, including a vector comprising the nucleic acid sequences encoding an M1 protein.
[0072] Also disclosed is a dual vector comprising a first nucleic acid sequence encoding the disclosed RSV pre-fusion F protein and a second nucleic acid sequence encoding an influenza M1 protein.
[0073] In some embodiments, the nucleic acid sequence encoding the disclosed RSV pre-fusion F protein is operably linked to a first expression control sequence; and the nucleic acid sequence encoding an M1 protein is operably linked to a second expression control sequence.
[0074] The term vector refers to the means by which a nucleic acid can be propagated and/or transferred between organisms, cells, or cellular components. Vectors include plasmids, viruses, bacteriophages, pro-viruses, phagemids, transposons, artificial chromosomes, and the like, that replicate autonomously or can integrate into a chromosome of a host cell. A vector can also be a naked DNA polynucleotide. In many, but not all, common embodiments, the vectors of the present invention are plasmids or bacmids.
[0075] Thus, also disclosed are nucleotides that encode proteins, including chimeric molecules, cloned into an expression vector that can be expressed in a cell that induces the formation of VLPs. An expression vector is a vector, such as a plasmid that is capable of promoting expression, as well as replication of a nucleic acid incorporated therein. Typically, the nucleic acid to be expressed is operably linked to a promoter and/or enhancer, and is subject to transcription regulatory control by the promoter and/or enhancer. In one embodiment, said nucleotides encode for an RSV F protein (as discussed above). In some embodiments, the expression vector is a baculovirus vector.
[0076] In addition, the nucleotides can be sequenced to ensure that the correct coding regions were cloned and do not contain any unwanted mutations. The nucleotides can be subcloned into an expression vector (e.g. baculovirus) for expression in any cell. The above is only one example of how the RSV viral proteins can be cloned. Suitable vectors can be routinely selected based on the choice of cell used to produce the VLP. For example, where insect cells are used, suitable vectors include baculoviruses.
[0077] Also disclosed are vectors that comprise RSV nucleotides disclosed herein. The vector may be, for example, a phage, plasmid, viral, or retroviral vector. The vectors comprise RSV genes operatively linked to an appropriate promoter, such as the AcMNPV polyhedrin promoter (or other baculovirus). The expression constructs will further contain sites for transcription initiation, termination, and, in the transcribed region, a ribosome-binding site for translation. The coding portion of the transcripts expressed by the constructs will preferably include a translation initiating codon at the beginning and a termination codon appropriately positioned at the end of the polypeptide to be translated.
[0078] Expression vectors can include at least one selectable marker. Such markers include dihydrofolate reductase, G418 or neomycin resistance for eukaryotic cell culture and tetracycline, kanamycin or ampicillin resistance genes for culturing in E. coli and other bacteria. Among vectors preferred are virus vectors, such as baculovirus, poxvirus (e.g., vaccinia virus, avipox virus, canarypox virus, fowlpox virus, raccoonpox virus, swinepox virus, etc.), adenovirus (e.g., canine adenovirus). Other vectors that can be used include vectors for use in bacteria.
[0079] Among eukaryotic host cells are yeast, insect, avian, and mammalian host cells. Non limiting examples of insect cells are, Spodoptera frugiperda (Sf) cells, e.g. Sf9, Sf21, Trichoplusia ni cells, e.g. High Five cells, and Drosophila S2 cells. Examples of mammalian cells are COS cells, baby hamster kidney cells, mouse L cells, LNCaP cells, Chinese hamster ovary (CHO) cells, human embryonic kidney (HEK) cells, and African green monkey cells, CV1 cells, HeLa cells, MDCK cells, Vero and Hep-2 cells. Xenopus laevis oocytes, or other cells of amphibian origin, may also be used. Prokaryotic host cells include bacterial cells, for example, E. coli, B. subtilis, and mycobacteria.
[0080] Virus-Like Particles (VLPs)
[0081] Influenza VLP vaccines that were produced in insect cells were proven to be safe and efficacious in clinical trials (Glenn, G. M., et al., 2013. Vaccine 31:524-532; Khurana, S., et al., 2011. Journal of virology 85:10945-10954; Lopez-Macias, C., et al., 2011. Vaccine 29:7826-7834). RSV pre-fusion F protein may be expressed on the surface of a particle to mimic the natural conformation of RSV pre-fusion F protein on influenza virus M1 matrix VLPs. For example, the disclosed RSV pre-fusion F proteins were incorporated into virus-like particles (VLPs) by including within the RSV pre-fusion F protein a membrane anchor domain, such as a transmembrane domain and optional cytoplasmic domain of a viral envelope protein.
[0082] Non-replicating VLPs resemble infectious virus particles in structure and morphology, and contain immunologically relevant viral structural proteins. VLPs have been produced from both non-enveloped and enveloped viruses. Envelopes of VLPs are derived from the host cells similar to the way as enveloped viruses such as influenza A virus obtain their lipid envelopes from their host cells. Therefore, membrane-anchored proteins on the surfaces of enveloped viruses will be expressed in a native-like conformation if they are expressed in a membrane-anchored form. VLPs can be harvested approximately 48 to 96 hours post infection, when the levels of VLPs in the cell culture medium are near the maximum but before extensive cell lysis. The Sf9 cell density and viability at the time of harvest can be about 0.510.sup.6 cells/ml to about 1.510.sup.6 cells/ml with at least 20% viability, as shown by dye exclusion assay. Next, the medium can be removed and clarified. NaCl can be added to the medium to a concentration of about 0.4 to about 1.0 M, preferably to about 0.5 M, to avoid VLP aggregation. The removal of cell and cellular debris from the cell culture medium containing VLPs can be accomplished by tangential flow filtration (TFF) with a single use, pre-sterilized hollow fiber 0.5 or 1.00 m filter cartridge or a similar device.
[0083] Next, VLPs in the clarified culture medium can be concentrated by ultrafiltration using a disposable, pre-sterilized 500,000 molecular weight cut off hollow fiber cartridge. The concentrated VLPs can be diafiltrated against 10 volumes pH 7.0 to 8.0 phosphate-buffered saline (PBS) containing 0.5 M NaCl to remove residual medium components.
[0084] The concentrated, diafiltered VLPs can be furthered purified on a 20% to 60% discontinuous sucrose gradient in pH 7.2 PBS buffer with 0.5 M NaCl by centrifugation at 6,500g for 18 hours at about 4 C. to about 10 C. Usually VLPs will form a distinctive visible band between about 30% to about 40% sucrose or at the interface (in a 20% and 60% step gradient) that can be collected from the gradient and stored. This product can be diluted to comprise 200 mM of NaCl in preparation for the next step in the purification process. This product contains VLPs and may contain intact baculovirus particles.
[0085] Further purification of VLPs can be achieved by anion exchange chromatography, or 44% isopycnic sucrose cushion centrifugation. In anion exchange chromatography, the sample from the sucrose gradient (see above) is loaded into column containing a medium with an anion (e.g. Matrix Fractogel EMD TMAE) and eluded via a salt gradient (from about 0.2 M to about 1.0 M of NaCl) that can separate the VLP from other contaminates (e.g. baculovirus and DNA/RNA). In the sucrose cushion method, the sample comprising the VLPs is added to a 44% sucrose cushion and centrifuged for about 18 hours at 30,000 g. VLPs form a band at the top of 44% sucrose, while baculovirus precipitates at the bottom and other contaminating proteins stay in the 0% sucrose layer at the top. The VLP peak or band is collected.
[0086] The intact baculovirus can be inactivated, if desired. Inactivation can be accomplished by chemical methods, for example, formalin or -propiolactone (BPL). Removal and/or inactivation of intact baculovirus can also be largely accomplished by using selective precipitation and chromatographic methods known in the art, as exemplified above. Methods of inactivation can comprise incubating the sample containing the VLPs in 0.2% of BPL for 3 hours at about 25 C. to about 27 C. The baculovirus can also be inactivated by incubating the sample containing the VLPs at 0.05% BPL at 4 C. for 3 days, then at 37 C. for one hour.
[0087] After the inactivation/removal step, the product comprising VLPs can be run through another diafiltration step to remove any reagent from the inactivation step and/or any residual sucrose, and to place the VLPs into the desired buffer (e.g. PBS). The solution comprising VLPs can be sterilized by methods known in the art (e.g. sterile filtration) and stored in the refrigerator or freezer.
[0088] Split Enveloped Virus Vaccines
[0089] The enveloped RSV virus can be produced by replication on a suitable cell substrate, in serum or in a serum free process. Tissue culture-grown RSV may be produced in Hep2, BHK2, or Vero cells. Some of the disclosed vaccine formulations involve enveloped viruses that are capable of being split. The enveloped virus of RSV and influenza virus may be derived from a wide variety of sources including viruses from human or animal origin. The disclosed vaccine optionally comprises split virus selected from the group consisting of RSV and influenza virus.
[0090] The splitting of the virus means a treatment for disrupting or fragmenting whole virus, infectious (wild-type or attenuated) or non-infectious or inactivated virus. A disrupting and splitting agent is generally, but not necessarily, a surfactant. The virus to be split may be a chimeric or recombinant virus, having pre-fusion F immunogenic elements. The splitting treatment results in a full or partial fragmentation of the virus lipid bilayer envelop components and proteins which alters the antigenicity and immunogenicity.
[0091] Split virus can be prepared by contacting the inactivated or live RSV or influenza virus with a splitting agent to fully or partially disrupt the viral envelope lipid bilayers. Inactivation of the enveloped virus with cross-linking chemicals such as formalin may stabilize the viral protein antigens. Some viral proteins upon splitting the enveloped virus may become fully or partially exposed, possibly resulting in enhancing the antigenicity and immunogenicity. The loss of lipid membrane integrity of the enveloped virus after splitting as well as formalin inactivation renders the virus non-infectious as assessed by suitable in vitro titration assays. Once disrupted, the viral envelope proteins may retain or enhance antigenicity or immunogenicity although viral proteins are no longer associated with infecting target host cells.
[0092] The process for the preparation of the split enveloped virus may further include filtration and/or other separation steps such as ultracentrifugation, ultrafiltration, and zonal centrifugation. Prior and optional processes involve an inactivation step e.g. with formaldehyde or 3-propiolactone or UV treatment which may be carried out before or after splitting.
[0093] The inactivated split vaccines are the most common platform of seasonal influenza vaccination. The split RSV vaccines may contain membrane fragments and membrane envelope proteins as well as non-membrane proteins such as viral matrix protein and nucleoprotein but are not capable of replication. Split vaccines will contain most of the virus structural proteins but not necessarily in the same proportions as in the whole virus. Preferred split virus preparations comprise most of viral structural proteins. Subunit vaccines on the other hand consist of one or a few highly purified proteins. For example an RSV subunit vaccine could contain purified viral surface fusion proteins known to be capable of eliciting RSV neutralizing antibodies upon vaccination.
[0094] Various splitting agents such as non-ionic and ionic surfactants as well as various other reagents may be used. A preferred splitting agent is non-ionic surfactant triton X-100 (t-octylphenoxypolyethoxyethanol). Preferably, the final concentration of stabilizing surfactant triton X-100 present in the final vaccine formulation is between 0.01 to 5%, more preferably 0.05 to 2%. The most preferable range is between 0.1 to 1% triton X-100 in splitting RSV and in preparing split RSV vaccines.
[0095] Vaccine Compositions
[0096] Disclosed herein are vaccine compositions that comprise one or more of the RSV pre-fusion F proteins on VLP and or spit RSV vaccines described above. Although not required, the vaccine compositions optionally contain one or more immunostimulants. An immunostimulant refers to essentially any substance that enhances or potentiates an immune response (antibody or cell-mediated) to an exogenous antigen. One preferred type of immunostimulant is an adjuvant.
[0097] In some embodiments, the adjuvant is combination of low dose TLR4 agonist and low dose TLR9. In some embodiments, the TLR4 agonist is 3-O-desacyl-4-monophosphoryl lipid A (MPL). In some embodiments, the TLR9 against is a CpG oligodeoxynucleotide. In some embodiments, a low dose of MPL can be 0.5-1 g. In some embodiments, a low dose of CpG can be 2-4 g.
[0098] CpG adjuvant with unmethylated CpG motifs is recognized by TLR 9 and induces Th1 immune responses. As disclosed herein, the combination of low dose CpG (e.g. 4 g) and MPL (e.g. 1 g) obviates RSV F protein vaccine-enhanced lung histopathology (
[0099] Many adjuvants contain a substance designed to protect the antigen from rapid catabolism, such as aluminum hydroxide, and a stimulator of immune responses, such as heat-killed lactic acid bacteria, cell-wall skeleton of BCG vaccines, or Mycobacterium tuberculosis derived proteins. The adjuvant may be a submicron oil-in-water emulsion agent. For example, the adjuvant may comprise MF59TM, which is a sub-micron oil-in-water emulsion of a squalene, polyoxyethylene sorbitan monooleate (Tween 80) and sorbitan trioleate. The adjuvant may also be a combination of the TLR4 agonist MPL (3-O-desacyl-4-monophosphoryl lipid A) and aluminum salt, e.g., AS04 (GlaxoSmithKline, Philadelphia, Pa.).
[0100] Certain adjuvants are commercially available as, for example, Merck Adjuvant 65 (Merck and Company, Rahway, N.J.); AS01, AS02, AS03, and AS04 (GlaxoSmithKline, Philadelphia, Pa.); aluminum salts such as aluminum hydroxide gel (alum) or aluminum phosphate; biodegradable microspheres; monophosphoryl lipid A (MPL) and quil A.
[0101] In addition, the adjuvant composition can be one that induces an immune response predominantly of the Th1 type. High levels of Th1-type cytokines (e.g., IFN-, TNF, IL-2 and IL-12) tend to favor the induction of cell mediated immune responses to an administered antigen. In contrast, high levels of Th2-type cytokines (e.g., IL-4, IL-5, IL-6 and IL-10) tend to favor the induction of humoral immune responses. Following application of a vaccine as provided herein, a subject will support an immune response that includes Th1- and Th2-type responses. Optionally, the level of Th1-type cytokines will increase to a greater extent than the level of Th2-type cytokines. The levels of these cytokines may be readily assessed using standard assays. Certain adjuvants for eliciting a predominantly Th1-type response include, for example, a combination of monophosphoryl lipid A, preferably 3-de-O-acylated monophosphoryl lipid A, together with an aluminum salt adjuvants are available from Corixa Corporation (Seattle, Wash.). CpG-containing oligonucleotides (in which the CpG dinucleotide is unmethylated) also induce a predominantly Th1 response. Another adjuvant comprises a saponin, such as Quil A, or derivatives thereof, including QS21 and QS7 (Aquila Biopharmaceuticals Inc., Framingham, Mass.); Escin; Digitonin; or Gypsophila or Chenopodium quinoa saponins.
[0102] In some embodiments, the adjuvant is incorporated into the VLP in a membrane-anchored form. For example, GM-CSF or a bacterial flagellin protein containing a membrane anchor can be incorporated into the disclosed VLPs.
[0103] Pharmaceutical Compositions
[0104] The disclosed vaccines can be used therapeutically in combination with a pharmaceutically acceptable carrier. By pharmaceutically acceptable is meant a material that is not biologically or otherwise undesirable, i.e., the material may be administered to a subject without causing any undesirable biological effects or interacting in a deleterious manner with any of the other components of the pharmaceutical composition in which it is contained. The carrier would naturally be selected to minimize any degradation of the active ingredient and to minimize any adverse side effects in the subject, as would be well known to one of skill in the art.
[0105] The materials may be in solution, suspension (for example, incorporated into microparticles, liposomes, or cells). Suitable carriers and their formulations are described in Remington: The Science and Practice of Pharmacy (22nd ed.) eds. Loyd V. Allen, Jr., et al., Pharmaceutical Press, 2012. Typically, an appropriate amount of a pharmaceutically-acceptable salt is used in the formulation to render the formulation isotonic. Examples of the pharmaceutically-acceptable carrier include, but are not limited to, saline, Ringer's solution and dextrose solution. The pH of the solution is preferably from about 5 to about 8, and more preferably from about 7 to about 7.5. Pharmaceutical carriers are known to those skilled in the art. These most typically would be standard carriers for administration of vaccines to humans, including solutions such as sterile water, saline, and buffered solutions at physiological pH. Pharmaceutical compositions may include carriers, thickeners, diluents, buffers, preservatives, surface active agents and the like in addition to the vaccine. Pharmaceutical compositions may also include one or more active ingredients such as antimicrobial agents, antiinflammatory agents, anesthetics, and the like.
[0106] In some embodiments, the disclosed vaccines are formulated for delivery via intranasal, intramuscular, subcutaneous, transdermal or sublingual administration.
[0107] Preparations for parenteral administration include sterile aqueous or non-aqueous solutions, suspensions, and emulsions. Examples of non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate. Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media.
[0108] Combinations
[0109] The disclosed vaccine can be used to supplement existing human vaccines to improve cross protection. Therefore, the disclosed vaccine can further include (or be administered in combination with) a whole inactivated virus, split viral vaccine, live attenuated vaccine, or another virus-like particle (VLP) vaccine. For example, the disclosed vaccine can be combined with an inactivated vaccine, attenuated vaccine, split vaccine, or subunit vaccine. In some embodiments, the vaccine comprises the disclosed RSV F VLPs and at least one RSV split vaccine.
[0110] Methods of Vaccinating a Subject
[0111] A method of vaccinating a subject for RSV is disclosed that involves administering the disclosed vaccine to a subject in need thereof. The disclosed vaccine may be administered in a number of ways. For example, the disclosed vaccine can be administered intramuscularly, intranasally, or by microneedle in the skin. The compositions may be administered orally, intravenously, subcutaneously, transdermally (e.g., by microneedle), intraperitoneally, ophthalmically, vaginally, rectally, sublingually, or by inhalation.
[0112] Parenteral administration of the composition, if used, is generally characterized by injection. Injectables can be prepared in conventional forms, either as liquid solutions or suspensions, solid forms suitable for solution of suspension in liquid prior to injection, or as emulsions. A revised approach for parenteral administration involves use of a slow release or sustained release system such that a constant dosage is maintained.
[0113] The exact amount of the compositions required will vary from subject to subject, depending on the species, age, weight and general condition of the subject, the severity of the allergic disorder being treated, the particular nucleic acid or vector used, its mode of administration and the like. Thus, it is not possible to specify an exact amount for every composition. However, an appropriate amount can be determined by one of ordinary skill in the art using only routine experimentation given the teachings herein. For example, effective dosages and schedules for administering the compositions may be determined empirically, and making such determinations is within the skill in the art. The dosage ranges for the administration of the compositions are those large enough to produce the desired effect in which the symptoms disorder are affected. The dosage should not be so large as to cause adverse side effects, such as unwanted cross-reactions, anaphylactic reactions, and the like. Generally, the dosage will vary with the age, condition, sex and extent of the disease in the patient, route of administration, or whether other drugs are included in the regimen, and can be determined by one of skill in the art. The dosage can be adjusted by the individual physician in the event of any counterindications. Dosage can vary, and can be administered in one or more dose administrations daily, for one or several days. Guidance can be found in the literature for appropriate dosages for given classes of pharmaceutical products. A typical dosage of the disclosed vaccine used alone might range from about 1 g/kg to up to 100 mg/kg of body weight or more per vaccination, such as 10 g/kg to 50 mg/kg, or 50 g/kg to 10 mg/kg, depending on the factors mentioned above.
[0114] Symptoms of RSV are well known in the art. They include rhinorrhea, sore throat, headache, hoarseness, cough, sputum, fever, rales, wheezing, and dyspnea. Thus, the method of the invention comprises the prevention or reduction of at least one symptom associated with RSV infection. A reduction in a symptom may be determined subjectively or objectively, e.g., self-assessment by a subject, by a clinician's assessment or by conducting an appropriate assay or measurement (e.g. body temperature), including, e.g., a quality of life assessment, a slowed progression of a RSV infection or additional symptoms, a reduced severity of a RSV symptoms or a suitable assays (e.g. antibody titer and/or T-cell activation assay). The objective assessment comprises both animal and human assessments.
[0115] A number of embodiments of the invention have been described. Nevertheless, it will be understood that various modifications may be made without departing from the spirit and scope of the invention. Accordingly, other embodiments are within the scope of the following claims.
EXAMPLES
Example 1
[0116] RSV F VLP are shown to induce neutralizing antibodies and confers protection against RSV without pulmonary inflammation after challenge. RSV F VLP is similar to an enveloped virus in structure, 80-150 nm spherical particles in diameter but non-infectious. This F VLP avoids RSV vaccine-enhanced disease (VED) after RSV challenge, in contrasts with other RSV vaccines including FI-RSV (whole virus) (Connors, M., et al., 1992b. Journal of virology 66:7444-7451; Haynes, L. M., et al., 2003. J Virol 77:9831-9844), and F soluble proteins (Connors, M., et al., 1992a. Vaccine 10:475-484; Murphy, B. R., et al., 1990. Vaccine 8:497-502). Prior priming with RSV F VLP suppresses the induction of VED-prone lung inflammation that typically follows FI-RSV or F protein vaccination. RSV F VLP primes innate and adaptive immune responses suppressing VED, which differ from those primed by FI-RSV or purified F protein.
[0117] Avian cells that were transfected with plasmid DNA vectors encoding Newcastle disease virus (NDV) core proteins, M and NP, and containing two chimera proteins, composed of the RSV fusion protein (F) and glycoprotein (G) ectodomains fused to the NDV F and HN proteins were reported to produce chimeric RSV-NDV VLPs and their efficacy was tested in small animal studies (Cimica, V., et al., 2016. Clinical and vaccine immunology: CVI 23:451-459; Cullen, L. M., et al., 2015. J Transl Med 13:350). In these previous studies, chimeric RSV-NDV VLPs containing the pre-fusion RSV F protein were required at higher doses (50-150 g) to stimulate protective immune responses in cotton rats (Cullen, L. M., et al., 2015. J Transl Med 13:350). RSV-NDV VLPs containing pre-fusion F with pre-F stabilizing mutations were shown to be effective in inducing RSV neutralizing antibodies but their immunogenicity was very low since high vaccine doses (50-150 g) were needed for protective immune responses. Production of chimeric RSV-NDV VLPs in avian cells by DNA transfection would have limitations in scaling up the manufacturing process. The pre-fusion mutations (S155C, S290C, S190F, V207L 4 point mutations only) in the chimeric RSV-NDV VLP vaccine were different from those in our RSV F VLP vaccines containing the pre-fusion stabilizing mutations (mutations in the both furin cleavage sites, deletion of 10 amino acid residues, and 4 point mutations). Protective immunity was observed with moderate doses (10-20 g) of RSV F VLP vaccines even with post-fusion F proteins. Recombinant baculovirusinsect cell expressed vaccine production would be easier and less vaccine cost than DNA transfection avian cell-expressed vaccine production. RSV neutralizing antibodies targeting to the pre-fusion F proteins were more potent than antibodies targeting to the post-fusion F proteins. Vaccines containing pre-fusion F conformation (and palivizumab reactive epitopes) were shown to be highly effective in inducing RSV neutralizing antibodies. Therefore, a pre-F (F12dm-dcm) VLP presenting pre-fusion F conformation, was created and shown to enhance RSV neutralizing immunogenicity.
Example 2
[0118] Antigenicity of different RSV vaccine platforms has not been well characterized, which is critically important for better understanding vaccine efficacy and safety (vaccine-enhanced disease after challenge).
[0119] The results of antigenicity tests (Table 1) suggest that RSV vaccines [RSV F VLP (F-WT VLP), FI-RSV, or split RSV] described above display high reactivity to palivizumab and 131-2a mAb but low or no reactivity to prefusion (pre-F) conformation F specific 5C4 mAb. Previous studies reported that immunization with post-fusion (post-F) protein presenting the neutralizing antigenic sites (I, II, IV) induces neutralizing antibodies clearing lung viral replication in mice and cotton rats after challenge.
[0120] However, post-F lacks an antigenic site 0 (5C4 mAb epitope, Table 1) which is uniquely present in pre-F. Recent studies demonstrate that RSV F vaccines containing pre-F and post-F conformation were more effective in inducing neutralizing antibodies. Vaccination of cotton rats with pre-F and post-F proteins primes VED despite lung viral clearance.
[0121] The efficacy and safety of VLP or virus (split RSV) presenting pre-F or both pre-F and post-F conformations are still not well known. We have developed unique RSV vaccine candidates presenting pre-F conformation dominantly in VLP and RSV vaccine platforms (Table 1). F-GCN4 TM (transmembrane) VLP is newly developed and contains the full-length F protein linked to oligomer-stabilizing domain (GCN4) and TM (transmembrane) from influeza virus hemmaglutinin proteins. F-GCN4 TM exhibits high post-F specific mAb [131-2a, palivizumab (Paliv.mab), Table 1].
[0122] Live RSV displays reactivity to both post-F (131-2a, Paliv.mab) and pre-F (5C4) specific mAbs as for a comparative control.
[0123] FI-RSV shows reactivity to 131-2a and palivizumab but not to 5C4, containing F in post-F conformation, consistent with a recent study {Killikelly, 2016 #108}.
[0124] Split RSV37 C. [standard preparation of inactivated split RSV vaccine] exhibits high reactivity to post-F (131-2a, Paliv.mab) and low reactivity to pre-F (5C4) specific mAbs.
[0125] Low temperature (4 C.) inactivation, split of RSV (split RSV4 C.) vaccines were shown to retain significantly higher levels of pre-fusion F conformation (Table 1). Split RSV4 C. (inactivated at 4 C. and split) showed high reactivity to pre-F specific 5C4 mAb than split RSV37 C. and FI-RSV (Table 1).
[0126] Subunit RSV post-fusion and pre-fusion F protein vaccines requiring adjuvants were able to induce RSV neutralizing antibodies but were found to induce vaccine-enhanced disease after challenge, raising vaccine safety concerns in animal models (Palomo, C., et al., 2016. J Virol 90:5485-5498; Schneider-Ohrum, K., et al., 2017. J Virol 91). Alum adjuvanted FI-RSV vaccination resulted in vaccine enhanced disease (VED) after RSV infection (Kapikian A Z, M. R., et al., 1969. American journal of epidemiology 89:405-421; Kim, H. W., et al., 1969. American journal of epidemiology 89:422-434).
[0127] Split RSV maintains sufficient immunogenicity to control lung viral titers in the absence of adjuvants, and induces a desirable T cell helper type 1 (Th1) response and avoids VED after RSV challenge,
TABLE-US-00001 TABLE 1 F VLP and RSV vaccine candidates with preF (5C4) or postF (131-21, palivizumab) specific mAb reactivity (Reactivity to F mAb by ELISA) F VLP or RSV 131-2a Palivizumab 5C4 F-WT TM (post F) +++ ++++ +/ F1m TM (post F) ++++ +++ +/ F + F1m TM (pre F) + + ++++ Fdcm TM (pre-F) + + +++ F12dm.dcm.VLP ++ ++++ +++++ Live RSV (A2 strain) +++ +++ ++ FI-RSV (post F) ++++ +++ +/ Split RSV37 C. +++++ +++++ ++ Split RSV4 C. ++++ ++++++ ++++ VLP platforms were produced in insect cells. RSV vaccines were produced in HEp2 cells. ELISA OD values +/: 0.1-0.2, +: 0.3-0.5, ++: 0.5-1, +++: 1-1.5, ++++: 1.5-2, +++++: 2-2.5, ++++++: >2.5
Example 3
[0128] RSV A2-L19F (expressing F protein of line 19F strain) was reported to retain higher levels of thermostable pre-F conformation than RSV A2 or DB1 strain in recent studies (Rostad, C. A., et al., 2017. J Virol. 92(6); Stobart, C. C., et al., 2016. Nat Commun 7:13916). Recombinant RSV A2-L19F strains were produced expressing dual F proteins in a pre-F-stabilized conformation using a bacterial artificial chromosome (BAC)-based reverse genetics technology.
[0129] Replication competent, recombinant RSV A2-L19F were generated with dual expression of F proteins where RSV NS2 virulence gene known as a virulence gene was replaced with F in the RSV A2-L19F to develop more effective and safe split RSV4 C. vaccine.
[0130] Transcript regulator M2-2 gene deletion was shown to increase the expression of F (Jin, H., et al., 2000. J Virol 74:74-82; Karron, R. A., et al., 2015. Sci Transl Med 7:312ra175; Teng, M. N., et al., 2000. Journal of virology 74:9317-9321). Generation of RSV A2-L19F expressing dual F proteins where M2-2 was replaced with F and tested in a split RSV 4 C. platform. F1m is a mutated-F protein that contains furin cleavage site 1 mutation (KKRKRR to KKQKQQ) in the F protein.
[0131] Heterologous F+F1m co-expression resulted in higher reactivity to 5C4 pre-F specific mAb (Table 1). A replicable recombinant RSV co-expressing F-WT and F1 m TM was generated by replacing the M2-2 gene.
Example 4
[0132] The results of antigenicity tests (concentration at 0.05 g/well, Table 1) suggest that RSV vaccines [F VLP (F-WT VLP), FI-RSV, or split RSV] described above display high reactivity to palivizumab (site II) and 131-2a (site I) mAb but low reactivity to prefusion (pre-F) F specific 5C4 monoclonal antibody (mAb). However, post-F lacks an antigenic site (5C4 mAb epitope, Table 1) which is uniquely present in pre-F conformation. Alum-adjuvanted RSV F protein (post-F) vaccines were not sufficiently immunogenic for inducing protective levels of RSV neutralizing antibodies in the elderly (Falsey, A. R., et al., 2008. J Infect Dis 198:1317-1326; Langley, J. M., et al., 2009. Vaccine 27:5913-5919). RSV F vaccines containing pre-F (or both pre-F and post-F) were effective in inducing neutralizing antibodies (Cimica, V., et al., 2016. Clinical and vaccine immunology 23:451-459; Liang, B., et al., 2015. J Virol 89(18):9499-510; Palomo, C., et al., 2016. J Virol 90:5485-5498).
[0133] F1m TM VLP that contains furin cleavage site 1 mutation in the F protein displays similar antigenic properties as the F wild type context and did not show reactivity to 5C4 mAb. Heterologous F+F1m TM VLP was produced in insect cells by co-infecting with recombinant baculoviruses (rBVs) co-expressing F-WT and F1m TM. F+F1m TM VLP resulted in high reactivity to 5C4 pre-F specific mAb but low reactivity to palivizumab and 131-2a mAb, losing post-fusion epitopes (Table 1). Fdcm TM VLP (
[0134] Both mutations were combined to develop a unique F construct, named F12dm-dcm VLP presenting very high reactivity to both 5C4 mAb (pre-F) and palivizumab (Table 1,
[0135] Data using mouse sera after IM prime boost immunization with pre-F (F12dm.dcm) VLP showed higher and potent RSV neutralizing activity than F-WT VLP immune sera (
Example 5
[0136] FI-RSV shows reactivity to 131-2a and palivizumab but not to 5C4 mAb (Table 1), suggesting post-F, consistent with a previous study (Killikelly, A. M., et al., 2016. Sci Rep 6:34108). Split RSV37 C. (inactivated at 37 C. and split, a standard preparation) exhibits high reactivity to post-F (131-2a, Paliv.mab) and a moderate reactivity to pre-F (5C4) specific mAbs (
Example 6
[0137] To compare immunogenicity, BALB/c mice (n=10) were IM primed (a single dose) with 5 g of split RSV or FI-RSV. Split RSV raised higher levels of IgG2a than FI-RSV (
[0138] These results demonstrate desirable properties of split RSV as a promising vaccine candidate: [1] higher reactivity to palivizumab, [2] effective protection with Th1-like immune responses, [3] less likely to induce VED, and [4] more immunogenic and protective even without adjuvants (
Example 7
[0139] Alum adjuvant increases FI-RSV vaccine efficacy (lowering lung viral loads) but promotes vaccine-enhanced disease VED (Kim, K. H., et al., 2015. PloS one 10:e0139916). Squalene oil-in-water emulsion (Lambert, S. L., et al., 2015. PloS one 10:e0119509; Schneider-Ohrum, K., et al., 2017. J Virol 91), delta-inulin (Wong, T. M., et al., 2016. Human vaccines & immunotherapeutics:1-10), and natural killer (NK) T cell agonist -GalCer (Johnson, T. R., et al., 2002. J Virol 76:4294-4303) did not diminish lung inflammation of RSV vaccines. CpG is an oligodeoxynucleotide with unmethylated CpG motifs and recognized by TLR9 on human B cells and dendritic cells, inducing Th1-dominant immune responses (Krug, A., et al., 2001. Eur. J. Immunol. 31:3026-3037; Lin, L., et al., 2004. Eur J Immunol 34:1483-1487; McCluskie, M. J., et al., 1998. J. Immunol. 161:4463-4466; Vicari, A. P., et al., 2007. Antivir Ther 12:741-751). RSV F protein vaccines with high dose of CpG (20-100 g) adjuvant did not prevent lung pathology after challenge of vaccinated cotton rats (Prince, G. A., et al., 2003. J Virol 77:13156-13160). Other studies reported high dose CpG (10-100 g) adjuvant effects on improving the efficacy but lacked the details on VED in the RSV F protein vaccines (Garlapati, S., et al., 2012. Vaccine 30:5206-5214; Hancock, G. E., et al., 2001. Vaccine 19:4874-4882; Oumouna, M., et al., 2005. Journal of virology 79:2024-2032). MPL (3-O-deacyl-4-monophosphoryl lipid A), an attenuated version of TLR4 agonist lipopolysaccharide (LPS), is included in human vaccines (Rappuoli, R., et al., 2011. Nature reviews. Immunology 11:865-872). AS04 (GSK) of combined alum+MPL adjuvant is approved for use in human vaccines (HPV, HBV) (Boland, G., et al., 2004. Vaccine 23:316-320; Giannini, S. L., et al., 2006. Vaccine 24:5937-5949; Harper, D. M., 2009. Expert review of vaccines 8:1663-1679; Khatun, S., et al., 2012. Japanese journal of clinical oncology 42:36-4; Levie, K., et al., 2002. Scandinavian journal of infectious diseases 34:610-614; Thoelen, S., et al., 1998. Vaccine 16:708-714). A high dose MPL (100 g) was shown to attenuate FI-RSV-induced histopathology and proinflammatory cytokines (Boukhvalova, M. S., et al., 2006. Vaccine 24:5027-5035; Prince, G. A., et al., 2001. J Gen Virol 82:2881-2888).
[0140] Many adjuvants were screened (Tables 2 and 3). A unique combination of low dose [MPL TLR4 agonist+CpG TLR9 agonist] adjuvant was shown to enhance vaccine efficacy and prevent RSV vaccine-enhanced lung histopathology (
Example 8
[0141] Low dose [MPL TLR4 agonist+CpG TLR9 agonist] adjuvant improved the cross protective efficacy of influenza split virus vaccine (Tables 2-3). To compare adjuvant efficacy in 14 days old (D14) infant mice, split influenza (flu) virus vaccine (0.5 g)+/adjuvants was used with low doses of adjuvants: MPL (0.5-1 g), CpG (2-4 g) vs 10-100 g in prior studies (Mosca et al., 2008; Opal et al., 2005). After intramuscular (i.m.) priming (single exposure) of D14 mice with split flu (0.5 g)+/adjuvants (alum 25 g, MPL 1 g, CpG 4 g, MPL 1 g+Alum 25 g, MPL 1 g+CpG 4 g), serum IgG isotype Abs, and protection against intranasal (i.n.) lethal challenge with homologous virus (pandemic A/California/2009, pH1N1) at 4 W later (Table 2) was determined. Combined low dose MPL (1 g)+CpG (4 g) TLR agonist adjuvant was found to be effective in inducing IgG2a (T helper type 1) isotype antibodies in D14 mice. Also, MPL+CpG significantly improved protection against lethal infection with body weight (BW) loss 2%, similar to AddaVax (an equivalent MF59 licensed adjuvant) in D14 pups (BW loss 1-2%) compared to D14 split alone (BW loss 14.4%) and other adjuvants (BW loss 7-11.7%, Table 2).
TABLE-US-00002 TABLE 2 Superior efficacy of MPL + CpG adjuvants on enhancing influenza vaccine efficacy in infant age mouse models Age Groups IgG1 IgG2a BW (%) Nave inf. (lethal) 0.08 0.04 >25% adult split (0.5 g) 0.60 0.21 13.0%.sup. D 14 split 0.63 0.06 14.4%.sup. D 14 split + alum 0.92 0.08 11.7%.sup. D 14 split + MPL + Alum 0.87 0.12 8.9% D 14 split + MPL (1 g) 0.89 0.30 7.0% D 14 split + CpG (4 g) 0.51 0.19 9.4% D 14 split + MPL + CpG 0.41 0.54 2.0% Nave inf. 0.08 0.04 21% D 7 split 0.44 0.04 18% D 7 split + MPL + CpG 0.95 0.15 6% D 7 split + AddaVax 0.17 0.05 25% D 7 split + polyI:C 0.13 0.04 24% D 5 split 0.08 0.03 >25% D 5split + MPL + CpG 0.54 0.12 11% Split: Inactivated influenza split vaccine Adjuvants: alum, AddaVax, MPL, CpG, MPL + CpG, poly I:C DK128 (killed lactic acid bacteria), CWS (Cell-wall cytoskeleton of BCG vaccine: Bacillus Calmette-Gurin (BCG))
TABLE-US-00003 TABLE 3 Effects of new adjuvants on enhancing the protective efficacy of influenza vaccines efficacy in infant and adult age mouse models Age Groups IgG1 IgG2a BW (%) B6 Nave inf. (lethal) 0.08 0.04 >25% B6 adult split (3 g) 0.60 0.15 >25% B6 adult split (3 g) + DK128 2.60 2.2 10% D 6, D 14 prime boost vaccination D 6 Nave Inf. 0.08 0.04 >25% D 6 Split only 0.7 0.12 22% D 6 Split + CWS 1.4 0.2 6% D 14 Nave Inf. 20% D 14 Split only 0.75 0.05 20% D 14 Split + CWS 1.3 0.64 9%
Example 9
[0142] Adjuvant effects of low dose MPL+CpG adjuvant were determine in neonatal age mice [5 days old: D5; 7 days old: D7] in comparison with other adjuvants. Severe BW loss (%) was observed in neonatal pups primed intraperitoneally (i.p.) with split flu alone (D5 split 0.1-0.5 g, >25% BW loss) or plus AddaVax (D7split+AddaVax [(an equivalent MF59 licensed adjuvant], BW loss 25%), poly IC (4 g) [polyinosinic-polycytidylic acid, TLR3 agonist] (D7split+poly IC, 24%). MPL+CpG TLR adjuvant was superior to other adjuvants in inducing IgG antibodies and protection in D5/D7 age neonatal mice (BW 6-11%,
Example 10
[0143] The adjuvant effects on influenza vaccine efficacy of heat-killed lactic acid bacteria (DK128) and cell wall skeleton (CWS) of Bacillus Calmette-Gurin (BCG) were tested in mice. Both heat-killed DK128 and BCG CWS showed vaccine adjuvant effects on enhancing the immunogenicity and efficacy of inactivated split influenza virus vaccines even in the immune compromised condition (Table 3).
Example 11
[0144] F VLP was found to prime immune responses preventing VED upon exposure to FI-RSV. BALB/c mice (n=5) were intramuscularly (IM) immunized with FI-RSV (prime)/FI-RSV (boost) or heterologous F VLP prime/FI-RSV boost. RSV F VLP prime was found to dictate the pattern of RSV-specific IgG2a (Th1 type) IgG responses (IgG2a/IgG1 ratios=4) after heterologous F VLP prime/FI-RSV boost; whereas FI-RSV prime-boost induced IgG1 predominantly (IgG2a/IgG1 ratios <1). FI-RSV/FI-RSV and F VLP/FI-RSV vaccination controlled lung RSV titers after RSV challenge. RSV F VLP prime was found to suppress lung inflammation by subsequent FI-RSV boost. To further extend this exciting finding, VED-prone purified RSV F protein vaccines were tested in infant mice that are prone to RSV disease. IM prime co-immunization of 2 weeks (2 W) old infant BALB/c mice with F VLP+F protein induced higher levels of RSV specific IgG2a (Th1 type) antibodies, and resulted in better control of lung viral titers (immune plaque assay) after RSV challenge compared to alum adjuvanted-F protein (
Example 12
[0145] Groups of BALB/c mice were prime or primeboost intramuscularly (IM) immunized with RSV (FFG) VLP (F DNA 25 g+F VLP 10 g), FI-RSV (2 g), or inoculated with live RSV (110.sup.4 PFU), and then challenged with RSV (110.sup.6 PFU RSV A2) (
[0146] Neonatal age (7 days old) cotton rats (n=5) were intramuscularly immunized with split RSV (10 g)+F DNA (25 g), and then boosted with F VLP (10 g) or split RSV (20 g). Cotton rats that were prior immunized with split RSV+F DNA/F VLP or split RSV were found to clear lung viral loads after RSV challenge whereas nave (mock control) cotton rats showed high levels of RSV titers in the lungs (
Example 13
[0147] Experiments were conducted to determine whether MPL+CpG adjuvanted split influenza virus vaccination improves the efficacy of cross protection against heterosubtypic influenza virus challenge. The immunized mice were challenged with rgH5N1 virus at a sublethal dose at 4 weeks post boost immunization. Body weight changes and enhanced pause of respirations (PenH) were monitored to measure severity of disease (
[0148] Unless defined otherwise, all technical and scientific terms used herein have the same meanings as commonly understood by one of skill in the art to which the disclosed invention belongs. Publications cited herein and the materials for which they are cited are specifically incorporated by reference.
[0149] Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the following claims.