ANTIMICROBIAL NANOBODIES
20210070854 · 2021-03-11
Inventors
Cpc classification
B82Y5/00
PERFORMING OPERATIONS; TRANSPORTING
C07K16/28
CHEMISTRY; METALLURGY
C07K2317/569
CHEMISTRY; METALLURGY
C07K2319/33
CHEMISTRY; METALLURGY
C07K2317/22
CHEMISTRY; METALLURGY
C07K2318/10
CHEMISTRY; METALLURGY
C07K16/00
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
International classification
Abstract
This application discloses a nanobody polypeptide comprising at least 2 complementarity determining regions (CDRs) and an antimicrobial peptide, wherein the polypeptide binds specifically to a microbial surface antigen. Further, this application provides a nanobody polypeptide comprising 3 CDRs and an antimicrobial peptide, wherein the polypeptide binds specifically to a microbial surface antigen.
Claims
1. A nanobody polypeptide comprising at least 2 complementarity determining regions (CDRs) and an antimicrobial peptide, wherein the polypeptide binds specifically to a microbial surface antigen.
2. The polypeptide of claim 1, wherein the 2 CDRs are separated from each other by framework domain sequences.
3. The polypeptide of claim 2, wherein the framework domain sequences are from immunoglobulin variable regions.
4. The polypeptide of claim 3, wherein the framework domain sequences are from mammalian immunoglobulin variable regions.
5. The polypeptide of claim 4, wherein the framework domain sequences are from human immunoglobulin variable regions.
6. The polypeptide of claim 1, wherein the polypeptide binds specifically to a bacterial surface antigen.
7. The polypeptide of claim 1, wherein the bacterial surface antigen is a gram positive bacteria surface antigen.
8. The polypeptide of claim 1, wherein the bacterial surface antigen is a gram negative bacteria surface antigen.
9. The polypeptide of claim 1, wherein the nanobody polypeptide is humanized.
10. The polypeptide of claim 1, comprising from N-terminus to C-terminus: a first framework domain; the first CDR; a second framework domain; the second CDR; a third framework domain; the antimicrobial peptide; and a forth framework domain.
11. The polypeptide of claim 1, comprising from N-terminus to C-terminus: a first framework domain; the first CDR; a second framework domain; the second CDR; a third framework domain; and the antimicrobial peptide.
12. The polypeptide of claim 1, comprising at least 3 complementarity determining regions.
13. The polypeptide of claim 13, wherein the 3 CDRs are separated from each other by framework domain sequences.
14. The polypeptide of claim 1, comprising from N-terminus to C-terminus: a first framework domain; the first CDR; a second framework domain; the second CDR; a third framework domain; the antimicrobial peptide; the third CDR; and a forth framework domain.
15. The polypeptide of claim 1, comprising from N-terminus to C-terminus: a first framework domain; the first CDR; a second framework domain; the second CDR; a third framework domain; the third CDR; the antimicrobial peptide; and a forth framework domain.
16. The polypeptide of claim 1, comprising from N-terminus to C-terminus: a first framework domain; the first CDR; a second framework domain; the second CDR; a third framework domain; the antimicrobial peptide; a linker sequence; the third CDR; and a forth framework domain.
17. The polypeptide of claim 1, comprising from N-terminus to C-terminus: a first framework domain; the first CDR; a second framework domain; the second CDR; a third framework domain; the third CDR; a linker sequence; the antimicrobial peptide; and a forth framework domain.
18. The polypeptide of claim 1, comprising from N-terminus to C-terminus: a first framework domain; the first CDR; a second framework domain; the second CDR; a third framework domain; the third CDR; a forth framework domain; and the antimicrobial peptide.
19. The polypeptide of claim 1, wherein the antimicrobial peptide is positioned to replace the amino acids corresponding to the CDR3 of an antibody.
20. The polypeptide of claim 1, wherein the antimicrobial peptide is positioned after amino acid 96 based on the Kabat antibody number convention.
21. The polypeptide of claim 1, wherein the antimicrobial peptide replaces the amino acid corresponding to amino acids 96 and 108 of SEQ ID NO: 14.
22. The polypeptide of claim 1, wherein the antimicrobial peptide comprises a sequence at least 80% identical to the Ec5, Ab15, or Cat3.
23. The polypeptide of claim 22, wherein the antimicrobial peptide is Ab15.
24. The polypeptide of claim 1, wherein the polypeptide comprises the amino acid sequence at least 80% identical to the sequence of SEQ ID NO:1-27.
25. The polypeptide of any of claims 1-24, further comprising a transmembrane domain.
26. The polypeptide of claim 1, wherein the polypeptide is fused to at least a second nanobody polypeptide comprising at least 2 complementarity determining regions (CDRs) and an antimicrobial peptide, wherein the polypeptide binds specifically to a microbial surface antigen.
27. The polypeptide of claim 1, wherein the polypeptide is fused to at least a second nanobody polypeptide in accordance with anyone of claims 1-25.
28. The polypeptide of claim 1, wherein the polypeptide is fused to at least a second nanobody polypeptide comprising at least 3 complementarity determining regions (CDRs), wherein the polypeptide binds specifically to a microbial surface antigen.
29. A polynucleotide molecule encoding a polypeptide of any one of claims 1-28.
30. A vector comprising coding sequence for the polypeptide of any of claims 1-29 operably linked to a promoter sequence.
31. The vector of claim 30, wherein the promoter is an inducible promoter.
32. A host cell comprising the single-chain polypeptide of any of claims 1-29 or the vector of claim 30.
33. A pharmaceutical composition comprising an effective amount of a polypeptide of any one of claims 1-28 in a pharmaceutically acceptable carrier.
34. A method of treating a microbial infection in a subject comprising administering an effective amount of a polypeptide of any one of claims 1-28 to the subject.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0025] The following drawings form part of the present specification and are included to further demonstrate certain aspects of the present invention. The invention may be better understood by reference to one or more of these drawings in combination with the detailed description of specific embodiments presented herein.
[0026]
[0027]
[0028]
[0029]
[0030]
DESCRIPTION OF ILLUSTRATIVE EMBODIMENTS
I. The Present Embodiments
[0031] The present invention relates to a polypeptide construct comprising one or more nanobodies directed to one or more target microbial antigen, and methods of use thereof. In certain aspects, the nanobodies of the instant disclosure comprise and antimicrobial peptide domain. Thus, nanobody compositions of the embodiments can be used to inhabit microbial growth or to kill target microbes.
II. Nanobodies
[0032] A nanobody, as used herein, refers to the smallest antigen binding fragment or single variable domain (VHH) derived from a naturally occurring heavy chain antibody and is known to the person skilled in the art. Such nanobodies can be derived from antibodies raised in Camelidae species, for example in camel, llama, dromedary, alpaca and guanaco. Nanobodies may also be synthetically produced, such as by overexpression in bacteria. Single domain antibodies are antibodies whose complementary determining regions are part of a single domain polypeptide. Examples include, but are not limited to, heavy chain antibodies, antibodies naturally devoid of light chains, single domain antibodies derived from conventional 4-chain antibodies, engineered antibodies and single domain scaffolds other than those derived from antibodies. A nanobody of the embodiments comprises at least 2 CDR domains.
[0033] The nanobodies, according to the disclosure, generally comprise a single amino acid chain that can be considered to comprise 4 framework sequences or FRs and 2 or 3 complementary determining regions or CDRs, preferably in a sequence FR1-CDR1-FR2-CDR2-FR3-(optionally CDR3)-FR4. Non-limiting examples of nanobodies of the disclosure are described in more detail further herein. It should be clear that framework regions of nanobodies may also contribute to the binding of their antigens (Desmyter et al., 2002; Korotkov et al., 2009). It should however be noted that parts, fragments, analogs or derivatives (as further described herein) of a nanobody are not particularly limited as to their length and/or size, as long as such parts, fragments, analogs or derivatives meet the further requirements outlined herein and are also preferably suitable for the purposes described herein.
[0034] The term nanobody, in its broadest sense, is not limited to a specific biological source or to a specific method of preparation. For example, the nanobodies of the disclosure can generally be obtained: (1) by isolating the VHH domain of a naturally occurring heavy chain antibody; (2) by expression of a nucleotide sequence encoding a naturally occurring VHH domain; (3) by humanization of a naturally occurring VHH domain or by expression of a nucleic acid encoding a such humanized VHH domain; (4) by camelization of a naturally occurring VH domain from any animal species, and in particular from a mammalian species, such as from a human being, or by expression of a nucleic acid encoding such a camelized VH domain; (5) by camelization of a domain antibody or Dab, as described in the art, or by expression of a nucleic acid encoding such a camelized VH domain; (6) by using synthetic or semi-synthetic techniques for preparing proteins, polypeptides or other amino acid sequences known per se; (7) by preparing a nucleic acid encoding a nanobody using techniques for nucleic acid synthesis known per se, followed by expression of the nucleic acid thus obtained; and/or (8) by any combination of one or more of the foregoing.
[0035] The small size and unique biophysical properties of nanobodies excel conventional antibody fragments for the recognition of uncommon or hidden epitopes and for binding into cavities or active sites of protein targets. Further, nanobodies can be designed as bispecific and bivalent antibodies or attached to reporter molecules (Conrath et al., 2001). Nanobodies are stable and rigid single domain proteins that can easily be manufactured and survive the gastro-intestinal system. Therefore, nanobodies can be used in many applications including drug discovery and therapy (Saerens et al., 2008) but also as a versatile and valuable tool for purification, functional study and crystallization of proteins (Conrath et al., 2009).
[0036] The nanobodies or V.sub.HHS may be directed against a functional conformational state of a membrane protein, as described hereinbefore. Although naive or synthetic libraries of nanobodies (for examples of such libraries, see WO9937681, WO0043507, WO0190190, WO03025020 and WO03035694) may contain conformational binders against a membrane protein in a functional conformational state.
[0037] The amino acid residues of a nanobody are numbered according to the general numbering for VH domains given by Kabat et al., as applied to VHH domains from Camelids in the article of Riechmann and Muyldermans, 2000 (see for example
[0038] Nanobodies, and the VHH domains upon which they are based, have a number of unique structural characteristics and functional properties which make isolated VHH domains, and proteins containing the same, highly advantageous for use as functional antigen-binding domains or proteins. In particular, and without being limited thereto, VHH domains (which have been designed by nature to functionally bind to an antigen without the presence of, and without any interaction with, a light chain variable domain) and nanobodies can function as a single, relatively small, functional antigen-binding structural unit, domain or protein. This distinguishes the nanobodies and VHH domains from the VH and VL domains of conventional 4-chain antibodies, which by themselves are generally not suited for practical application as single antigen-binding proteins or domains, but need to be combined in some form or another to provide a functional antigen-binding unit (as in for example conventional antibody fragments such as Fab fragments; in ScFv's fragments, which consist of a VH domain covalently linked to a VL, domain).
[0039] Because of these unique properties, the use of nanobodies and VHH domains as single antigen-binding proteins or as antigen-binding domains (i.e. as part of a larger protein or polypeptide) offers a number of significant advantages over the use of conventional VH and VL domains, scFv's or conventional antibody fragments (such as Fab- or F(ab)2-fragments). For example, only a single domain is required to bind an antigen with high affinity and with high selectivity, so that there is no need to have two separate domains present, nor to assure that these two domains are present in the right spatial conformation and configuration (i.e. through the use of especially designed linkers, as with scFv's). Further, nanobodies can be expressed from a single gene and require no post-translational folding or modifications. Also, nanobodies can easily be engineered into multivalent and multispecific formats. Additionally, nanobodies are highly soluble and do not have a tendency to aggregate (as with the mouse-derived dAb's described by Ward et al., 1989). Another highly desirable trait of nanobodies or VHH domains is that they are highly stable to heat, pH, proteases and other denaturing agents or conditions (see for example Ewert et al.). Nanobodies are easy and relatively cheap to prepare, even on a scale required for production. For example, nanobodies, VHH domains, and proteins/polypeptides containing the same can be produced using microbial fermentation (e.g. as further described below) and do not require the use of mammalian expression systems, as with for example conventional antibody fragments. Nanobodies and VHH domains are relatively small (approximately 15 kDa, or 10 times smaller than a conventional IgG) compared to conventional 4-chain antibodies and antigen-binding fragments thereof, and therefore show higher penetration into tissues (including but not limited to solid tumors and other dense tissues) than such conventional 4-chain antibodies and antigen-binding fragments thereof. Nanobodies can show so-called cavity-binding properties (inter alia due to their extended CDR3 loop, compared to conventional VH domains) and can therefore also access targets and epitopes not accessible to conventional 4-chain antibodies and antigen-binding fragments thereof. For example, it has been shown that VHH domains and Nanobodies can inhibit enzymes (see for example WO 97/49805; Transue et al., 1998; Lauwereys et al., 1998).
[0040] In additional aspects, nanobody polypeptides may be further modified by one or more other amino substitutions while maintaining their activity. In preferred aspects, such substitutions are made in the framework regions and not in the CDR domains. For example, amino acid substitutions can be made at one or more positions wherein the substitution is for an amino acid having a similar hydrophilicity. The importance of the hydropathic amino acid index in conferring interactive biologic function on a protein is generally understood in the art (Kyte and Doolittle, 1982). It is accepted that the relative hydropathic character of the amino acid contributes to the secondary structure of the resultant protein, which in turn defines the interaction of the protein with other molecules. Thus such conservative substitution can be made in a nanobody of the embodiments and will likely only have minor effects on their activity. As detailed in U.S. Pat. No. 4,554,101, the following hydrophilicity values have been assigned to amino acid residues: arginine (+3.0); lysine (+3.0); aspartate (+3.01); glutamate (+3.01); serine (+0.3); asparagine (+0.2); glutamine (+0.2); glycine (0); threonine (0.4); proline (0.51); alanine (0.5); histidine 0.5); cysteine (1.0); methionine (1.3); valine (1.5); leucine (1.8); isoleucine (1.8); tyrosine (2.3); phenylalanine (2.5); tryptophan (3.4). These values can be used as a guide and thus substitution of amino acids whose hydrophilicity values are within 2 are preferred, those that are within 1 are particularly preferred, and those within 0.5 are even more particularly preferred. Thus, any of the nanobody polypeptides described herein may be modified by the substitution of an amino acid, for different, but homologous amino acid with a similar hydrophilicity value. Amino acids with hydrophilicities within +/1.0, or +/0.5 points are considered homologous. Furthermore, it is envisioned that nanobody sequences may be modified by amino acid deletions, substitutions, additions or insertions while retaining its binding and/or antimicrobial activity.
III. Methods of Use
[0041] The present disclosure also provides methods of using the nanobody polypeptide(s) of the present disclosure to prevent, inhibit or terminate the growth of at least one microbe which may include, for example, bacteria, archaea, fungi, algae, protozoa, multicellular parasites, and viruses.
[0042] In one embodiment, the compositions of the present disclosure provide antimicrobial effect to a target microbial organism and can be used to treat a disease or infection associated with the target microbial organism. An antimicrobial effect includes inhibiting the growth or killing of the target microbial organisms, or interfering with any biological functions of the target microbial organisms. In general, the compositions of the present disclosure can be used to treat a disease or infection at any place in a host, e.g., at any tissue including surfaces of any tissue or implant. In one embodiment, the compositions are used to specifically kill or inhibit bacterial target microbial organisms in body fluid (e.g., blood, sputum).
[0043] In some embodiments, compositions of the present disclosure are effective against bacteria including Gram-positive and Gram-negative cocci, Gram-positive and Gram-negative straight, curved and helical/vibroid and branched rods, sheathed bacteria, sulfur-oxidizing bacteria, sulfur or sulfate-reducing bacteria, spirochetes, actinomycetes and related genera, myxobacteria, mycoplasmas, rickettsias and chlamydias, cyanobacteria, archea, fungi, parasites, viruses and algae. For example, the target microbial organisms of the present disclosure include, without limitation, Escherichia coli, Candida, Salmonella, Staphylococcus, and Pseudomonas, especially Campylobacter jejuni, Candida albicans, Candida krusei, Chlamydia trachomatis, Clostridium difficile, Cryptococcus neoformans, Haempohilus influenzae, Helicobacter pylori, Moraxella catarrhalis, Neisseria gonorrhoeae, Pseudomonas aeroginosa, Salmonella typhimurium, Shigella disenteriae, Staphylococcus aureus, and Streptococcus pneumoniae. In addition, the microbial peptide composition may be used to treat chronic skin ulcers, infected acute wounds or burn wounds, infected skin eczema, impetigo, atopic dermatitis, acne, external otitis, vaginal infections, seborrhoic dermatitis, oral infections, paradontitis, conjunctivitis or pneumonia.
[0044] In particular embodiments, the compositions of the present disclosure are effective against gram-negative bacteria. Gram-positive and Gram-negative cocci include, but are not limited to, Aerococcus, Enterococcus, Halococcus, Leuconostoc, Micrococcus, Mobiluncus, Moraxella catarrhalis, Neisseria (including N. gonorrheae and N. meningitidis), Pediococcus, Peptostreptococcus, Staphylococcus species (including S. aureus, methicillin-resistant S. aureus, coagulase-negative S. aureus, and S. saprophyticus), Streptococcus species (including S. pyogenes, S. agalactiae, S. bovis, S. pneumoniae, S. mutans, S. sanguis, S. equi, S. equinus, S. thermophilus, S. morbillorum, S. hansenii, S. pleomorphus, and S. parvulus), and Veillonella.
[0045] The Gram-positive and Gram-negative straight, curved, helical/vibrioid and branched rods include, but are not limited to, Acetobacter, Acinetobacter, Actinobacillus equuli, Aeromonas, Agrobacterium, Alcaligenes, Aquaspirillum, Arcanobacterium haemolyticum, Bacillus species (including B. cereus and B. anthracis), Bacteroides species (including B. fragilis), Bartonella, Bordetella species (including B. pertussis), Brochothrix, Brucella, Burkholderia cepacia, Calymmatobacterium granulomatis, Campylobacter species (including C. jejuni), Capnocytophaga, Caulobacter, Chromobacterium violaceum, Citrobacter, Clostridium species (including C. perfringens, C. tetani and C. difficile), Comamonas, Curtobacterium, Edwardsiella, Eikenella, Enterobacter, Erwinia, Erysipelothrix, Escherichia species (including E. coli), Flavobacterium species (including E. meninosepticum), Francisella species (including E. tularensis), Fusobacterium (including E. nucleatum), Gardnerella species (including G. vaginalis), Gluconobacter, Haemophilus species (including H. influenzae and H. ducreyi), Hafnia, Helicobacter (including H. pylori), Herpetosiphon, Klebsiella species (including K. pneumoniae), Kluyvera, Lactobacillus, Legionella species (including E. pneumophila), Leptotrichia, Listeria species (including E. monocytogenes), Microbacterium, Morganella, Nitrobacter, Nitrosomonas, Pasteurella species (including P. multocida), Pectinatus, Porphyromonas gingivalis, Proteus species (including E. mirabilis), Providencia, Pseudomonas species (including E. aeruginosa, P. mallei, P. pseudomallei and E. solanacearum), Rahnella, Renibacterium salmoninarum, Salmonella, Serratia, Shigella, Spirillum, Streptobacillus species (including S. moniliformis), Vibrio species (including V. cholerae and V. vulnificus), Wolinella, Xanthobacter, Xenorhabdus, Yersinia species (including Y. pestis and Y. enter ocoliticd), Zanthomonas and Zymomonas.
[0046] The clinical diseases or infections caused by Gram-positive and/or Gram-negative bacteria, treatable with the present disclosure include abscesses, bacteremia, contamination of peritoneal dialysis fluid, endocarditis, pneumonia, meningitis, osteomyelitis, cellulitis, pharyngitis, otitis media, sinusitis, scarlet fever, arthritis, urinary tract infection, laryngotracheitis, erysipeloid, gas gangrene, tetanus, typhoid fever, acute gastroenteritis, bronchitis, epiglottitis, plague, sepsis, chancroid, wound and burn infection, cholera, glanders, periodontitis, genital infections, empyema, granuloma inguinale, Legionnaire's disease, paratyphoid, bacillary dysentary, brucellosis, diphtheria, pertussis, botulism, toxic shock syndrome, mastitis, rheumatic fever, cystic fibrosis, eye infections, plaque, and dental caries. Other uses include swine erysipelas, peritonitis, abortion, encephalitis, anthrax, nocardiosis, pericarditis, mycetoma, peptic ulcer, melioidosis, HaverhiU fever, tularemia, Moko disease, galls (e.g, crown, cane and leaf), hairy root, bacterial rot, bacterial blight, bacterial brown spot, bacterial wilt, bacterial fin rot, dropsy, columnaris disease, pasteurellosis, furunculosis, enteric redmouth disease, vibriosis offish, and fouling of medical devices.
[0047] Another embodiments of the present disclosure relates to administering a nanobody polypeptide provided herein in combination with an antibiotic. Antibiotics suitable for co-administration with the nanobody polypeptides disclosed herein include substances, produced synthetically or naturally, which can inhibit the growth of or kill microbial organisms. Such antibiotics include, without any limitation, -lactam antibiotics (e.g., ampicillin, aziocillin, aztreonam, carbenicillin, cefoperazone, ceftriaxone, cephaloridine, cephalothin, cloxacillin, moxalactam, penicillin, piperacillin, and ticarcillin), amoxicillin, bacitracin, chloramphenicol, clindamycin, capreomycin, colistimethate, ciprofloxacin, doxycycline, erythromycin, fusidic acid, fosfomycin, fusidate sodium, gramicidin, gentamycin, lincomycin, minocycline, macrolides, monobactams, nalidixic acid, novobiocin, ofloxcin, rifamycins, tetracyclines, vancomycin, tobramycin, and trimethoprim.
[0048] Another aspect of the present disclosure relates to a composition comprising a nanobody polypeptide and an agent which can enhance, maintain, or facilitate the function or activity of the polypeptide. In one embodiment, the chemical is a protease inhibitor. The polypeptide is exposed to a protease-present environment where the presence of the protease may reduce the antimicrobial activity of the peptide via, for example, enzymatic degradation. The combination of a protease inhibitor and the polypeptide stabilizes the polypeptide from the protease degradation and thus enhances the activity of the nanobody polypeptide. The protease-present environment includes, for example, body fluid (e.g., urine, blood, serum, salvia, sputum, and mucosal fluid). The protease includes, for example, neutrophil elastase, proteinase-3, cycteine protease, metalloprotease, serine-protease, or other proteases derived from bacteria and/or hosts. The protease inhibitor includes, for example, BMF, EDTA, PMSF, benzamidine, and/or recombinant -1 antitrypsin (rAAT).
[0049] A. Disinfectant Compositions
[0050] The nanobody polypeptides of the present disclosure are useful in a variety of environments including industrial, clinical, the household, and personal care. The polypeptide compositions of the present disclosure for industrial, pharmaceutical, household and personal care use may comprise at least one active ingredient, of which the polypeptide of the present disclosure is an active ingredient acting alone, additively, or synergistically against the target microbe.
[0051] Accordingly, the nanobody compositions of the present disclosure may be used to form contact-killing coatings or layers on a variety of substrates including personal care products (e.g., toothbrushes, contact lens cases and dental equipment), healthcare products, household products, food preparation surfaces and packaging, and laboratory and scientific equipment. Further, other substrates include medical devices such as catheters, urological devices, blood collection and transfer devices, tracheotomy devices, intraocular lenses, wound dressings, sutures, surgical staples, membranes, shunts, gloves, tissue patches, prosthetic devices (e.g., heart valves) and wound drainage tubes. Still further, other substrates include textile products such as cacpets and fabrics, paints and joint cement. A further use is as an antimicrobial soil fumigant.
[0052] B. Pharmaceutical Compositions
[0053] The nanobody polypeptides of the present disclosure may be delivered in a pharmaceutically acceptable composition. The nanobody polypeptide(s) and any suitable carrier may be prepared for delivery in forms including solution, microemulsion, suspension or aerosol.
[0054] The nanobody polypeptides of the disclosure may be incorporated into a polymer, such as, for example, a polysaccharide, a glycol polymer, a polyester, a polyurethane, a polyacrylate, a poly acrylonitrile, a polyamide, a polyolefin, a polystyrene, a vinyl polymer, a polypropylene, silk, a biopolymer, and mixtures thereof.
[0055] In the compositions of the present disclosure, the polypeptides are typically present in an amount of about 0.000001 to about 99%. In other embodiments, the polypeptides are present in an amount of about 0.001 to about 50%. In other embodiments, the polypeptides are present in an amount of about 0.01 to about 25%.
[0056] In the nanobody compositions of the present disclosure, the carrier, or mixture of carriers, is typically present in an amount of about 1 to about 99% by weight of the composition. In other embodiments, the carrier, or mixture of carriers, is typically present in an amount of about 50 to about 99% by weight of said composition. In other embodiments, the carrier, or mixture of carriers, is typically present in an amount of 75 to about 99% by weight of said composition.
[0057] Where clinical applications are contemplated, it may be necessary to prepare pharmaceutical compositions comprising proteins, antibodies, and drugs in a form appropriate for the intended application. Generally, pharmaceutical compositions may comprise an effective amount of one or more of the polypeptides of the embodiments or additional agents dissolved or dispersed in a pharmaceutically acceptable carrier. The phrases pharmaceutical or pharmacologically acceptable refers to molecular entities and compositions that do not produce an adverse, allergic, or other untoward reaction when administered to an animal, such as, for example, a human, as appropriate. The preparation of a pharmaceutical composition that contains at least one polypeptide of the embodiments isolated by the method disclosed herein, or additional active ingredient will be known to those of skill in the art in light of the present disclosure, as exemplified by Remington's Pharmaceutical Sciences, 18th Ed., 1990, incorporated herein by reference. Moreover, for animal (e.g., human) administration, it will be understood that preparations should meet sterility, pyrogenicity, general safety, and purity standards as required by the FDA Office of Biological Standards.
[0058] As used herein, pharmaceutically acceptable carrier includes any and all solvents, dispersion media, coatings, surfactants, antioxidants, preservatives (e.g., antibacterial agents, antifungal agents), isotonic agents, absorption delaying agents, salts, preservatives, drugs, drug stabilizers, gels, binders, excipients, disintegration agents, lubricants, sweetening agents, flavoring agents, dyes, such like materials and combinations thereof, as would be known to one of ordinary skill in the art (see, for example, Remington's Pharmaceutical Sciences, 18th Ed., 1990, incorporated herein by reference). Except insofar as any conventional carrier is incompatible with the active ingredient, its use in the pharmaceutical compositions is contemplated.
[0059] Certain embodiments of the present disclosure may comprise different types of carriers depending on whether it is to be administered in solid, liquid, or aerosol form, and whether it needs to be sterile for the route of administration, such as injection. The compositions can be administered intravenously, intrathecally, intradermally, transdermally, intrathecally, intraarterially, intraperitoneally, intranasally, intravaginally, intrarectally, intramuscularly, subcutaneously, mucosally, orally, topically, locally, by inhalation (e.g., inhalation of a nebulized formulation), by injection, by infusion, by continuous infusion, by localized perfusion bathing target cells directly, via a catheter, via a lavage, in lipid compositions (e.g., liposomes), or by other methods or any combination of the forgoing as would be known to one of ordinary skill in the art (see, for example, Remington's Pharmaceutical Sciences, 18th Ed., 1990, incorporated herein by reference).
[0060] The nanobody polypeptides may be formulated into a composition in a free base, neutral, or salt form. Pharmaceutically acceptable salts include the acid addition salts, e.g., those formed with the free amino groups of a proteinaceous composition, or which are formed with inorganic acids, such as, for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric, or mandelic acid. Salts formed with the free carboxyl groups can also be derived from inorganic bases, such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides; or such organic bases as isopropylamine, trimethylamine, histidine, or procaine. Upon formulation, solutions will be administered in a manner compatible with the dosage formulation and in such amount as is therapeutically effective. The formulations are easily administered in a variety of dosage forms, such as formulated for parenteral administrations, such as injectable solutions, or aerosols for delivery to the lungs, or formulated for alimentary administrations, such as drug release capsules and the like.
[0061] Formulations suitable for oral administration may be in the form of capsules, cachets, pills, tablets, lozenges (using a flavored basis, usually sucrose and acacia or tragacanth), powders, granules, or as a solution or a suspension in an aqueous or non-aqueous liquid, or as an oil-in-water or water-in-oil liquid emulsion, or as an elixir or syrup, or as pastilles (using an inert base, such as gelatin and glycerin, or sucrose and acacia) and/or as mouth washes and the like, each containing a predetermined amount of an antimicrobial peptide as an active ingredient. A compound may also be administered as a bolus, electuary, or paste.
[0062] Further in accordance with certain aspects of the present disclosure, the composition suitable for administration may be provided in a pharmaceutically acceptable carrier with or without an inert diluent. The carrier should be assimilable and includes liquid, semi-solid, i.e., pastes, or solid carriers. Except insofar as any conventional media, agent, diluent, or carrier is detrimental to the recipient or to the therapeutic effectiveness of a composition contained therein, its use in administrable composition for use in practicing the methods is appropriate. Examples of carriers or diluents include fats, oils, water, saline solutions, lipids, liposomes, resins, binders, fillers, and the like, or combinations thereof. The composition may also comprise various antioxidants to retard oxidation of one or more component. Additionally, the prevention of the action of microorganisms can be brought about by preservatives, such as various antibacterial and antifungal agents, including but not limited to parabens (e.g., methylparabens, propylparabens), chlorobutanol, phenol, sorbic acid, thimerosal or combinations thereof.
[0063] In accordance with certain aspects of the present disclosure, the composition is combined with the carrier in any convenient and practical manner, i.e., by solution, suspension, emulsification, admixture, encapsulation, absorption, and the like. Such procedures are routine for those skilled in the art.
[0064] In a specific embodiment of the present disclosure, the composition is combined or mixed thoroughly with a semi-solid or solid carrier. The mixing can be carried out in any convenient manner, such as grinding. Stabilizing agents can be also added in the mixing process in order to protect the composition from loss of therapeutic activity, i.e., denaturation in the stomach. Examples of stabilizers for use in a composition include buffers, amino acids, such as glycine and lysine, carbohydrates or lyoprotectants, such as dextrose, mannose, galactose, fructose, lactose, sucrose, maltose, sorbitol, mannitol, etc.
[0065] In some aspects, a pharmaceutical formulation comprises one or more surfactants. Surfactants used in accordance with the disclosed methods include ionic and non-ionic surfactants. Representative non-ionic surfactants include polysorbates such as TWEEN-20 and TWEEN-80 surfactants (ICI Americas Inc. of Bridgewater, N.J.); poloxamers (e.g., poloxamer 188); TRITON surfactants (Sigma of St. Louis, Mo.); sodium dodecyl sulfate (SDS); sodium laurel sulfate; sodium octyl glycoside; lauryl-, myristyl-, linoleyl-, or stearyl-sulfobetaine; lauryl-, myristyl-, linoleyl- or stearyl-sarcosine; linoleyl-, myristyl-, or cetyl-betaine; lauroamidopropyl-, cocamidopropyl-, linoleamidopropyl-, myristamidopropyl-, palnidopropyl-, or (e.g., lauroamidopropyl); myristamidopropyl-, palmidopropyl-, or isostearamidopropyl-dimethylamine; sodium methyl cocoyl-, or disodium methyl oleyl-taurate; MONAQUAT surfactants (Mona Industries Inc. of Paterson, N.J.); polyethyl glycol; polypropyl glycol; block copolymers of ethylene and propylene glycol such as PLURONIC surfactants (BASF of Mt. Olive, N.J.); oligo (ethylene oxide) alkyl ethers; alkyl (thio) glucosides, alkyl maltosides; and phospholipids. For example, the surfactant can be present in a formulation in an amount from about 0.01% to about 0.5% (weight of surfactant relative to total weight of other solid components of the formulation; w/w), from about 0.03% to about 0.5% (w/w), from about 0.05% to about 0.5% (w/w), or from about 0.1% to about 0.5% (w/w). However, in further aspects, a pharmaceutical formulation of the embodiments is essentially free of non-ionic surfactants or essentially free of all surfactants.
[0066] With respect to the therapeutic methods of the present disclosure, it is not intended that the administration of the one or more polypeptides as disclosed herein or a mutant, variant, analog or derivative thereof be limited to a particular mode of administration, dosage, or frequency of dosing; the present disclosure contemplates all modes of administration, including intramuscular, intravenous, intraperitoneal, intravesicular, intraarticular, intralesional, subcutaneous, or any other route sufficient to provide a dose adequate to treat the inflammation-related disorder. The therapeutic may be administered to the patient in a single dose or in multiple doses. When multiple doses are administered, the doses may be separated from one another by, for example, one hour, three hours, six hours, eight hours, one day, two days, one week, two weeks, or one month. For example, the therapeutic may be administered for, e.g., 2, 3, 4, 5, 6, 7, 8, 10, 15, 20, or more weeks. It is to be understood that, for any particular subject, specific dosage regimes should be adjusted over time according to the individual need and the professional judgment of the person administering or supervising the administration of the compositions. For example, the dosage of the therapeutic can be increased if the lower dose does not provide sufficient therapeutic activity.
[0067] The term unit dose or dosage refers to physically discrete units suitable for use in a subject, each unit containing a predetermined quantity of the therapeutic composition calculated to produce the desired responses discussed above in association with its administration, i.e., the appropriate route and treatment regimen. The quantity to be administered, both according to number of treatments and unit dose, depends on the effect desired. The actual dosage amount of a composition of the present embodiments administered to a patient or subject can be determined by physical and physiological factors, such as body weight, the age, health, and sex of the subject, the type of disease being treated, the extent of disease penetration, previous or concurrent therapeutic interventions, idiopathy of the patient, the route of administration, and the potency, stability, and toxicity of the particular therapeutic substance. For example, a dose may also comprise from about 1 g/kg/body weight to about 1000 mg/kg/body weight (this such range includes intervening doses) or more per administration, and any range derivable therein. In non-limiting examples of a derivable range from the numbers listed herein, a range of about 5 g/kg/body weight to about 100 mg/kg/body weight, about 5 g/kg/body weight to about 500 mg/kg/body weight, etc., can be administered. The practitioner responsible for administration will, in any event, determine the concentration of active ingredient(s) in a composition and appropriate dose(s) for the individual subject. In some embodiments, the dosage of antigen-specific T cell infusion may comprise about 100 million to about 30 billion cells, such as 10, 15, or 20 billion cells.
[0068] While the attending physician ultimately will decide the appropriate amount and dosage regimen, therapeutically effective amounts of the one or more polypeptides as disclosed herein or a mutant, variant, analog or derivative thereof may be provided at a dose of 0.0001, 0.01, 0.01 0.1, 1, 5, 10, 25, 50, 100, 500, or 1,000 mg/kg or g/kg. A typical dosage, for example is about 0.01 to about 100 mg/kg of peptide. Effective doses may be extrapolated from dose-response curves derived from in vitro or animal model test bioassays or systems.
[0069] Dosages for a particular patient or subject can be determined by one of ordinary skill in the art using conventional considerations, (e.g. by means of an appropriate, conventional pharmacological protocol). A physician may, for example, prescribe a relatively low dose at first, subsequently increasing the dose until an appropriate response is obtained. The dose administered to a patient is sufficient to effect a beneficial therapeutic response in the patient over time, or, e.g., to reduce symptoms, or other appropriate activity, depending on the application. The dose is determined by the efficacy of the particular formulation, and the activity, stability or serum half-life of the one or more polypeptides as disclosed herein or a mutant, variant, analog or derivative thereof and the condition of the patient, as well as the body weight or surface area of the patient to be treated.
IV. Examples
[0070] The following examples are included to demonstrate preferred embodiments of the invention. It should be appreciated by those of skill in the art that the techniques disclosed in the examples which follow represent techniques discovered by the inventor to function well in the practice of the invention, and thus can be considered to constitute preferred modes for its practice. However, those of skill in the art should, in light of the present disclosure, appreciate that many changes can be made in the specific embodiments which are disclosed and still obtain a like or similar result without departing from the spirit and scope of the invention.
Example 1Materials and Methods
[0071] Generation and Identification of Nanobody Presenting Cells
[0072] The anti-GFP nanobody sequence, sequences for nanobodies encoding antimicrobial peptides (GFPNB: LGSMAQVQLVESGGALVQPGGSLRLSCAASGFPVNRYSMRWYRQAPGKEREWVAG MSSAGDRSSYEDSVKGRFTISRDDARNTVYLQMNSLKPEDTAVYYCNVNVGFEYW GQGTQVTVSSK; SEQ ID NO: 14), and the sequence coding for the HA peptide (2HA: YPYDVPDYAAYPYDVPDYAA; SEQ ID NO: 31) were synthesized by IDT, and were cloned into an IPTG-inducible LppOmpA vector and transformed into BL21(DE3) C2987 E. coli (NEB) per manufacture's instructions. Transformed E. coli was grown at 37 C., and the presence of the nanobody plasmid and insert were validated by PCR and Sanger sequencing. To evaluate surface presentation of nanobodies, flow cytometry was performed with cells presenting the anti-GFP nanobody or the HA antigen as a control, to determine GFP binding.
[0073] Surface Display Killing of Nanobodies Encoding Antimicrobial Peptides
[0074] E. coli cells presenting the GFP nanobody, or nanobodies presenting the antimicrobial peptide Ab15 or humanized Ab15 were grown in LB supplemented with carbenicillin overnight and diluted the following day to an OD600 0.01. For cultures in which nanobody expression was induced, IPTG was added at a concentration of either 0.1 mM or 1 mM to induce nanobody expression. Cells were cultured for 6 hours following IPTG induction, and OD600 values were measured hourly. E. coli expressing humanized antibody constructs with either GFP, or antimicrobial peptides Ec5, Ab15, or Cat3.
TABLE-US-00001 GFPNB: (SEQIDNO:14) LGSMAQVQLVESGGALVQPGGSLRLSCAASGFPVNRYSMRWYRQAPGKER EWVAGMSSAGDRSSYEDSVKGRFTISRDDARNTVYLQMNSLKPEDTAVYY CNVNVGFEYWGQGTQVTVSSK Ec5NB: (SEQIDNO:11) LGSMAQVQLVESGGALVQPGGSLRLSCAASGFPVNRYSMRWYRQAPGKER EWVAGMSSAGDRSSYEDSVKGRFTISRDDARNTVYLQMNSLKPEDTAVYY CIHRDQQHESFLDARPEPGLTEYWGQGTQVTVSSK Ab15NB: (SEQIDNO:2) LGSMAQVQLVESGGALVQPGGSLRLSCAASGFPVNRYSMRWYRQAPGKER EWVAGMSSAGDRSSYEDSVKGRFTISRDDARNTVYLQMNSLKPEDTAVYY CHYRALMLFHMRVRRRKLYWGQGTQVTVSSK Cat3NB: (SEQIDNO:9) LGSMAQVQLVESGGALVQPGGSLRLSCAASGFPVNRYSMRWYRQAPGKER EWVAGMSSAGDRSSYEDSVKGRFTISRDDARNTVYLQMNSLKPEDTAVYY CRLVRILVSKRPVAIKPYFRLYWGQGTQVTVSSK
[0075] Each of these were also evaluated for surface display killing. As above, cells transformed with the indicated nanobodies were grown with or without IPTG at a concentration of 1 mM. Optical density was measured at 2, 3.5, and 6 hours.
[0076] Protein Purification
[0077] The sequences for GFP nanobodies and Ab15 nanobodies were cloned into the pET28a expression vector, with a non-cleavable C-terminal 6-histidine tag. The resulting plasmids were then transformed into BL21(DE3) E. coli. The presence of the appropriate plasmid and inserts were confirmed by PCR. Cell cultures harboring the expression vectors were grown to log phase (OD600 0.5-0.8) and induced by the addition of IPTG. Cultures were incubated for 6 hours. Cultures were centrifuged at 8000 rpm for 15 minutes to pellet the cells. Cells were resuspended in 20 mM Tris (pH 7.5), 200 mM NaCl, 25 mM Imidazole and lysed by sonication. Cell lysates were then centrifuged to remove insoluble debris. Cleared lysates were run over NiNTA-agarose columns by gravity flow and eluted with a 150 mL gradient of 25 mM to 500 mM imidazole. Pure Ab15 nanobodies or GFP nanobodies were pooled and dialyzed into assay buffer containing 20 mM Tris (pH 7.5), and 50 mM NaCl. Samples were stored at 4 C.
[0078] Minimum Bactericidal Concentration
[0079] E. coli strain W3110 or A. baumannii strains Ab17978, Ab5075, or AYE were grown in Tris/NaCl/Glucose media, or the same media supplemented with GFP or CP1 nanobodies at a concentration of between 0.02 uM and 1.6 uM. Individual cultures were then subcultured onto LB agar plates and incubated overnight before evaluating the minimal bactericidal concentration of the CP1 nanobodies.
[0080] Minimum Inhibitory Concentration Determination
[0081] E. coli strain W3110 or A. baumannii strain Ab5075 were grown in Mueller Hinton media and diluted to OD 0.001. 50 uls of each strain was added to a 96 well plate. Wells were supplemented with 50 uls of 0-32 uM GFP nanobodies or CP1 nanobodies and evaluated for plate clearing overnight at 37 C.
[0082] Computational Methods
[0083] Sequence alignments of known nanobodies, and nanobodies disclosed herein were generated using ClustalW. Predicted structures were generated using ABodyBuilder, an automated antibody structure prediction softwar with data-driven accuracy estimation. Protein structures are depicted using PyMol.
Example 2Development and Characterization of Exemplary Nanobodies
[0084] Determination of Sites for Antimicrobial Peptide Insertion in Nanobodies
[0085] The framework and CDR sequences of a functional nanobody directed to bind GFP is shown in
[0086] Surface Display of Nanobodies with Antimicrobial Peptides Inhibit E. coli
[0087] To determine whether surface display of nanobodies may have antimicrobial activity, cells which can inducibly express GFP nanobody, Ab15 nanobody, or humanized Ab15 nanobody were cultured, and then expression of the nanobodies was induced by the addition of IPTG at the indicated concentrations (
[0088] Cells Displaying GFP Nanobodies Bind GFP
[0089] Cells transformed with GFP nanobody-LppOmpA or HA peptide-LppOmpA plasmids were subjected to GFP flow cytometry analysis (
[0090] Antimicrobial Activity of Exemplary Nanobodies
[0091] The growth of E. coli in the presence of various nanobodies was measured. The Ab15 nanobody was confirmed to have antimicrobial activity by strong inhibition of bacterial growth when induced with either 0.1 mM or 1 mM IPTG (
[0092] Antimicrobial Peptide Nanobodies Inhibit E. coli and A. baumannii
[0093] To test the efficacy of purified antimicrobial nanobodies, CP1 and GFP nanobodies were purified (
[0094] All of the methods disclosed and claimed herein can be made and executed without undue experimentation in light of the present disclosure. While the compositions and methods of this invention have been described in terms of preferred embodiments, it will be apparent to those of skill in the art that variations may be applied to the methods and in the steps or in the sequence of steps of the method described herein without departing from the concept, spirit and scope of the invention. More specifically, it will be apparent that certain agents which are both chemically and physiologically related may be substituted for the agents described herein while the same or similar results would be achieved. All such similar substitutes and modifications apparent to those skilled in the art are deemed to be within the spirit, scope and concept of the invention as defined by the appended claims.
REFERENCES
[0095] The following references, to the extent that they provide exemplary procedural or other details supplementary to those set forth herein, are specifically incorporated herein by reference. [0096] Conrath et al., Antimicrob Agents Chemother 45: 2807, 2001. [0097] Conrath et al., Protein Sci. 18:619, 2009. [0098] Desmyter et al., J Biol. Chem. 277:23645, 2002. [0099] Ewert et al., Biochemistry, 41(11):3628-3636. [0100] International Patent Publication No. WO 97/49805 [0101] International Patent Publication No. WO0043507 [0102] International Patent Publication No. WO0190190 [0103] International Patent Publication No. WO03025020 [0104] International Patent Publication No. WO03035694 [0105] International Patent Publication No. WO9937681 [0106] Kabat et al. (Sequence of proteins of immunological interest, US Public Health Services, NIH Bethesda, Md., Publication No. 91. [0107] Korotkov et al., Structure 17:255, 2009. [0108] Kyte and Doolittle, 1982. [0109] Lauwereys et al., EMBO J. 17(13): 3512-20, 1998. [0110] Remington's Pharmaceutical Sciences, 18th Ed., 1990 [0111] Riechmann and Muyldermans, J. Immunol. Methods 240 (1-2): 185-195, 2000. [0112] Saerens et al., Curr Opin Pharmacol. 8:600, 2008. [0113] Transue et al., Proteins 32(4): 515-22, 1998. [0114] U.S. Pat. No. 4,554,101 [0115] Ward et al., Nature 341, p. 544, 1989.