AAV-MEDIATED DELIVERY OF THERAPEUTIC ANTIBODIES TO THE INNER EAR
20210071149 ยท 2021-03-11
Inventors
- Emmanuel John Simons (Brookline, MA, US)
- Robert Ng (Newton, MA, US)
- Michael McKenna (Southborough, MA)
Cpc classification
C12N7/00
CHEMISTRY; METALLURGY
A61K9/0021
HUMAN NECESSITIES
C12N2750/14143
CHEMISTRY; METALLURGY
C07K2317/14
CHEMISTRY; METALLURGY
A61K48/005
HUMAN NECESSITIES
C07K2317/24
CHEMISTRY; METALLURGY
A61K9/19
HUMAN NECESSITIES
C07K2317/76
CHEMISTRY; METALLURGY
C07K16/22
CHEMISTRY; METALLURGY
International classification
C12N7/00
CHEMISTRY; METALLURGY
A61K48/00
HUMAN NECESSITIES
A61K9/00
HUMAN NECESSITIES
Abstract
Provided herein are methods that include introducing into an inner ear of a mammal a therapeutically effective amount of an adeno-associated virus (AAV) vector that includes a nucleotide sequence encoding (a) a polypeptide including an antibody heavy chain variable domain operably linked to a signal peptide and a polypeptide including an antibody light chain variable domain operably linked to a signal peptide; (b) a polypeptide including an antigen-binding antibody fragment operably linked to a signal peptide; or (c) a soluble vascular endothelial growth factor receptor operably linked to a signal peptide.
Claims
1. A method comprising introducing into an inner ear of a mammal a therapeutically effective amount of an adeno-associated virus (AAV) vector that comprises a nucleotide sequence encoding (a) a polypeptide comprising an antibody heavy chain variable domain operably linked to a signal peptide and a polypeptide comprising an antibody light chain variable domain operably linked to a signal peptide; or (b) a polypeptide comprising an antigen-binding antibody fragment operably linked to a signal peptide.
2. A method for increasing the level of an antibody or an antigen-binding antibody fragment in an inner ear of a mammal in need thereof, the method comprising: introducing into the inner ear of the mammal a therapeutically effective amount of an AAV vector that comprises a nucleotide sequence encoding (a) a polypeptide comprising an antibody heavy chain variable domain operably linked to a signal peptide and a polypeptide comprising an antibody light chain variable domain operably linked to a signal peptide; or (b) a polypeptide comprising an antigen-binding antibody fragment linked to a signal peptide; wherein the introducing results in an increase in the level of the antibody or the antigen-binding antibody fragment in the inner ear of the mammal.
3. The method of claim 1 or 2, wherein the antibody or the antigen-binding antibody fragment binds specifically to vascular endothelial growth factor (VEGF).
4. The method of claim 3, wherein the antibody or antigen-binding antibody fragment decreases VEGF activity.
5. The method of any one of claims 1-4, wherein the AAV vector further comprises one or both of a promoter and a Kozak sequence that are operably linked to the sequence encoding the antibody or the antigen-binding antibody fragment.
6. The method of claim 5, wherein the AAV vector comprises a promoter selected from the group consisting of: an inducible promoter, a constitutive promoter, and a tissue-specific promoter.
7. The method of any one of claims 1-6, wherein the AAV vector further comprises a polyadenylation signal sequence.
8. The method of any one of claims 1-7, wherein the mammal is a human.
9. The method of any one of claims 1-8, wherein the mammal has been identified as having an inner ear disorder.
10. The method of any one of claims 1-8, wherein the mammal has been diagnosed as having an inner ear disorder.
11. The method of any one of claims 1-10, wherein the AAV vector comprises a nucleic acid sequence encoding a polypeptide comprising an antibody heavy chain variable domain operably linked to a signal peptide and a polypeptide comprising an antibody light chain variable domain operably linked to a signal peptide.
12. The method of any one of claims 1-10, wherein the AAV vector comprises a nucleic acid sequence encoding a polypeptide comprising an antigen-binding antibody fragment operably linked to a signal.
13. A method for treating an inner ear disorder in a mammal in need thereof, the method comprising: introducing into the inner ear of the mammal a therapeutically effective amount of an AAV vector that comprises a nucleotide sequence encoding: (a) a polypeptide comprising an antibody heavy chain variable domain operably linked to a signal peptide and a polypeptide comprising an antibody light chain variable domain operably linked to a signal peptide; or (b) a polypeptide comprising an antigen-binding antibody fragment linked to a signal peptide; wherein the introducing results in the treatment of the inner ear disorder in the mammal.
14. The method of claim 13, wherein the AAV vector further comprises one or both of a promoter and a Kozak sequence that are operably linked to the sequence encoding the antibody or the antigen-binding antibody fragment.
15. The method of claim 14, wherein the AAV vector comprises a promoter selected from the group consisting of: an inducible promoter, a constitutive promoter, and a tissue-specific promoter.
16. The method of any one of claims 13-15, wherein the AAV vector further comprises a polyadenylation signal sequence.
17. The method of any one of claims 13-16, wherein the mammal is a human.
18. The method of any one of claims 13-17, wherein the mammal has been identified as having an inner ear disorder.
19. The method of any one of claims 13-17, wherein the mammal has been diagnosed as having an inner ear disorder.
20. The method of any one of claims 13-19, wherein the AAV vector comprises a nucleic acid sequence encoding a polypeptide comprising an antibody heavy chain variable domain operably linked to a signal peptide and a polypeptide comprising an antibody light chain variable domain operably linked to a signal peptide.
21. The method of any one of claims 13-19, wherein the AAV vector comprises a nucleic acid sequence encoding a polypeptide comprising an antigen-binding antibody fragment operably linked to a signal.
22. A method of reducing VEGF activity in an inner ear of a mammal in need thereof, the method comprising: introducing into the inner ear of the mammal a therapeutically effective amount of an AAV vector that comprises a nucleotide sequence encoding (a) a polypeptide comprising an antibody heavy chain variable domain operably linked to a signal peptide and a polypeptide comprising an antibody light chain variable domain operably linked to a signal peptide; or (b) a polypeptide comprising an antigen-binding antibody fragment linked to a signal peptide; wherein the polypeptide of (a) encodes an antibody that binds specifically to VEGF and reduces VEGF activity, the polypeptide of (b) encodes an antigen-binding antibody fragment that binds specifically to VEGF and reduces VEGF activity; wherein the introducing results in a reduction in VEGF activity in the inner ear of the mammal.
23. The method of claim 22, wherein the AAV vector further comprises one or both of a promoter and a Kozak sequence that are operably linked to the sequence encoding the antibody or the antigen-binding antibody fragment.
24. The method of claim 23, wherein the AAV vector comprises a promoter selected from the group consisting of: an inducible promoter, a constitutive promoter, and a tissue-specific promoter.
25. The method of any one of claims 22-24, wherein the AAV vector further comprises a polyadenylation signal sequence.
26. The method of any one of claims 22-25, wherein the mammal is a human.
27. The method of any one of claims 22-26, wherein the mammal has been identified or diagnosed as having an acoustic neuroma.
28. The method of any one of claims 22-26, wherein the mammal has been identified or diagnosed as having a vestibular schwannoma.
29. The method of any one of claims 22-26, wherein the mammal has been identified or diagnosed as having a neurofibromatosis type 2.
30. The method of any one of claims 22-29, wherein the AAV vector comprises a nucleic acid sequence encoding a polypeptide comprising an antibody heavy chain variable domain operably linked to a signal peptide and a polypeptide comprising an antibody light chain variable domain operably linked to a signal peptide.
31. The method of any one of claims 22-29, wherein the AAV vector comprises a nucleic acid sequence encoding a polypeptide comprising an antigen-binding antibody fragment operably linked to a signal peptide.
32. A method of treating acoustic neuroma, vestibular schwannoma, or neurofibromatosis type 2 in an inner ear of a mammal, the method comprising: introducing into the inner ear of the mammal a therapeutically effective amount of an AAV vector that comprises a nucleotide sequence encoding (a) a polypeptide comprising an antibody heavy chain variable domain operably linked to a signal peptide and a polypeptide comprising an antibody light chain variable domain operably linked to a signal peptide; or (b) a polypeptide comprising an antigen-binding antibody fragment linked to a signal peptide; wherein the polypeptide of (a) encodes an antibody that binds specifically to VEGF and reduces VEGF activity, the polypeptide of (b) encodes an antigen-binding antibody fragment that binds specifically to VEGF and reduces VEGF activity; wherein the introducing results in treatment of acoustic neuroma, vestibular schwannoma, or neurofibromatosis type II, respectively, in the inner ear of the mammal.
33. The method of claim 32, wherein the AAV vector further comprises one or both of a promoter and a Kozak sequence that are operably linked to the sequence encoding the antibody or the antigen-binding antibody fragment.
34. The method of claim 33, wherein the AAV vector comprises a promoter selected from the group consisting of: an inducible promoter, a constitutive promoter, and a tissue-specific promoter.
35. The method of any one of claims 32-34, wherein the AAV vector further comprises a polyadenylation signal sequence.
36. The method of any one of claims 32-35, wherein the mammal is a human.
37. The method of any one of claims 32-36, wherein the mammal has been identified or diagnosed as having an acoustic neuroma.
38. The method of any one of claims 32-36, wherein the mammal has been identified or diagnosed as having a vestibular schwannoma.
39. The method of any one of claims 32-36, wherein the mammal has been identified or diagnosed as having neurofibromatosis type 2.
40. The method of any one of claims 32-39, wherein the AAV vector comprises a nucleic acid sequence encoding a polypeptide comprising an antibody heavy chain variable domain operably linked to a signal peptide and a polypeptide comprising an antibody light chain variable domain operably linked to a signal peptide.
41. The method of any one of claims 32-40, wherein the AAV vector comprises a nucleic acid sequence encoding a polypeptide comprising an antigen-binding antibody fragment operably linked to a signal peptide.
42. The method of any one of claims 1-41, wherein the antibody comprises a Fc region that includes one or more amino acid substitutions that decreases the half-life of the antibody in a mammal as compared to a control antibody; or the antigen-binding antibody fragment thereof has a decreased in vivo half-life as compared to a control antigen-binding antibody fragment.
43. A method comprising introducing into an inner ear of a mammal a therapeutically effective amount of an adeno-associated virus (AAV) vector that comprises a nucleotide sequence encoding a soluble vascular endothelial growth factor (VEGF) receptor operably linked to a signal peptide.
44. A method for increasing the level of a soluble vascular endothelial growth factor (VEGF) receptor in an inner ear of a mammal in need thereof, the method comprising: introducing into the inner ear of the mammal a therapeutically effective amount of an AAV vector that comprises a nucleotide sequence encoding a soluble VEGF receptor operably linked to a signal peptide; wherein the introducing results in an increase in the level of the soluble VEGF receptor in the inner ear of the mammal.
45. The method of claim 43 or 44, wherein the soluble VEGF receptor comprises a portion of an extracellular region of VEGF receptor-1 (VEGFR-1).
46. The method of claim 45, wherein the portion of the extracellular region of VEGFR-1 comprises a contiguous sequence from wildtype human VEGFR-1.
47. The method of claim 46, wherein the portion of the extracellular region of VEGFR-1 comprises one or more immunoglobulin-like domains in the extracellular region from wildtype human VEGFR-1.
48. The method of claim 45, wherein the portion of the extracellular region of VEGFR-1 comprises a sequence that is at least 90% identical to a contiguous sequence from wildtype human VEGFR-1.
49. The method of claim 43 or 44, wherein the soluble VEGF receptor comprises a portion of an extracellular region of VEGF receptor-2 (VEGFR-2).
50. The method of claim 49, wherein the portion of the extracellular region of VEGFR-2 comprises a contiguous sequence from wildtype human VEGFR-2.
51. The method of claim 50, wherein the portion of the extracellular region of VEGFR-2 comprises one or more immunoglobulin-like domains in the extracellular region from wildtype human VEGFR-2.
52. The method of claim 49, wherein the portion of the extracellular region of VEGFR-2 comprises a sequence that is at least 90% identical to a contiguous sequence from wildtype human VEGFR-2.
53. The method of claim 43 or 44, wherein the soluble VEGF receptor comprises a portion of an extracellular region of VEGFR-1 and a portion of an extracellular region of VEGFR-2.
54. The method of claim 53, wherein: the portion of the extracellular region of VEGFR-1 comprises one or more immunoglobulin-like domains in the extracellular region from wildtype human VEGFR-1; and the portion of the extracellular region of VEGFR-2 comprises one or more immunoglobulin-like domains in the extracellular region from wildtype human VEGFR-2.
55. The method of claim 54, wherein the soluble VEGF receptor is aflibercept.
56. The method of claim 43 or 44, wherein the soluble VEGF receptor comprises a portion of an extracellular region of VEGF receptor-3 (VEGFR-3).
57. The method of claim 56, wherein the portion of the extracellular region of VEGFR-3 comprises a contiguous sequence from wildtype human VEGFR-3.
58. The method of claim 57, wherein the portion of the extracellular region of VEGFR-3 comprises one or more immunoglobulin-like domains in the extracellular region from wildtype human VEGFR-3.
59. The method of claim 56, wherein the portion of the extracellular region of VEGFR-3 comprises a sequence that is at least 90% identical to a contiguous sequence from wildtype human VEGFR-3.
60. The method of any one of claims 43-59, wherein the soluble VEGF receptor comprises a Fc domain.
61. The method of claim 60, wherein the Fc domain is an IgG1 Fc domain.
62. The method of claim 61, wherein the IgG1 Fc domain is a human wildtype IgG1 Fc domain.
63. The method of any one of claims 43-62, wherein the soluble VEGF receptor decreases the ability of a VEGF to bind to one or more of VEGFR-1, VEGFR-2, and VEGFR-3.
64. The method of any one of claims 43-63, wherein the AAV vector further comprises one or both of a promoter and a Kozak sequence that are operably linked to the sequence encoding the soluble VEGF receptor.
65. The method of claim 64, wherein the AAV vector comprises a promoter selected from the group consisting of: an inducible promoter, a constitutive promoter, and a tissue-specific promoter.
66. The method of any one of claims 43-65, wherein the AAV vector further comprises a polyadenylation signal sequence.
67. The method of any one of claims 43-66, wherein the mammal is a human.
68. The method of any one of claims 43-67, wherein the mammal has been identified as having an inner ear disorder.
69. The method of any one of claims 43-67, wherein the mammal has been diagnosed as having an inner ear disorder.
70. A method for treating an inner ear disorder in a mammal in need thereof, the method comprising: introducing into the inner ear of the mammal a therapeutically effective amount of an AAV vector that comprises a nucleotide sequence encoding a soluble vascular endothelial growth factor (VEGF) receptor operably linked to a signal peptide; wherein the introducing results in the treatment of the inner ear disorder in the mammal.
71. The method of claim 70, wherein the AAV vector further comprises one or both of a promoter and a Kozak sequence that are operably linked to the sequence encoding the soluble VEGF receptor.
72. The method of claim 71, wherein the AAV vector comprises a promoter selected from the group consisting of: an inducible promoter, a constitutive promoter, and a tissue-specific promoter.
73. The method of any one of claims 70-72, wherein the AAV vector further comprises a polyadenylation signal sequence.
74. The method of any one of claims 70-73, wherein the mammal is a human.
75. The method of any one of claims 70-74, wherein the mammal has been identified as having an inner ear disorder.
76. The method of any one of claims 70-74, wherein the mammal has been diagnosed as having an inner ear disorder.
77. A method of reducing a VEGF activity in an inner ear of a mammal in need thereof, the method comprising: introducing into the inner ear of the mammal a therapeutically effective amount of an AAV vector that comprises a nucleotide sequence encoding a soluble vascular endothelial growth factor (VEGF) receptor operably linked to a signal peptide; wherein the introducing results in a reduction in the VEGF activity in the inner ear of the mammal.
78. The method of claim 77, wherein the AAV vector further comprises one or both of a promoter and a Kozak sequence that are operably linked to the sequence encoding the soluble VEGF receptor.
79. The method of claim 78, wherein the AAV vector comprises a promoter selected from the group consisting of: an inducible promoter, a constitutive promoter, and a tissue-specific promoter.
80. The method of any one of claims 77-79, wherein the AAV vector further comprises a polyadenylation signal sequence.
81. The method of any one of claims 77-80, wherein the mammal is a human.
82. The method of any one of claims 77-81, wherein the mammal has been identified or diagnosed as having an acoustic neuroma.
83. The method of any one of claims 77-81, wherein the mammal has been identified or diagnosed as having a vestibular schwannoma.
84. The method of any one of claims 77-81, wherein the mammal has been identified or diagnosed as having a neurofibromatosis type 2.
85. A method of treating acoustic neuroma, vestibular schwannoma, or neurofibromatosis type 2 in an inner ear of a mammal, the method comprising: introducing into the inner ear of the mammal a therapeutically effective amount of an AAV vector that comprises a nucleotide sequence encoding a nucleotide sequence encoding a soluble vascular endothelial growth factor (VEGF) receptor operably linked to a signal peptide; wherein the introducing results in treatment of acoustic neuroma, vestibular schwannoma, or neurofibromatosis type II, respectively, in the inner ear of the mammal.
86. The method of claim 85, wherein the AAV vector further comprises one or both of a promoter and a Kozak sequence that are operably linked to the sequence encoding the soluble VEGF receptor.
87. The method of claim 86, wherein the AAV vector comprises a promoter selected from the group consisting of: an inducible promoter, a constitutive promoter, and a tissue-specific promoter.
88. The method of any one of claims 85-87, wherein the AAV vector further comprises a polyadenylation signal sequence.
89. The method of any one of claims 85-88, wherein the mammal is a human.
90. The method of any one of claims 85-89, wherein the mammal has been identified or diagnosed as having an acoustic neuroma.
91. The method of any one of claims 85-89, wherein the mammal has been identified or diagnosed as having a vestibular schwannoma.
92. The method of any one of claims 85-89, wherein the mammal has been identified or diagnosed as having neurofibromatosis type 2.
93. The method of any one of claims 70-92, wherein the soluble VEGF receptor comprises a portion of an extracellular region of VEGF receptor-1 (VEGFR-1).
94. The method of claim 93, wherein the portion of the extracellular region of VEGFR-1 comprises a contiguous sequence from wildtype human VEGFR-1.
95. The method of claim 94, wherein the portion of the extracellular region of VEGFR-1 comprises one or more immunoglobulin-like domains in the extracellular region from wildtype human VEGFR-1.
96. The method of claim 93, wherein the portion of the extracellular region of VEGFR-1 comprises a sequence that is at least 90% identical to a contiguous sequence from wildtype human VEGFR-1.
97. The method of any one of claims 70-92, wherein the soluble VEGF receptor comprises a portion of an extracellular region of VEGF receptor-2 (VEGFR-2).
98. The method of claim 97, wherein the portion of the extracellular region of VEGFR-2 comprises a contiguous sequence from wildtype human VEGFR-2.
99. The method of claim 98, wherein the portion of the extracellular region of VEGFR-2 comprises one or more immunoglobulin-like domains in the extracellular region from wildtype human VEGFR-2.
100. The method of claim 97, wherein the portion of the extracellular region of VEGFR-2 comprises a sequence that is at least 90% identical to a contiguous sequence from wildtype human VEGFR-2.
101. The method of any one of claims 70-92, wherein the soluble VEGF receptor comprises a portion of an extracellular region of VEGFR-1 and a portion of an extracellular region of VEGFR-2.
102. The method of claim 101, wherein: the portion of the extracellular region of VEGFR-1 comprises one or more immunoglobulin-like domains in the extracellular region from wildtype human VEGFR-1; and the portion of the extracellular region of VEGFR-2 comprises one or more immunoglobulin-like domains in the extracellular region from wildtype human VEGFR-2.
103. The method of claim 102, wherein the soluble VEGF receptor is aflibercept.
104. The method of any one of claims 70-92, wherein the soluble VEGF receptor comprises a portion of an extracellular region of VEGF receptor-3 (VEGFR-3).
105. The method of claim 104, wherein the portion of the extracellular region of VEGFR-3 comprises a contiguous sequence from wildtype human VEGFR-3.
106. The method of claim 105, wherein the portion of the extracellular region of VEGFR-3 comprises one or more immunoglobulin-like domains in the extracellular region from wildtype human VEGFR-3.
107. The method of claim 104, wherein the portion of the extracellular region of VEGFR-3 comprises a sequence that is at least 90% identical to a contiguous sequence from wildtype human VEGFR-3.
108. The method of any one of claims 70-107, wherein the soluble VEGF receptor comprises a Fc domain.
109. The method of claim 108, wherein the Fc domain is an IgG1 Fc domain.
110. The method of claim 109, wherein the IgG1 Fc domain is a human wildtype IgG1 Fc domain.
111. The method of any one of claims 70-110, wherein the soluble VEGF receptor decreases the ability of a VEGF to bind to one or more of VEGFR-1, VEGFR-2, and VEGFR-3.
112. The method of any one of claims 43-111, wherein the AAV vector further comprises a secretion sequence.
Description
BRIEF DESCRIPTION OF DRAWINGS
[0078]
[0079]
[0080]
[0081]
[0082]
[0083]
[0084]
[0085]
[0086]
[0087]
DETAILED DESCRIPTION
[0088] Provided herein are methods that include introducing into an inner ear of a mammal a therapeutically effective amount of an adeno-associated virus (AAV) vector that includes a nucleotide sequence encoding: (a) a polypeptide including an antibody heavy chain variable domain operably linked to a signal peptide and a polypeptide including an antibody light chain variable domain operably linked to a signal peptide; or (b) a polypeptide including an antigen-binding antibody fragment (e.g., a Fab or a scFv)operably linked to a signal peptide.
[0089] Also provided herein are methods for increasing the level of an antibody or an antigen-binding antibody fragment in an inner ear of a mammal in need thereof, that include: introducing into the inner ear of the mammal a therapeutically effective amount of an AAV vector that includes a nucleotide sequence encoding: (a) a polypeptide including an antibody heavy chain variable domain operably linked to a signal peptide and a polypeptide including an antibody light chain variable domain operably linked to a signal peptide; or (b) a polypeptide including an antigen-binding antibody fragment (e.g., a Fab or a scFv) operably linked to a signal peptide; wherein the introducing results in an increase in the level of the antibody or the antigen-binding antibody fragment in the inner ear of the mammal.
[0090] Also provided are methods for treating an inner ear disorder in a mammal in need thereof that include introducing into the inner ear of the mammal a therapeutically effective amount of an AAV vector that includes a nucleotide sequence encoding: (a) a polypeptide including an antibody heavy chain variable domain operably linked to a signal peptide and a polypeptide comprising an antibody light chain variable domain operably linked to a signal peptide; or (b) a polypeptide comprising an antigen-binding antibody fragment linked to a signal peptide; where the introducing results in the treatment of the inner ear disorder in the mammal.
[0091] Also provided herein are methods of reducing VEGF activity in an inner ear of a mammal in need thereof that include: introducing into the inner ear of the mammal a therapeutically effective amount of an AAV vector that includes a nucleotide sequence encoding (a) a polypeptide including an antibody heavy chain variable domain operably linked to a signal peptide and a polypeptide including an antibody light chain variable domain operably linked to a signal peptide; or (b) a polypeptide including an antigen-binding antibody fragment (e.g., a Fab or a scFv) operably linked to a signal peptide; wherein the polypeptide of (a) encodes an antibody that binds specifically to VEGF and reduces VEGF activity, the polypeptide of (b) encodes an antigen-binding antibody fragment that binds specifically to VEGF and reduces VEGF activity; and wherein the introducing results in a reduction in VEGF activity in the inner ear of the mammal.
[0092] Also provided herein are methods of treating acoustic neuroma, vestibular schwannoma, or neurofibromatosis type II in an inner ear of a mammal that include: introducing into the inner ear of the mammal a therapeutically effective amount of an AAV vector that includes a nucleotide sequence encoding (a) a polypeptide including an antibody heavy chain variable domain operably linked to a signal peptide and a polypeptide including an antibody light chain variable domain operably linked to a signal peptide; or (b) a polypeptide including an antigen-binding antibody fragment (e.g., a Fab or a scFv) operably linked to a signal peptide; wherein the polypeptide of (a) encodes an antibody that binds specifically to VEGF and reduces VEGF activity, the polypeptide of (b) encodes an antigen-binding antibody fragment that binds specifically to VEGF and reduces VEGF activity; and wherein the introducing results in treatment of acoustic neuroma or vestibular schwannoma in the inner ear of the mammal.
[0093] Also provided herein are methods that include introducing into an inner ear of a mammal a therapeutically effective amount of an adeno-associated virus (AAV) vector that include a nucleotide sequence encoding a soluble vascular endothelial growth factor (VEGF) receptor operably linked to a signal peptide.
[0094] Also provided herein are methods for increasing the level of a soluble vascular endothelial growth factor (VEGF) receptor in an inner ear of a mammal in need thereof that include introducing into the inner ear of the mammal a therapeutically effective amount of an AAV vector that includes a nucleotide sequence encoding a soluble VEGF receptor operably linked to a signal peptide; where the introducing results in an increase in the level of the soluble VEGF receptor in the inner ear of the mammal.
[0095] Also provided herein are methods for treating an inner ear disorder in a mammal in need thereof that include introducing into the inner ear of the mammal a therapeutically effective amount of an AAV vector that includes a nucleotide sequence encoding a soluble vascular endothelial growth factor (VEGF) receptor operably linked to a signal peptide; where the introducing results in the treatment of the inner ear disorder in the mammal.
[0096] Also provided herein are methods of reducing a VEGF activity in an inner ear of a mammal in need thereof that include introducing into the inner ear of the mammal a therapeutically effective amount of an AAV vector that includes a nucleotide sequence encoding a soluble vascular endothelial growth factor (VEGF) receptor operably linked to a signal peptide; where the introducing results in a reduction in the VEGF activity in the inner ear of the mammal.
[0097] Also provided herein are methods of treating acoustic neuroma, vestibular schwannoma, or neurofibromatosis type 2 in an inner ear of a mammal that include introducing into the inner ear of the mammal a therapeutically effective amount of an AAV vector that includes a nucleotide sequence encoding a nucleotide sequence encoding a soluble vascular endothelial growth factor (VEGF) receptor operably linked to a signal peptide; where the introducing results in treatment of acoustic neuroma, vestibular schwannoma, or neurofibromatosis type II, respectively, in the inner ear of the mammal.
[0098] Also provided are kits that include any of the AAV vectors described herein.
[0099] Additional non-limiting aspects of the compositions, kits, and methods are described herein and can be used in any combination without limitation.
Antibodies and Antigen-Binding Antibody Fragments
[0100] In some embodiments, the antibody can be a humanized antibody, a chimeric antibody, or a multivalent antibody. In some embodiments, an antibody or an antigen-binding antibody fragment can be a scFv-Fc, a V.sub.HH domain, a V.sub.NAR domain, a (scFv).sub.2, a minibody, or a BiTE. In some embodiments, an antibody or an antigen-binding antibody fragment can be a DVD-Ig, and a dual-affinity re-targeting antibody (DART), a triomab, kih IgG with a common LC, a crossmab, an ortho-Fab IgG, a 2-in-1-IgG, IgG-ScFv, scFv.sub.2-Fc, a bi-nanobody, tanden antibody, a DART-Fc, a scFv-HAS-scFv, DNL-Fab3, DAF (two-in-one or four-in-one), DutaMab, DT-IgG, knobs-in-holes common LC, knobs-in-holes assembly, charge pair antibody, Fab-arm exchange antibody, SEEDbody, Triomab, LUZ-Y, Fcab, k-body, orthogonal Fab, DVD-IgG, IgG(H)-scFv, scFv-(H)IgG, IgG(L)-scFv, scFv-(L)-IgG, IgG (L,H)-Fc, IgG(H)-V, V(H)-IgG, IgG(L)-V, V(L)-IgG, KIH IgG-scFab, 2scFv-IgG, IgG-2scFv, scFv4-Ig, Zybody, DVI-IgG, nanobody, nanobody-HSA, a diabody, a TandAb, scDiabody, scDiabody-CH3, Diabody-CH3, Triple Body, miniantibody, minibody, TriBi minibody, scFv-CH3 KIH, Fab-scFv, scFv-CH-CL-scFv, F(ab).sub.2-scFV.sub.2, scFv-KIH, Fab-scFv-Fc, tetravalent HCAb, scDiabody-Fc, diabody-Fc, tandem scFv-Fc, intrabody, dock and lock bispecific antibody, ImmTAC, HSAbody, scDiabody-HAS, tandem scFv, IgG-IgG, Cov-X-Body, and seFv1-PEG-seFv2.
[0101] Additional examples of an antibody or an antigen-binding antibody fragment include an Fv fragment, a Fab fragment, a F(ab).sub.2 fragment, and a Fab fragment. Additional examples of an antibody or an antigen-binding antibody fragment include an antigen-binding fragment of an IgG (e.g., an antigen-binding fragment of IgG1, IgG2, IgG3, or IgG4) (e.g., an antigen-binding fragment of a human or humanized IgG, e.g., human or humanized IgG1, IgG2, IgG3, or IgG4); an antigen-binding fragment of an IgA (e.g., an antigen-binding fragment of IgA1 or IgA2) (e.g., an antigen-binding fragment of a human or humanized IgA, e.g., a human or humanized IgA1 or IgA2); an antigen-binding fragment of an IgD (e.g., an antigen-binding fragment of a human or humanized IgD); an antigen-binding fragment of an IgE (e.g., an antigen-binding fragment of a human or humanized IgE); or an antigen-binding fragment of an IgM (e.g., an antigen-binding fragment of a human or humanized IgM).
[0102] Any of the antibodies or antigen-binding antibody fragments described herein can bind specifically to VEGF.
[0103] A V.sub.HH domain is a single monomeric variable antibody domain that can be found in camelids. A V.sub.NAR domain is a single monomeric variable antibody domain that can be found in cartilaginous fish. Non-limiting aspects of V.sub.HH domains and V.sub.NAR domains are described in, e.g., Cromie et al., Curr. Top. Med. Chem. 15:2543-2557, 2016; De Genst et al., Dev. Comp. Immunol. 30:187-198, 2006; De Meyer et al., Trends Biotechnol. 32:263-270, 2014; Kijanka et al., Nanomedicine 10:161-174, 2015; Kovaleva et al., Expert. Opin. Biol. Ther. 14:1527-1539, 2014; Krah et al., Immunopharmacol. Immunotoxicol. 38:21-28, 2016; Mujic-Delic et al., Trends Pharmacol. Sci. 35:247-255, 2014; Muyldermans, J. Biotechnol. 74:277-302, 2001; Muyldermans et al., Trends Biochem. Sci. 26:230-235, 2001; Muyldermans, Ann. Rev. Biochem. 82:775-797, 2013; Rahbarizadeh et al., Immunol. Invest. 40:299-338, 2011; Van Audenhove et al., EBioMedicine 8:40-48, 2016; Van Bockstaele et al., Curr. Opin. Investig. Drugs 10:1212-1224, 2009; Vincke et al., Methods Mol. Biol. 911:15-26, 2012; and Wesolowski et al., Med. Microbiol. Immunol. 198:157-174, 2009.
[0104] A Fv fragment includes a non-covalently-linked dimer of one heavy chain variable domain and one light chain variable domain.
[0105] A Fab fragment includes, the constant domain of the light chain and the first constant domain (C.sub.H1) of the heavy chain, in addition to the heavy and light chain variable domains of the Fv fragment.
[0106] A F(ab).sub.2 fragment includes two Fab fragments joined, near the hinge region, by disulfide bonds.
[0107] A dual variable domain immunoglobulin or DVD-Ig refers to multivalent and multispecific binding proteins as described, e.g., in DiGiammarino et al., Methods Mol. Biol. 899:145-156, 2012; Jakob et al., MABs 5:358-363, 2013; and U.S. Pat. Nos. 7,612,181; 8,258,268; 8,586,714; 8,716,450; 8,722,855; 8,735,546; and 8,822,645, each of which is incorporated by reference in its entirety.
[0108] DARTs are described in, e.g., Garber, Nature Reviews Drug Discovery 13:799-801, 2014.
[0109] Additional aspects of antibodies and antigen-binding antibody fragments are known in the art.
[0110] In some embodiments, any of the antibodies or antigen-binding antibody fragments described herein has a dissociation constant (K.sub.D) of less than 110.sup.5 M (e.g., less than 0.510.sup.5 M, less than 110.sup.6 M, less than 0.510.sup.6 M, less than 110.sup.7 M, less than 0.510.sup.7 M, less than 110.sup.8 M, less than 0.510.sup.8 M, less than 110.sup.9 M, less than 0.510.sup.9 M, less than 110.sup.10 M, less than 0.510.sup.10 M, less than 110.sup.11 M, less than 0.510.sup.11 M, or less than 110.sup.12 M), e.g., as measured in phosphate buffered saline using surface plasmon resonance (SPR) for a VEGF protein (e.g., any of the VEGF proteins described herein, e.g., one or more of mature human VEGF-A, mature human VEGF-B, mature human VEGF-C, and mature human VEGF-D).
[0111] In some embodiments, any of the antibodies or antigen-binding antibody fragments described herein has a K.sub.D of about 110.sup.12 M to about 110.sup.5 M, about 0.510.sup.5 M, about 110.sup.6 M, about 0.510.sup.6 M, about 110.sup.7 M, about 0.510.sup.7 M, about 110.sup.8 M, about 0.510.sup.8 M, about 110.sup.9 M, about 0.510.sup.9 M, about 110.sup.10 M, about 0.510.sup.10 M, about 110.sup.11 M, or about 0.510.sup.11 M (inclusive); about 0.510.sup.11 M to about 110.sup.5 M, about 0.510.sup.5 M, about 110.sup.6 M, about 0.510.sup.6 M, about 110.sup.7 M, about 0.510.sup.7 M, about 110.sup.8 M, about 0.510.sup.8 M, about 110.sup.9 M, about 0.510.sup.9 M, about 110.sup.10 M, about 0.510.sup.10 M, or about 110.sup.11 M (inclusive); about 110.sup.11 M to about 110.sup.5 M, about 0.510.sup.5 M, about 110.sup.6 M, about 0.510.sup.6 M, about 110.sup.7 M, about 0.510.sup.7 M, about 110.sup.8 M, about 0.510.sup.8 M, about 110.sup.9 M, about 0.510.sup.9 M, about 110.sup.10 M, or about 0.510.sup.10 M (inclusive); about 0.510.sup.10 M to about 110.sup.5 M, about 0.510.sup.5 M, about 110.sup.6 M, about 0.510.sup.6 M, about 110.sup.7 M, about 0.510.sup.7 M, about 110.sup.8 M, about 0.510.sup.8 M, about 110.sup.9 M, about 0.510.sup.9 M, or about 110.sup.10 M (inclusive); about 110.sup.10 M to about 110.sup.5 M, about 0.510.sup.5 M, about 110.sup.6 M, about 0.510.sup.6 M, about 110.sup.7 M, about 0.510.sup.7 M, about 110.sup.8 M, about 0.510.sup.8 M, about 110.sup.9 M, or about 0.510.sup.9 M (inclusive); about 0.510.sup.9 M to about 110.sup.5 M, about 0.510.sup.5 M, about 110.sup.6 M, about 0.510.sup.6 M, about 110.sup.7 M, about 0.510.sup.7 M, about 110.sup.8 M, about 0.510.sup.8 M, or about 110.sup.9 M (inclusive); about 110.sup.9 M to about 110.sup.5 M, about 0.510.sup.5 M, about 110.sup.6 M, about 0.510.sup.6 M, about 110.sup.7 M, about 0.510.sup.7 M, about 110.sup.8 M, or about 0.510.sup.8 M (inclusive); about 0.510.sup.8 M to about 110.sup.5 M, about 0.510.sup.5 M, about 110.sup.6 M, about 0.510.sup.6 M, about 110.sup.7 M, about 0.510.sup.7 M, or about 110.sup.8 M (inclusive); about 110.sup.8 M to about 110.sup.5 M, about 0.510.sup.5 M, about 110.sup.6 M, about 0.510.sup.6 M, about 110.sup.7 M, or about 0.510.sup.7 M (inclusive); about 0.510.sup.7 M to about 110.sup.5 M, about 0.510.sup.5 M, about 110.sup.6 M, about 0.510.sup.6 M, or about 110.sup.7 M (inclusive); about 110.sup.7 M to about 110.sup.5 M, about 0.510.sup.5 M, about 110.sup.6 M, or about 0.510.sup.6 M (inclusive); about 0.510.sup.6 M to about 110.sup.5 M, about 0.510.sup.5 M, or about 110.sup.6 M (inclusive); about 110.sup.6 M to about 110.sup.5 M or about 0.510.sup.5 M (inclusive); or about 0.510.sup.5 M to about 110.sup.5 M (inclusive), e.g., as measured in phosphate buffered saline using surface plasmon resonance (SPR), for a VEGF protein (e.g., any of the VEGF proteins described herein, e.g., one or more of mature human VEGF-A, mature human VEGF-B, mature human VEGF-C, and mature human VEGF-D).
[0112] A variety of different methods known in the art can be used to determine the K.sub.D values of any of the antibodies or antigen-binding antibody fragments described herein (e.g., an electrophoretic mobility shift assay, a filter binding assay, surface plasmon resonance, and a biomolecular binding kinetics assay, etc.).
[0113] In some embodiments of any of the antibodies and/or antigen-binding antibody fragments described herein, the half-life of the antibody and/or the antigen-binding antibody fragment in a subject (e.g., a human) is decreased about 0.5-fold to about 4-fold (e.g., about 0.5-fold to about 3.5-fold, about 0.5-fold to about 3-fold, about 0.5-fold to about 2.5-fold, about 0.5-fold to about 2-fold, about 0.5-fold to about 1.5-fold, about 0.5-fold to about 1-fold, about 1-fold to about 4-fold, about 1-fold to about 3.5-fold, about 1-fold to about 3-fold, about 1-fold to about 2.5-fold, about 1-fold to about 2-fold, about 1.5-fold to about 4-fold, about 1.5-fold to about 3.5-fold, about 1.5-fold to about 3-fold, about 1.5-fold to about 2.5-fold, about 1.5-fold to about 2-fold, about 2-fold to about 4-fold, about 2-fold to about 3.5-fold, about 2-fold to about 3-fold, about 2-fold to about 2.5-fold, about 2.5-fold to about 4-fold, about 2.5-fold to about 3.5-fold, about 2.5-fold to about 3-fold, about 3-fold to about 4-fold, about 3-fold to about 3.5-fold, or about 3.5-fold to about 4-fold) as compared to the half-life of a control antibody and/or a control antigen-binding antibody fragment (e.g., any of the control antibodies and control antigen-binding antibody fragments described herein) in a similar subject. See, e.g., Leabman et al., MAbs. 5(6): 896-903, 2013. In some embodiments, an antibody or antigen-binding antibody fragment described herein has one or more amino acid substitutions in the Fc region that decrease its half-life in a mammal, and a control antibody lacks at least one (e.g., lacks all) of these one or more amino acid substiutions in the Fc region.
VEGF
[0114] The VEGF gene encodes vascular endothelial growth factor (VEGF), formerly known as fms-like tyrosine kinase (Flt-1). The VEGF protein is a heparin-biding protein that induces migration and proliferation of vascular endothelial cells.
[0115] Non-limiting examples of protein and nucleotide sequences encoding a wildtype VEGF protein are shown below.
TABLE-US-00001 HumanVEGFTranscriptVariant1ProteinSequence (SEQIDNO:1) MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGV ALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEE KEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVA RRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHH AKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIE YIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEM SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGAR CCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLEL NERTCRCDKPRR HumanVEGFTranscriptVariant1cDNA (SEQIDNO:2) ctgacggacagacagacagacaccgcccccagccccagctac cacctcctccccggccggcggcggacagtggacgcggcgg cgagccgcgggcaggggccggagcccgcgcccggaggcgg ggtggagggggtcggggctcgcggcgtcgcactgaaactt ttcgtccaacttctgggctgttctcgcttcggaggagccg tggtccgcgcgggggaagccgagccgagcggagccgcgag aagtgctagctcgggccgggaggagccgcagccggaggag ggggaggaggaagaagagaaggaagaggagagggggccgc agtggcgactcggcgctcggaagccgggctcatggacggg tgaggcggcggtgtgcgcagacagtgctccagccgcgcgc gctccccaggccctggcccgggcctcgggccggggaggaa gagtagctcgccgaggcgccgaggagagcgggccgcccca cagcccgagccggagagggagcgcgagccgcgccggcccc ggtcgggcctccgaaaccatgaactttctgctgtcttggg tgcattggagccttgccttgctgctctacctccaccatgc caagtggtcccaggctgcacccatggcagaaggaggaggg cagaatcatcacgaagtggtgaagttcatggatgtctatc agcgcagctactgccatccaatcgagaccctggtggacat cttccaggagtaccctgatgagatcgagtacatcttcaag ccatcctgtgtgcccctgatgcgatgcgggggctgctgca atgacgagggcctggagtgtgtgcccactgaggagtccaa catcaccatgcagattatgcggatcaaacctcaccaaggc cagcacataggagagatgagcttcctacagcacaacaaat gtgaatgcagaccaaagaaagatagagcaagacaagaaaa aaaatcagttcgaggaaagggaaaggggcaaaaacgaaag cgcaagaaatcccggtataagtcctggagcgtgtacgttg gtgcccgctgctgtctaatgccctggagcctccctggccc ccatccctgtgggccttgctcagagcggagaaagcatttg tttgtacaagatccgcagacgtgtaaatgttcctgcaaaa acacagactcgcgttgcaaggcgaggcagcttgagttaaa cgaacgtacttgcagatgtgacaagccgaggcggtga HumanVEGFTranscriptVariant3ProteinSequence (SEQIDNO:3) MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGV ALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEE KEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVA RRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHH AKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIE YIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEM SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRPCGPCSERRKH LFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR HumanVEGFTranscriptVariant3cDNA (SEQIDNO:4) ctgacggacagacagacagacaccgcccccagccccagctac cacctcctccccggccggcggcggacagtggacgcggcgg cgagccgcgggcaggggccggagcccgcgcccggaggcgg ggtggagggggtcggggctcgcggcgtcgcactgaaactt ttcgtccaacttctgggctgttctcgcttcggaggagccg tggtccgcgcgggggaagccgagccgagcggagccgcgag aagtgctagctcgggccgggaggagccgcagccggaggag ggggaggaggaagaagagaaggaagaggagagggggccgc agtggcgactcggcgctcggaagccgggctcatggacggg tgaggcggcggtgtgcgcagacagtgctccagccgcgcgc gctccccaggccctggcccgggcctcgggccggggaggaa gagtagctcgccgaggcgccgaggagagcgggccgcccca cagcccgagccggagagggagcgcgagccgcgccggcccc ggtcgggcctccgaaaccatgaactttctgctgtcttggg tgcattggagccttgccttgctgctctacctccaccatgc caagtggtcccaggctgcacccatggcagaaggaggaggg cagaatcatcacgaagtggtgaagttcatggatgtctatc agcgcagctactgccatccaatcgagaccctggtggacat cttccaggagtaccctgatgagatcgagtacatcttcaag ccatcctgtgtgcccctgatgcgatgcgggggctgctgca atgacgagggcctggagtgtgtgcccactgaggagtccaa catcaccatgcagattatgcggatcaaacctcaccaaggc cagcacataggagagatgagcttcctacagcacaacaaat gtgaatgcagaccaaagaaagatagagcaagacaagaaaa aaaatcagttcgaggaaagggaaaggggcaaaaacgaaag cgcaagaaatcccgtccctgtgggccttgctcagagcgga gaaagcatttgtttgtacaagatccgcagacgtgtaaatg ttcctgcaaaaacacagactcgcgttgcaaggcgaggcag cttgagttaaacgaacgtacttgcagatgtgacaagccga ggcggtga MatureHumanVEGF-A (SEQIDNO:13) apmaegggqnhhevvkfmdvyqrsychpietlvd ifqeypdeieyifkpscvplmrcggccndeglecvptees nitmqimrikphqgqhigemsflghnkcecrpkkdrarqe kksvrgkgkgqkrkrkksrykswsvyvgarcclmpwslpg phpcgpcserrkhlfvqdpqtckcsckntdsrckarqlel nertcrcdkprr MatureHumanVEGF-B (SEQIDNO:14) pvsqpdapghqrkvvswidvytratcqprevvvpltvel mgtvakqlvpscvtvqrcggccpddglecvptgqhqvrmq ilmirypssqlgemsleehsqcecrpkkkdsavkpdraat phhrpqprsvpgwdsapgapspadithptpapgpsahaap sttsaltpgpaaaaadaaassvakgga MatureHumanVEGF-C (SEQIDNO:15) Ahynteilksidnewrktqcmprevcidvgkefgvatnt ffkppcvsvyrcggccnseglqcmntstsylsktifeitv plsqgpkpvtisfanhtscrcmskldvyrqvhsiirr MatureHumanVEGF-D (SEQIDNO:16) faatfydietlkvideewqrtqcspretcvevaselgkstnt ffkppcvnvfrcggccneeslicmntstsyiskqlfeisv pltsvpelvpvkvanhtgckclptaprhpysiirr
[0116] In some examples of any of the antibodies and antigen-binding fragments thereof described herein, the antibody and antigen-binding fragment can bind to a VEGF antigen (e.g., any of the exemplary VEGF proteins described herein, e.g., one or more of mature human VEGF-A, mature human VEGF-B, mature human VEGF-C, and mature human VEGF-D) (e.g., any of the binding affinities described herein).
[0117] In some embodiments described herein, an antibody or antigen-binding antibody fragment can decrease an activity of a VEGF (e.g., one or more of any of the exemplary VEGF proteins described herein, e.g., one or more of mature human VEGF-A, mature human VEGF-B, mature human VEGF-C, and mature human VEGF-D). In some embodiments, an antibody or antigen-binding antibody fragment can block a VEGF (e.g., one or more of any of the exemplary VEGF proteins described herein, e.g., one or more of mature human VEGF-A, mature human VEGF-B, mature human VEGF-C, and mature human VEGF-D) from binding to one or more of its receptors (e.g., one or more VEGF receptors) See, e.g., WO 1998/045331, U.S. Pat. No. 9,079,953, US 2015/0147317, US 2016/0289314, Plotkin et al., Otology & Neurotology 33: 1046-1052 (2012); and Ferrara et al. (2005) Biochem Biophys Res Commun 333(2): 328-335. In some embodiments, an antibody or antigen-binding antibody can decrease downstream signaling (e.g., signaling downstream of a VEGF receptor, e.g., one or more of any of the exemplary VEGF receptors described herein, e.g., one or more of human VEGFR-1, human VEGFR-2, and human VEGFR-3). In some embodiments, a decrease in an activity of a VEGF can be detected indirectly, e.g., through an increase in hearing (e.g., a 1% to about 400% increase (or any of the subranges of this range described herein) in hearing) or a decrease (e.g., a 1% to 99%, a 1% to 95%, a 1% to 90%, a 1% to 85%, a 1% to 80%, a 1% to 75%, a 1% to 70%, a 1% to 65%, a 1% to 60%, a 1% to 55%, a 1% to 50%, a 1% to 45%, a 1% to 40%, a 1% to 35%, a 1% to 30%, a 1% to 25%, a 1% to 20%, a 1% to 15%, a 1% to 10%, a 1% to 5%, a 5% to 99%, a 5% to 95%, a 5% to 90%, a 5% to 85%, a 5% to 80%, a 5% to 75%, a 5% to 70%, a 5% to 65%, a 5% to 60%, a 5% to 55%, a 5% to 50%, a 5% to 45%, a 5% to 40%, a 5% to 35%, a 5% to 30%, a 5% to 25%, a 5% to 20%, a 5% to 15%, a 5% to 10%, a 10% to 99%, a 10% to 95%, a 10% to 90%, a 10% to 85%, a 10% to 80%, a 10% to 75%, a 10% to 70%, a 10% to 65%, a 10% to 60%, a 10% to 55%, a 10% to 50%, a 10% to 45%, a 10% to 40%, a 10% to 35%, a 10% to 30%, a 10% to 25%, a 10% to 20%, a 10% to 15%, a 15% to 99%, a 15% to 95%, a 15% to 90%, a 15% to 85%, a 15% to 80%, a 15% to 75%, a 15% to 70%, a 15% to 65%, a 15% to 60%, a 15% to 55%, a 15% to 50%,a 15% to 45%,a 15% to 40%, a 15% to 35%, a 15% to 30%, a 15% to 25%, a 15% to 20%, a 20% to 99%, a 20% to 95%, a 20% to 90%, a 20% to 85%, a 20% to 80%, a 20% to 75%, a 20% to 70%, a 20% to 65%, a 20% to 60%, a 20% to 55%, a 20% to 50%, a 20% to 45%, a 20% to 40%, a 20% to 35%, a 20% to 30%, a 20% to 25%, a 25% to 99%, a 25% to 95%, a 25% to 90%, a 25% to 85%, a 25% to 80%, a 25% to 75%, a 25% to 70%, a 25% to 65%, a 25% to 60%, a 25% to 55%, a 25% to 50%, a 25% to 45%, a 25% to 40%, a 25% to 35%, a 25% to 30%, a 30% to 99%, a 30% to 95%, a 30% to 90%, a 30% to 85%, a 30% to 80%, a 30% to 75%, a 30% to 70%, a 30% to 65%, a 30% to 60%, a 30% to 55%, a 30% to 50%, a 30% to 45%, a 30% to 40%, a 30% to 35%, a 35% to 99%, a 35% to 95%, a 35% to 90%, a 35% to 85%, a 35% to 80%, a 35% to 75%, a 35% to 70%, a 35% to 65%, a 35% to 60%, a 35% to 55%, a 35% to 50%, a 35% to 45%, a 35% to 40%, a 40% to 99%, a 40% to 95%, a 40% to 90%, a 40% to 85%, a 40% to 80%, a 40% to 75%, a 40% to 70%, a 40% to 65%, a 40% to 60%, a 40% to 55%, a 40% to 50%, a 40% to 45%, a 45% to 99%, a 45% to 95%, a 45% to 90%, a 45% to 85%, a 45% to 80%, a 45% to 75%, a 45% to 70%, a 45% to 65%, a 45% to 60%, a 45% to 55%, a 45% to 50%, a 50% to 99%, a 50% to 95%, a 50% to 90%, a 50% to 85%, a 50% to 80%, a 50% to 75%, a 50% to 70%, a 50% to 65%, a 50% to 60%, a 50% to 55%, a 55% to 99%, a 55% to 95%, a 55% to 90%, a 55% to 85%, a 55% to 80%, a 55% to 75%, a 55% to 70%, a 55% to 65%, a 55% to 60%, a 60% to 99%, a 60% to 95%, a 60% to 90%, a 60% to 85%, a 60% to 80%, a 60% to 75%, a 60% to 70%, a 60% to 65%, a 65% to 99%, a 65% to 95%, a 65% to 90%, a 65% to 85%, a 65% to 80%, a 65% to 75%, a 65% to 70%, a 70% to 99%, a 70% to 95%, a 70% to 90%, a 70% to 85%, a 70% to 80%, a 70% to 75%, a 75% to 99%, a 75% to 95%, a 75% to 90%, a 75% to 85%, a 75% to 80%, a 80% to 99%, a 80% to 95%, a 80% to 90%, a 80% to 85%, a 85% to 99%, a 85% to 95%, a 85% to 90%, a 90% to 99%, a 90% to 95%, or a 95% to 99% decrease) in the size or the severity of one or more symptoms of an acoustic neuroma, vestibular schwannoma, or neurofibromatosis type II in a mammal as compared to the level of hearing or size of an acoustic neuroma, vestibular schwannoma, or neurofibromatosis type II in the mammal, respectively, before administration of any of the AAV vectors described herein. In some embodiments, a decrease in a VEGF activity can be detected in an in vitro assay.
[0118] In some embodiments, the antibody that specifically binds to a VEGF is bevacizumab (Avastatin) or an antigen-binding fragment thereof. Bevacizumab (full size antibody150 kDa) inhibits all isoforms of VEGF-A. Bevacizumab received Food and Drug administration (FDA) approval in 2004 for colon cancer for intravenous (IV) dose of 4.0-7.5 mg/kg at 2-3 weeks (plasmatic half life 21 days), for intravetrial (IVT) dose 1.25 mg in 0.05 mL (half-life 5.6 days). Bevacizumab has a KD for VEGF 165 (VEGF-A) of 58 pM. See, e.g., WO 2017/050825. In some embodiments, the antibody that specifically binds to a VEGF is ranibizumab (Lucentis), or an antigen-binding fragment thereof. Ranibizumab (50 kDa) inhibits all isoforms of VEGF-A. Ranibizumab received FDA approval in 2006 for ocular use for intravenous (IV) dose of 4.0-7.5 mg/kg at 2-3 weeks (plasma half life of 0.5 days), for intravetrial (IVT) dose 0.5 mg in 0.05 mL (half-life of 3.2 days). Ranibizumab has a KD for VEGF 165 (VEGF-A) of 46 pM. See, e.g., WO 2014/178078. In some embodiments, the antibody that specifically binds to VEGF is sevacizumab (APX003/SIM-BD0801), or an antigen-binding fragment thereof.
TABLE-US-00002 AminoAcidEncodingLightChainof Bevacizumab (SEQIDNO:5) DIQMTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQKPGKAPKVLIYF TSSLHSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYSTVPWTFGQ GTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG LSSPVTKSFNRGEC AminoAcidEncodingHeavyChainof Bevacizumab (SEQIDNO:6) EVQLVESGGGLVQPGGSLRLSCAASGYTFTNYGMNWVRQAPGKGLEWVGW INTYTGEPTYAADFKRRFTFSLDTSKSTAYLQMNSLRAEDTAVYYCAKYP HYYGSSHWYFDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGC LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG TQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFP PKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPR EPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT PPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGK
[0119] In some embodiments of the antibodies that specifically bind to VEGF and antigen-binding fragments thereof described herein, the antibody or antigen-binding fragments thereof includes a variable light chain domain that is or includes a sequence that is at least 80% identical (e.g., at least 82%, at least 84%, at least 86%, at least 88%, at least 90%, at least 92%, at least 94%, at least 96%, at least 98%, or at least 99%) identical to the variable light chain domain of bevacizumab, and/or includes a variable heavy chain domain that is or includes a sequence that is at least 80% identical (e.g., at least 82%, at least 84%, at least 86%, at least 88%, at least 90%, at least 92%, at least 94%, at least 96%, at least 98%, or at least 99%) identical to the variable heavy chain domain of bevacizumab.
[0120] In some embodiments of the antibodies that specifically bind to VEGF and antigen-binding fragments thereof described herein, the antibody or antigen-binding fragments thereof includes a variable light chain domain that is or includes the variable light chain domain of bevacizumab, and/or a variable heavy chain domain that is or includes the variable heavy chain domain of bevacizumab. In some embodiments of the antibodies that specifically bind to VEGF and antigen-binding fragments thereof described herein, the antibody or antigen-binding fragments thereof includes a variable light chain domain that is or includes the sequence of variable light chain domain of bevacizumab, except that it includes one, two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, or fifteen amino acid substitutions, and/or includes a variable heavy chain domain that is or includes the sequence of variable heavy chain of bevacizumab, except that it includes one, two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, or fifteen amino acid substitutions. In some embodiments the first antigen-binding domain includes the three CDRs in the light chain variable domain of bevacizumab, and/or the three CDRs in the heavy chain variable domain of bevacizumab.
TABLE-US-00003 AminoAcidEncodingLightChainof Ranibizumab (SEQIDNO:7) DIQLTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQKPGKAPKVLIYF TSSLHSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYSTVPWTFGQ GTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG LSSPVTKSFNRGEC AminoAcidEncodingHeavyChainof Ranibizumab (SEQIDNO:8) EVQLVESGGGLVQPGGSLRLSCAASGYDFTHYGMNWVRQAPGKGLEWVGW INTYTGEPTYAADFKRRFTFSLDTSKSTAYLQMNSLRAEDTAVYYCAKYP YYYGTSHWYFDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGC LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG TQTYICNVNHKPSNTKVDKKVEPKSCDKTHL
[0121] In some embodiments of the antibodies that specifically bind to VEGF and antigen-binding fragments thereof described herein, the antibody or antigen-binding fragments thereof includes a variable light chain domain that is or includes a sequence that is at least 80% identical (e.g., at least 82%, at least 84%, at least 86%, at least 88%, at least 90%, at least 92%, at least 94%, at least 96%, at least 98%, or at least 99%) identical to the variable light chain domain of ranibizumab, and/or includes a variable heavy chain domain that is or includes a sequence that is at least 80% identical (e.g., at least 82%, at least 84%, at least 86%, at least 88%, at least 90%, at least 92%, at least 94%, at least 96%, at least 98%, or at least 99%) identical to the variable heavy chain domain of ranibizumab.
[0122] In some embodiments of the antibodies that specifically bind to VEGF and antigen-binding fragments thereof described herein, the antibody or antigen-binding fragments thereof includes a variable light chain domain that is or includes the variable light chain domain of ranibizumab, and/or a variable heavy chain domain that is or includes the variable heavy chain domain of ranibizumab. In some embodiments of the antibodies that specifically bind to VEGF and antigen-binding fragments thereof described herein, the antibody or antigen-binding fragments thereof includes a variable light chain domain that is or includes the sequence of variable light chain domain of ranibizumab, except that it includes one, two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, or fifteen amino acid substitutions, and/or includes a variable heavy chain domain that is or includes the sequence of variable heavy chain of ranibizumab, except that it includes one, two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, or fifteen amino acid substitutions. In some embodiments the first antigen-binding domain includes the three CDRs in the light chain variable domain of ranibizumab, and/or the three CDRs in the heavy chain variable domain of ranibizumab.
Soluble VEGF Receptors
[0123] A soluble VEGF receptor is a polypeptide that includes a portion of an extracellular region of one or more (e.g., two or three) mammalian VEGF receptor(s) (e.g., one or more of VEGFR-1, VEGFR-2, and VEGFR-3) operably linked to a signal peptide (e.g., any of the exemplary signal peptides described herein), where the soluble VEGF receptor is capable of specifically binding to one or more mammalian VEGF protein(s) (e.g., one or more (e.g., two, three, or four) of VEGF-A, VEGF-B, VEGF-C, and VEGF-D, e.g., one or more (e.g., two, three, or four) of human wildtype VEGF-A, human wildtype VEGF-B, human wildtype VEGF-C, and human wildtype VEGF-D).
[0124] In some examples, a soluble VEGF receptor includes a portion (e.g., about 10 amino acids to about 732 amino acids, about 10 amino acids to about 700 amino acids, about 10 amino acids to about 650 amino acids, about 10 amino acids to about 600 amino acids, about 10 amino acids to about 550 amino acids, about 10 amino acids to about 500 amino acids, about 10 amino acids to about 450 amino acids, about 10 amino acids to about 400 amino acids, about 10 amino acids to about 350 amino acids, about 10 amino acids to about 300 amino acids, about 10 amino acids to about 250 amino acids, about 10 amino acids to about 200 amino acids, about 10 amino acids to about 150 amino acids, about 10 amino acids to about 100 amino acids, about 10 amino acids to about 50 amino acids, about 50 amino acids to about 732 amino acids, about 50 amino acids to about 700 amino acids, about 50 amino acids to about 650 amino acids, about 50 amino acids to about 600 amino acids, about 50 amino acids to about 550 amino acids, about 50 amino acids to about 500 amino acids, about 50 amino acids to about 450 amino acids, about 50 amino acids to about 400 amino acids, about 50 amino acids to about 350 amino acids, about 50 amino acids to about 300 amino acids, about 50 amino acids to about 250 amino acids, about 50 amino acids to about 200 amino acids, about 50 amino acids to about 150 amino acids, about 50 amino acids to about 100 amino acids, about 100 amino acids to about 732 amino acids, about 100 amino acids to about 700 amino acids, about 100 amino acids to about 650 amino acids, about 100 amino acids to about 600 amino acids, about 100 amino acids to about 550 amino acids, about 100 amino acids to about 500 amino acids, about 100 amino acids to about 450 amino acids, about 100 amino acids to about 400 amino acids, about 100 amino acids to about 350 amino acids, about 100 amino acids to about 300 amino acids, about 100 amino acids to about 250 amino acids, about 100 amino acids to about 200 amino acids, about 100 amino acids to about 150 amino acids, about 150 amino acids to about 732 amino acids, about 150 amino acids to about 700 amino acids, about 150 amino acids to about 650 amino acids, about 150 amino acids to about 600 amino acids, about 150 amino acids to about 550 amino acids, about 150 amino acids to about 500 amino acids, about 150 amino acids to about 450 amino acids, about 150 amino acids to about 400 amino acids, about 150 amino acids to about 350 amino acids, about 150 amino acids to about 300 amino acids, about 150 amino acids to about 250 amino acids, about 150 amino acids to about 200 amino acids, about 200 amino acids to about 732 amino acids, about 200 amino acids to about 700 amino acids, about 200 amino acids to about 650 amino acids, about 200 amino acids to about 600 amino acids, about 200 amino acids to about 550 amino acids, about 200 amino acids to about 500 amino acids, about 200 amino acids to about 450 amino acids, about 200 amino acids to about 400 amino acids, about 200 amino acids to about 350 amino acids, about 200 amino acids to about 300 amino acids, about 200 amino acids to about 250 amino acids, about 250 amino acids to about 732 amino acids, about 250 amino acids to about 700 amino acids, about 250 amino acids to about 650 amino acids, about 250 amino acids to about 600 amino acids, about 250 amino acids to about 550 amino acids, about 250 amino acids to about 500 amino acids, about 250 amino acids to about 450 amino acids, about 250 amino acids to about 400 amino acids, about 250 amino acids to about 350 amino acids, about 250 amino acids to about 300 amino acids, about 300 amino acids to about 732 amino acids, about 300 amino acids to about 700 amino acids, about 300 amino acids to about 650 amino acids, about 300 amino acids to about 600 amino acids, about 300 amino acids to about 550 amino acids, about 300 amino acids to about 500 amino acids, about 300 amino acids to about 450 amino acids, about 300 amino acids to about 400 amino acids, about 300 amino acids to about 350 amino acids, about 350 amino acids to about 732 amino acids, about 350 amino acids to about 700 amino acids, about 350 amino acids to about 650 amino acids, about 350 amino acids to about 600 amino acids, about 350 amino acids to about 550 amino acids, about 350 amino acids to about 500 amino acids, about 350 amino acids to about 450 amino acids, about 350 amino acids to about 400 amino acids, about 400 amino acids to about 732 amino acids, about 400 amino acids to about 700 amino acids, about 400 amino acids to about 650 amino acids, about 400 amino acids to about 600 amino acids, about 400 amino acids to about 550 amino acids, about 400 amino acids to about 500 amino acids, about 400 amino acids to about 450 amino acids, about 450 amino acids to about 732 amino acids, about 450 amino acids to about 700 amino acids, about 450 amino acids to about 650 amino acids, about 450 amino acids to about 600 amino acids, about 450 amino acids to about 550 amino acids, about 450 amino acids to about 500 amino acids, about 500 amino acids to about 732 amino acids, about 500 amino acids to about 700 amino acids, about 500 amino acids to about 650 amino acids, about 500 amino acids to about 600 amino acids, about 500 amino acids to about 550 amino acids, about 550 amino acids to about 732 amino acids, about 550 amino acids to about 700 amino acids, about 550 amino acids to about 650 amino acids, about 550 amino acids to about 600 amino acids, about 600 amino acids to about 732 amino acids, about 600 amino acids to about 700 amino acids, about 600 amino acids to about 650 amino acids, about 650 amino acids to about 732 amino acids, about 650 amino acids to about 700 amino acids, or about 700 amino acids to about 732 amino acids) of an extracellular region of VEGFR-1 (e.g., a contiguous sequence from wildtype human VEGFR-1 (e.g., a contiguous sequence including one or more (e.g., one, two, three, four, five, six, or seven) immunoglobulin-like domains in the extracellular region from wildtype human VEGFR-1 (e.g., SEQ ID NO: 23) or a sequence that is at least 80% (e.g., at least 82%, at least 84%, at least 86%, at least 88%, at least 90%, at least 92%, at least 94%, at least 96%, at least 98%, or at least 99%) identical to a contiguous sequence from wildtype human VEGFR-1, e.g., a sequence that is at least 80% (e.g., least 82%, at least 84%, at least 86%, at least 88%, at least 90%, least 92%, at least 94%, at least 96%, at least 98%, or at least 99%) identical to a contiguous sequence in SEQ ID NO: 23).
[0125] In some examples, a soluble VEGF receptor includes a portion (e.g., about 20 amino acids to about 745 amino acids, or any of the subranges of this range described herein) of an extracellular region of VEGFR-2 (e.g., a contiguous sequence from wildtype human VEGFR-2 (e.g., a contiguous sequence including one or more (e.g., one, two, three, four, five, six, or seven) immunoglobulin-like domains in the extracellular region from wildtype human VEGFR-2 (e.g., SEQ ID NO: 26) or a sequence that is at least 80% (e.g., at least 82%, at least 84%, at least 86%, at least 88%, at least 90%, at least 92%, at least 94%, at least 96%, at least 98%, or at least 99%) identical to a contiguous sequence from wildtype human VEGFR-2, e.g., a sequence that is at least 80% (e.g., at least 82%, at least 84%, at least 86%, at least 88%, at least 90%, at least 92%, at least 94%, at least 96%, at least 98%, or at least 99%) identical to a contiguous sequence in SEQ ID NO: 26).
[0126] In some examples, a soluble VEGF receptor includes a portion of an extracellular region of VEGFR-1 (e.g., any of the portions of an extracellular region of VEGFR-1 described herein) and a portion of an extracellular region of VEGFR-2 (e.g., any of the portions of an extracellular region of VEGFR-2 described herein). For example, a soluble VEGF receptor can include one or more (e.g., two, three, four, five, six, or seven) immunoglobulin-like domains in the extracellular region from wildtype human VEGFR-1 and one or more (e.g., two, three, four, five, six, or seven) immunoglobulin-like domains in the extracellular region from wildtype human VEGFR-2 (e.g., aflibercept).
[0127] In some examples, a soluble VEGF receptor includes a portion (e.g., about 20 amino acids to about 751 amino acids, or any of the subranges of this range described herein) of an extracellular region of VEGFR-3 (e.g., a contiguous sequence from wildtype human VEGFR-3 (e.g., a contiguous sequence including one or more (e.g., one, two, three, four, five, six, or seven) immunoglobulin-like domains in the extracellular region from wildtype human VEGFR-3 (e.g., SEQ ID NO: 29) or a sequence that is at least 80% (e.g., at least 82%, at least 84%, at least 86%, at least 88%, at least 90%, at least 92%, at least 94%, at least 96%, at least 98%, or at least 99%) identical to a contiguous sequence from wildtype human VEGFR-3, e.g., a sequence that is at least 80% (e.g., at least 82%, at least 84%, at least 86%, at least 88%, at least 90%, at least 92%, at least 94%, at least 96%, at least 98%, or at least 99%) identical to a contiguous sequence in SEQ ID NO: 29).
[0128] Non-limiting examples of extracellular regions of different mammalian VEGFR-1, different mammalian VEGFR-2, and different mammalian VEGFR-3 are described herein. Non-limiting examples of protein and nucleotide sequences encoding a wildtype VEGF receptor protein are shown below. As one skilled in the art can appreciate, a substitution in an amino acid that is conserved between species is more likely to result in a change in the function of a protein, while a substitution in an amino acid position that is not converved between species is less likely to have an affect on the function of a protein.
TABLE-US-00004 HumanVEGFReceptor1Isoform2Protein Sequence (SEQIDNO:17) MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLH LQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQAN HTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTE GRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYK EIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVL NCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDK MQNKDKGLYTCRVRSGPSFKSVNTSVHIYDKAFITVKHRKQQVLETVAGK RSYRLSMKVKAFPSPEVVWLKDGLPATEKSARYLTRGYSLIIKDVTEEDA GNYTILLSIKQSNVFKNLTATLIVNVKPQIYEKAVSSFPDPALYPLGSRQ ILTCTAYGIPQPTIKWFWHPCNHNHSEARCDFCSNNEESFILDADSNMGN RIESITQRMAIIEGKNKMASTLVVADSRISGIYICIASNKVGTVGRNISF YITDVPNGFHVNLEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTM HYSISKQKMAITKEHSITLNLTIMNVSLQDSGTYACRARNVYTGEEILQK KEITIRGEHCNKKAVFSRISKFKSTRNDCTTQSNVKH HumanVEGFReceptor1Isoform2cDNA (SEQIDNO:18) ATGGTCAGCTACTGGGACACCGGGGTCCTGCTGTGCGCGCTGCTCAGCTG TCTGCTTCTCACAGGATCTAGTTCAGGTTCAAAATTAAAAGATCCTGAAC TGAGTTTAAAAGGCACCCAGCACATCATGCAAGCAGGCCAGACACTGCAT CTCCAATGCAGGGGGGAAGCAGCCCATAAATGGTCTTTGCCTGAAATGGT GAGTAAGGAAAGCGAAAGGCTGAGCATAACTAAATCTGCCTGTGGAAGAA ATGGCAAACAATTCTGCAGTACTTTAACCTTGAACACAGCTCAAGCAAAC CACACTGGCTTCTACAGCTGCAAATATCTAGCTGTACCTACTTCAAAGAA GAAGGAAACAGAATCTGCAATCTATATATTTATTAGTGATACAGGTAGAC CTTTCGTAGAGATGTACAGTGAAATCCCCGAAATTATACACATGACTGAA GGAAGGGAGCTCGTCATTCCCTGCCGGGTTACGTCACCTAACATCACTGT TACTTTAAAAAAGTTTCCACTTGACACTTTGATCCCTGATGGAAAACGCA TAATCTGGGACAGTAGAAAGGGCTTCATCATATCAAATGCAACGTACAAA GAAATAGGGCTTCTGACCTGTGAAGCAACAGTCAATGGGCATTTGTATAA GACAAACTATCTCACACATCGACAAACCAATACAATCATAGATGTCCAAA TAAGCACACCACGCCCAGTCAAATTACTTAGAGGCCATACTCTTGTCCTC AATTGTACTGCTACCACTCCCTTGAACACGAGAGTTCAAATGACCTGGAG TTACCCTGATGAAAAAAATAAGAGAGCTTCCGTAAGGCGACGAATTGACC AAAGCAATTCCCATGCCAACATATTCTACAGTGTTCTTACTATTGACAAA ATGCAGAACAAAGACAAAGGACTTTATACTTGTCGTGTAAGGAGTGGACC ATCATTCAAATCTGTTAACACCTCAGTGCATATATATGATAAAGCATTCA TCACTGTGAAACATCGAAAACAGCAGGTGCTTGAAACCGTAGCTGGCAAG CGGTCTTACCGGCTCTCTATGAAAGTGAAGGCATTTCCCTCGCCGGAAGT TGTATGGTTAAAAGATGGGTTACCTGCGACTGAGAAATCTGCTCGCTATT TGACTCGTGGCTACTCGTTAATTATCAAGGACGTAACTGAAGAGGATGCA GGGAATTATACAATCTTGCTGAGCATAAAACAGTCAAATGTGTTTAAAAA CCTCACTGCCACTCTAATTGTCAATGTGAAACCCCAGATTTACGAAAAGG CCGTGTCATCGTTTCCAGACCCGGCTCTCTACCCACTGGGCAGCAGACAA ATCCTGACTTGTACCGCATATGGTATCCCTCAACCTACAATCAAGTGGTT CTGGCACCCCTGTAACCATAATCATTCCGAAGCAAGGTGTGACTTTTGTT CCAATAATGAAGAGTCCTTTATCCTGGATGCTGACAGCAACATGGGAAAC AGAATTGAGAGCATCACTCAGCGCATGGCAATAATAGAAGGAAAGAATAA GATGGCTAGCACCTTGGTTGTGGCTGACTCTAGAATTTCTGGAATCTACA TTTGCATAGCTTCCAATAAAGTTGGGACTGTGGGAAGAAACATAAGCTTT TATATCACAGATGTGCCAAATGGGTTTCATGTTAACTTGGAAAAAATGCC GACGGAAGGAGAGGACCTGAAACTGTCTTGCACAGTTAACAAGTTCTTAT ACAGAGACGTTACTTGGATTTTACTGCGGACAGTTAATAACAGAACAATG CACTACAGTATTAGCAAGCAAAAAATGGCCATCACTAAGGAGCACTCCAT CACTCTTAATCTTACCATCATGAATGTTTCCCTGCAAGATTCAGGCACCT ATGCCTGCAGAGCCAGGAATGTATACACAGGGGAAGAAATCCTCCAGAAG AAAGAAATTACAATCAGAGGTGAGCACTGCAACAAAAAGGCTGTTTTCTC TCGGATCTCCAAATTTAAAAGCACAAGGAATGATTGTACCACACAAAGTA ATGTAAAACATTAA HumanVEGFReceptor1Isoform3Protein Sequence(sFlt1-14) (SEQIDNO:19) MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLH LQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQAN HTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTE GRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYK EIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVL NCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDK MQNKDKGLYTCRVRSGPSFKSVNTSVHIYDKAFITVKHRKQQVLETVAGK RSYRLSMKVKAFPSPEVVWLKDGLPATEKSARYLTRGYSLIIKDVTEEDA GNYTILLSIKQSNVFKNLTATLIVNVKPQIYEKAVSSFPDPALYPLGSRQ ILTCTAYGIPQPTIKWFWHPCNHNHSEARCDFCSNNEESFILDADSNMGN RIESITQRMAIIEGKNKMASTLVVADSRISGIYICIASNKVGTVGRNISF YITDVPNGFHVNLEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTM HYSISKQKMAITKEHSITLNLTIMNVSLQDSGTYACRARNVYTGEEILQK KEITIRDQEAPYLLRNLSDHTVAISSSTTLDCHANGVPEPQITWFKNNHK IQQEPELYTSTSPSSSSSSPLSSSSSSSSSSSS HumanVEGFReceptor1Isoform3cDNA (SEQIDNO:20) ATGGTCAGCTACTGGGACACCGGGGTCCTGCTGTGCGCGCTGCTCAGCTG TCTGCTTCTCACAGGATCTAGTTCAGGTTCAAAATTAAAAGATCCTGAAC TGAGTTTAAAAGGCACCCAGCACATCATGCAAGCAGGCCAGACACTGCAT CTCCAATGCAGGGGGGAAGCAGCCCATAAATGGTCTTTGCCTGAAATGGT GAGTAAGGAAAGCGAAAGGCTGAGCATAACTAAATCTGCCTGTGGAAGAA ATGGCAAACAATTCTGCAGTACTTTAACCTTGAACACAGCTCAAGCAAAC CACACTGGCTTCTACAGCTGCAAATATCTAGCTGTACCTACTTCAAAGAA GAAGGAAACAGAATCTGCAATCTATATATTTATTAGTGATACAGGTAGAC CTTTCGTAGAGATGTACAGTGAAATCCCCGAAATTATACACATGACTGAA GGAAGGGAGCTCGTCATTCCCTGCCGGGTTACGTCACCTAACATCACTGT TACTTTAAAAAAGTTTCCACTTGACACTTTGATCCCTGATGGAAAACGCA TAATCTGGGACAGTAGAAAGGGCTTCATCATATCAAATGCAACGTACAAA GAAATAGGGCTTCTGACCTGTGAAGCAACAGTCAATGGGCATTTGTATAA GACAAACTATCTCACACATCGACAAACCAATACAATCATAGATGTCCAAA TAAGCACACCACGCCCAGTCAAATTACTTAGAGGCCATACTCTTGTCCTC AATTGTACTGCTACCACTCCCTTGAACACGAGAGTTCAAATGACCTGGAG TTACCCTGATGAAAAAAATAAGAGAGCTTCCGTAAGGCGACGAATTGACC AAAGCAATTCCCATGCCAACATATTCTACAGTGTTCTTACTATTGACAAA ATGCAGAACAAAGACAAAGGACTTTATACTTGTCGTGTAAGGAGTGGACC ATCATTCAAATCTGTTAACACCTCAGTGCATATATATGATAAAGCATTCA TCACTGTGAAACATCGAAAACAGCAGGTGCTTGAAACCGTAGCTGGCAAG CGGTCTTACCGGCTCTCTATGAAAGTGAAGGCATTTCCCTCGCCGGAAGT TGTATGGTTAAAAGATGGGTTACCTGCGACTGAGAAATCTGCTCGCTATT TGACTCGTGGCTACTCGTTAATTATCAAGGACGTAACTGAAGAGGATGCA GGGAATTATACAATCTTGCTGAGCATAAAACAGTCAAATGTGTTTAAAAA CCTCACTGCCACTCTAATTGTCAATGTGAAACCCCAGATTTACGAAAAGG CCGTGTCATCGTTTCCAGACCCGGCTCTCTACCCACTGGGCAGCAGACAA ATCCTGACTTGTACCGCATATGGTATCCCTCAACCTACAATCAAGTGGTT CTGGCACCCCTGTAACCATAATCATTCCGAAGCAAGGTGTGACTTTTGTT CCAATAATGAAGAGTCCTTTATCCTGGATGCTGACAGCAACATGGGAAAC AGAATTGAGAGCATCACTCAGCGCATGGCAATAATAGAAGGAAAGAATAA GATGGCTAGCACCTTGGTTGTGGCTGACTCTAGAATTTCTGGAATCTACA TTTGCATAGCTTCCAATAAAGTTGGGACTGTGGGAAGAAACATAAGCTTT TATATCACAGATGTGCCAAATGGGTTTCATGTTAACTTGGAAAAAATGCC GACGGAAGGAGAGGACCTGAAACTGTCTTGCACAGTTAACAAGTTCTTAT ACAGAGACGTTACTTGGATTTTACTGCGGACAGTTAATAACAGAACAATG CACTACAGTATTAGCAAGCAAAAAATGGCCATCACTAAGGAGCACTCCAT CACTCTTAATCTTACCATCATGAATGTTTCCCTGCAAGATTCAGGCACCT ATGCCTGCAGAGCCAGGAATGTATACACAGGGGAAGAAATCCTCCAGAAG AAAGAAATTACAATCAGAGATCAGGAAGCACCATACCTCCTGCGAAACCT CAGTGATCACACAGTGGCCATCAGCAGTTCCACCACTTTAGACTGTCATG CTAATGGTGTCCCCGAGCCTCAGATCACTTGGTTTAAAAACAACCACAAA ATACAACAAGAGCCTGAACTGTATACATCAACGTCACCATCGTCATCGTC ATCATCACCATTGTCATCATCATCATCATCGTCATCATCATCATCATCAT AG HumanVEGFReceptor1Isoform4Protein Sequence (SEQIDNO:21) MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLH LQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQAN HTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTE GRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYK EIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVL NCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDK MQNKDKGLYTCRVRSGPSFKSVNTSVHIYDKAFITVKHRKQQVLETVAGK RSYRLSMKVKAFPSPEVVWLKDGLPATEKSARYLTRGYSLIIKDVTEEDA GNYTILLSIKQSNVFKNLTATLIVNVKPQIYEKAVSSFPDPALYPLGSRQ ILTCTAYGIPQPTIKWFWHPCNHNHSEARCDFCSNNEESFILDADSNMGN RIESITQRMAIIEGKNKLPPANSSFMLPPTSFSSNYFHFLP HumanVEGFReceptor1Isoform4cDNA (SEQIDNO:22) ATGGTCAGCTACTGGGACACCGGGGTCCTGCTGTGCGCGCTGCTCAGCTG TCTGCTTCTCACAGGATCTAGTTCAGGTTCAAAATTAAAAGATCCTGAAC TGAGTTTAAAAGGCACCCAGCACATCATGCAAGCAGGCCAGACACTGCAT CTCCAATGCAGGGGGGAAGCAGCCCATAAATGGTCTTTGCCTGAAATGGT GAGTAAGGAAAGCGAAAGGCTGAGCATAACTAAATCTGCCTGTGGAAGAA ATGGCAAACAATTCTGCAGTACTTTAACCTTGAACACAGCTCAAGCAAAC CACACTGGCTTCTACAGCTGCAAATATCTAGCTGTACCTACTTCAAAGAA GAAGGAAACAGAATCTGCAATCTATATATTTATTAGTGATACAGGTAGAC CTTTCGTAGAGATGTACAGTGAAATCCCCGAAATTATACACATGACTGAA GGAAGGGAGCTCGTCATTCCCTGCCGGGTTACGTCACCTAACATCACTGT TACTTTAAAAAAGTTTCCACTTGACACTTTGATCCCTGATGGAAAACGCA TAATCTGGGACAGTAGAAAGGGCTTCATCATATCAAATGCAACGTACAAA GAAATAGGGCTTCTGACCTGTGAAGCAACAGTCAATGGGCATTTGTATAA GACAAACTATCTCACACATCGACAAACCAATACAATCATAGATGTCCAAA TAAGCACACCACGCCCAGTCAAATTACTTAGAGGCCATACTCTTGTCCTC AATTGTACTGCTACCACTCCCTTGAACACGAGAGTTCAAATGACCTGGAG TTACCCTGATGAAAAAAATAAGAGAGCTTCCGTAAGGCGACGAATTGACC AAAGCAATTCCCATGCCAACATATTCTACAGTGTTCTTACTATTGACAAA ATGCAGAACAAAGACAAAGGACTTTATACTTGTCGTGTAAGGAGTGGACC ATCATTCAAATCTGTTAACACCTCAGTGCATATATATGATAAAGCATTCA TCACTGTGAAACATCGAAAACAGCAGGTGCTTGAAACCGTAGCTGGCAAG CGGTCTTACCGGCTCTCTATGAAAGTGAAGGCATTTCCCTCGCCGGAAGT TGTATGGTTAAAAGATGGGTTACCTGCGACTGAGAAATCTGCTCGCTATT TGACTCGTGGCTACTCGTTAATTATCAAGGACGTAACTGAAGAGGATGCA GGGAATTATACAATCTTGCTGAGCATAAAACAGTCAAATGTGTTTAAAAA CCTCACTGCCACTCTAATTGTCAATGTGAAACCCCAGATTTACGAAAAGG CCGTGTCATCGTTTCCAGACCCGGCTCTCTACCCACTGGGCAGCAGACAA ATCCTGACTTGTACCGCATATGGTATCCCTCAACCTACAATCAAGTGGTT CTGGCACCCCTGTAACCATAATCATTCCGAAGCAAGGTGTGACTTTTGTT CCAATAATGAAGAGTCCTTTATCCTGGATGCTGACAGCAACATGGGAAAC AGAATTGAGAGCATCACTCAGCGCATGGCAATAATAGAAGGAAAGAATAA GCTTCCACCAGCTAACAGTTCTTTCATGTTGCCACCTACAAGCTTCTCTT CCAACTACTTCCATTTCCTTCCGTGA ExtracellularRegionofWildtypeHuman VEGFR-1(thesevenIg-likedomainsare showninboldandunderlined) (SEQIDNO:23) sklkdpelslkgtqhimgagqtlhlqcrgeaahkwslpemvske serlsitksacgrngkqfcstltlntaqanhtgfysckyl avptskkketesaiyifisdtgrpfvemyseipeiihmte grelviperytspnitvtlkkfpldtlipdgkriiwdsrk gfiisnatykeiglltceatvnghlyktnylthrqtntii dvqistprpvkllrghtivlnctattpintrvqmtwsypd eknkrasvrrridqsnshanifysvltidkmqnkdkglyt crvrsgpsfksvntsvhiydkafitvkhrkqqvletvagk rsyrlsmkvkafpspevvwlkdglpateksaryltrgysl iikdvteedagnytillsikqsnvfknitatlivnvkpqi yekayssfpdpalvplgsrqiltctaygipqptikwfwhp cnhnhsearcdfcsnneesfildadsnmgnriesitqrma iiegknkmastivvadsrisgiyiciasnkvgtvgrnisf yitdvpngfhvnlekmptegedlklsctvnkflyrdvtwi llrtvnnrtmhysiskqkmaitkehsitlnltimnvslqd sgtyacrarnvytgeeilqkkeitirdqeapyllrnlsdh tvaisssttldchangvpepqitwfknnhkiqqepqiilq pgsstlfiervteedegvyhckatnqkgsvessayltvqg tsdksnle ExtracellularRegionofWildtypeMouse VEGFR-1 (SEQIDNO:24) ygsgsklkvpelslkgtqhvmqagqtlflkcrgeaahs wslpttvsqedkrlsitppsacgrdnrqfcstltldtaqa nhtglytcry1ptstskkkkaessiyifvsdagspfiemh tdipklvhmtegrqliipervtspnvtvtlkkfpfdtltp dgqritwdsrrgfiianatykeigllnceatvnghlyqtn ylthrqtntildvqirppspvrllhgqtivlnctatteln trvqmswnypgkatkrasirqridrshshnnvfhsvlkin nvesrdkglytcrvksgssfqsfntsvhvyekgfisvkhr kqpvqettagrrsyrlsmkvkafpspeivwlkdgspatlk sarylvhgysliikdvttedagdytillgikqsrlfknit atlivnvkpqiyeksysslpspplyplgsrqvltctvygi prptitwlwhpchhnhskerydfcteneesfildpssnlg nriesisqrmtviegtnktvstivvadsqtpgiyscrafn kigtvernikfyvtdvpngfhvslekmpaegedlklscvv nkflyrditwillrtvnnrtmhhsiskqkmattqdysitl nlviknvsledsgtyacrarniytgedilrktevlvrdse aphllqnlsdyevsisgsttldcgargvpapqitwfknnh kiqqepgiilgpgnstlfiervteedegvyrcratnqkga vesaayltvqgtsdksnle ExtracellularRegionofWildtypeRat VEGFR-1 (SEQIDNO:25) ycsgsklkgpelslkgtqhvmqagqtlflkcrgeaahs wslpttvsqedkklsvtrsacgrnnrqfcstltlnmaqan htglyscrylpkstskekkmesaiyifvsdagspfiemhs dipklvhmtegreliiperytspnitvtlkkfpfdaltpd gqriawdsrrgfiianatykeiglltceatvnghlyqtsy lthrqtntildvqisppspvrflrgqtivlnctvttdlnt rvqmswnypgkatkrasirqridqsnphsnvfhsvlkinn vesrdkglytcrvksgssfrtfntsvhvyekgfisvkhrk qqvqetiagkrshrlsmkvkafpspevvwlkdgvpateks arysvhgysliikdvtaedagdytillgikqsklfrnita tlivnvkpqiyeksysslpspplyplgsrqvltctvygip qptikwlwhpchynhskerndfcfgseesfildsssnign riegitqrmmviegtnktvstivvadsrtpgsysckafnk igtverdirfyvtdvpngfhvslekiptegedlklscvvs kflyrditwillrtvnnrtmhhsiskqkmattqdysitln lviknvsledsgtyacrarniytgeeilrktevlvrdlea plllqnlsdhevsisgsttldcqargvpapqitwfknnhk iqqepgiilgpgnstlfiervteedegvyrcratnqkgvv essayltvqgtsdksnle ExtracellularRegionofWildtypeHuman VEGFR-2(thesevenIg-likedomainsare showninboldandunderlined) (SEQIDNO:26) asvglpsysldlprlsiqkdiltikanttlqitcrgqrdld wlwpnngsgseqrvevtecsdglfcktltipkvigndtga ykcfyretdlasviyvyvqdyrspfiasysdqhgvvyite nknktvvipclgsisnlnvslcarypekrfvpdgnriswd skkgftipsymisyagmvfceakindesyqsimyivvvvg yriydvvlspshgielsvgeklvinctartelnvgidfnw eypsskhqhkklvnrdlktqsgsemkkflstltidgvtrs dqglytcaassglmtkknstfvrvhekpfvafgsgmeslv eatvgervripakylgypppeikwykngiplesnhtikag hvltimevserdtgnytviltnpiskekqshvvslvvyvp pqiqekslispvdsvqygttqtltctvyaippphhihwyw qleeecanepsqaysvtnpypceewrsvedfqggnkievn knqfaliegknktvstiviqaanvsalykceavnkvgrge rvisfhvtrgpeitlqpdmqpteqesyslwctadrstfen ltwyklgpqplpihvgelptpvcknldtlwklnatmfsns tndilimelknaslqdqgdyvclaqdrktkkrhcvvrqlt vlervaptitqnlengttsigesievsctasgnpppqimw fkdnetivedsgivlkdgnrnltirrvrkedeglytcqac svlgcakveaffiiegaqektnle ExtracellularRegionofWildtypeMouse VEGFR-2 (SEQIDNO:27) asvglpgdflhppklstqkdiltilanttlqitcrgqrdld wlwpnaqrdseervlvtecgggdsifcktltiprvvgndt gaykcsyrdvdiastvyvyvrdyrspfiasvsdqhgivyi tenknktvvipergsisnlnvslcarypekrfvpdgnris wdseigftlpsymisyagmvfceakindetyqsimyivvv vgyriydvilsppheielsageklvinctartelnvgldf twhsppskshhkkivnrdvkpfpgtvakmflstltiesvt ksdqgeytcvassgrmikrnrtfvrvhtkpfiafgsgmks lveatvgsqvripvkylsypapdikwyrngrpiesnytmi vgdeltimevterdagnytviltnpismekqshmvslvvn vppqigekalispmdsyqygtmqtltctvyanpplhhiqw ywqleeacsyrpgqtspyackewrhvedfqggnkievtkn qyaliegknktvstiviqaanvsalykceainkagrgery isfhvirgpeitvqpaaqpteqesysllctadrntfenit wyklgsqatsvhmgesltpvcknldalwklngtmfsnstn dilivafqnaslqdqgdyvcsaqdkktkkrhclvkqliil ermapmitgnlenqtttigetievtcpasgnptphitwfk dnetivedsgivirdgnrn1tirrvrkedgglytcqacnv lgcaraetlfiiegaqektnle ExtracellularRegionofWildtype RatVEGFR-2 (SEQIDNO:28) asvglpgdslhppklstqkdiltilanttlqitcrgqrdld wlwpntprdseervlvtecgdsifcktltvprvvgndtga ykcfyrdtdvssivyvyvqdhrspfiasysdehgivyite nknktvvipcrgsisnlnvslcarypekrfvpdgnriswd sekgftipsymisyagmvfceakindetyqsimyivlvvg yriydvvlsppheielsageklvinctartelnvgldfsw qfpsskhqhkkivnrdvkslpgtvakmflstltidsvtks dqgeytctaysglmtkknktfvrvhtkpfiafgsgmkslv eatvgsqvripvkylsypapdikwyrngrpiesnytmivg deltimevserdagnytviltnpismekqshmvslvvnvp pqigekalispmdsyqygtmqtltctvyanpplhhiqwyw qleeacsyrpsqtnpytckewrhvkdfqggnkievtknqy aliegknktvstiviqaayvsalykceainkagrgervis fhvirgpeitvqpatqpteresmsllctadrntfenitwy klgsqatsvhmgesltpvcknldalwklngtvfsnstndi livafqnaslqdqgnyvcsaqdkktkkrhclvkqlviler mapmitgnlenqtttigetievvcptsgnptplitwfkdn etivedsgivlkdgnrnitirrvrkedgglytcqacnvlg caraetlfiiegvqektnle ExtracellularRegionofWildtype HumanVEGFR-3(thesevenIg-like domainsareshowninbold) (SEQIDNO:29) ysmtpptlniteeshvidtgdslsiscrgqhplewa wpgaqeapatgdkdsedtgvvrdcegtdarpyckvlllhe vhandtgsyvcyykyikariegttaassyvfvrdfeqpfi nkpdtllvnrkdamwvpclvsipglnvtlrsgssvlwpdg qevvwddrrgmlvstpllhdalylqcettwgdgdflsnpf lvhitgnelydiqllprkslellvgeklvlnctvwaefns gvtfdwdypgkqaergkwvperrsqqthtelssiltihnv sqhdlgsyvckanngiqrfrestevivhenpfisvewlkg pileatagdelvklpvklaavpppefgwykdgkalsgrhs phalvlkevteastgtytlalwnsaaglrrnislelvvnv ppqihekeasspsiysrhsrqaltctaygvplplsiqwhw rpwtpckmfaqrslrrrqqqdlmpqcrdwravttqdavnp iesldtwtefvegknktvsklvignanvsamykcvvsnkv gqderliyfyvttipdgftieskpseelleggpvllscqa dsykyehlrwyrinlstlhdahgnpllldcknvhlfatpl aasleevapgarhatlslsiprvapeheghyvcevqdrrs hdkhchkkylsvgaleaprltqnitdllvnvsdslemgcl vagahapsivwykderlleeksgvdladsnqklsiqzvre edagrylcsvcnakgcvnssasvavegsedkgsmeivilv ExtracellularRegionofWildtypeMouse VEGFR-3 (SEQIDNO:30) ysmtpptlnitedsyvidtgdslsiscrgqhplewt wpgagevlttggkdsedtryvhdcegtearpyckvillaq thanntgsyhcyykyikariegttaastyvfvrdfkhpfi nkpdtllvnrkdsmwvpclvsipglnitlrsqssalhpdg qevlwddrrgmrvptqllrdalylqcettwgdqnflsnlf vvhitgnelydiglypkksmellvgeklvlnctvwaefds gvtfdwdypgkqaerakwvperrsqqthtelssiltihnv sqndlgpyvceanngiqrfrestevivhekpfisvewlkg pvleatagdelvklpvklaaypppefqwykdrkavtgrhn phalvlkevteasagvytlalwnsaaglrqnislelvvnv pphihekeasspsiysrhsrqtltctaygvpqplsvqwhw rpwtpcktfaqrslrrrqqrdgmpqcrdwkevttqdavnp iesldswtefvegknktvsklviqdanvsamykcvvvnkv gqderliyfyvttipdgfsiesepsedplegqsvrlscra dnytyehlrwyrinlstlhdaqgnpllldcknvhlfatpl eanleeaepgarhatlslniprvapedegdyvcevqdrrs qdkhchkkylsvgaleaprltqnitdllvnvsdslemrcp vagahvpsivwykderllekesgidladsnqrlsiqrvre edagrylcsvcnakgcvnssasvavegsedkgsme ExtracellularRegionofWildtypeRat VEGFR-3 (SEQIDNO:31) ysmtpptlnitedsyvidtgdslsiscrgqhplewt wrgagevlttggkdsedtqvvqdcegtearpyckvlslaq thanntgsyycyykyikariegttaastyvfvrdfeqpfi nkpdtllvnrkdsmwvpclvsipglnitlrsqssvlhpdg qevlwddrrgmrvpt111rdalylqcettwgdqdflsnpf lvhitgnelydiglypkks1ellvgeklvlnctvwaefds gvtfdwdypgkqaerakwvperrsqqthtelssiltihnv sqhdlgpyvceanngiqqfrestevivhekpfisvewlkg pvleatagdemvklpvklaaypppefqwykdrkavtgrhn phalvlkevteasagvytlalwnsaaglrqnislelvvnv pphihekeasspsiysrhsrqtltcttygvpqplsvqwhw rpwtpcktfaqrslrrrqprdgmpqcrdwkevttqdavnp iesldtwtesvegknktvsklviqdanvsamykcvvfnkv gqderliyfyvttipdgfsiesepsedplegqsvrlscra dnytyehlrwyrinlstlhdaqgnpllldcknvhlfatpl eanleeaepgarhatlslniprvapedegdyvcevqdrrs qdkhchkkylsvgaleaprltqnitdllvnvrtslemrcp vagahvpsivwykderllekesgidladsnqrlsiqrvre edagrylcsvcnakgcvnssasvavegsedkgsme
[0129] In some examples, a soluble VEGF receptor can further include a stabilizing domain (e.g., a Fc domain or a portion of a Fc domain). For example, a stabilizing domain can be an IgG1 Fc domain (e.g., a human wildtype IgG1 Fc domain or a portion thereof). For example, a stalizing domain can be an IgG2 Fc domain (e.g., a human wildtype IgG2 Fc domain or a portion thereof). For example, a stabilizing domain can be an IgG3 Fc domain (e.g., a human wildtype IgG3 domain or a portion thereof).
[0130] Non-limiting examples of human wildtype IgG1 Fc domain, human wildtype IgG2 Fc domain, and human wildtype IgG3 Fc domain are shown below.
TABLE-US-00005 HumanWildtypeIgG1FeDomain (SEQIDNO:32) pcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvs hedpevkfnwyvdgvevhnaktkpreeqynstyrvvsvlt vlhqdwlngkeykckvsnkalpapiektiskakgqprepq vytlppsrdeltknqvsltclvkgfypsdiavewesngqp ennykttppvldsdgsfflyskltvdksrwqqgnvfscsv mhealhnhytqkslslspgk HumanWildtypeIgG2FeRegion (SEQIDNO:33) vecppcpappvagpsvflfppkpkdtlmisrtpevtcvvv dvshedpevqfnwyvdgvevhnaktkpreeqfnstfrvvs vltvvhqdwlngkeykckvsnkglpapiektisktkgqpr epqvytlppsreemtknqvsltclvkgfypsdiavewesn gqpennykttppmldsdgsfflyskltvdksrwqqgnvfs csvmhealhnhytqkslslspgk HumanWildtypeIgG3FeRegion (SEQIDNO:34) tcprcpapellggpsvflfppkpkdtlmisrtpevtcvvv dvshedpevqfkwyvdgvevhnaktkpreeqfnstfrvvs vltvlhqdwlngkeykckvsnkalpapiektisktkgqpr epqvytlppsreemtknqvsltclvkgfypsdiavewess gqpennykttppmldsdgsfflyskltvdksrwqqgnifs csvmhealhnrftqkslslspgk
[0131] In some embodiments, the soluble VEGF receptor is aflibercept (Eylea). Aflibercept includes portions of human VEGF receptors 1 and 2 extracellular domains fused to the Fc portion of human IgG1 (size115 kDa). Aflibercept inhibits the activity of VEGF-A, VEGF-B, and PIGF. Aflibercept has a K.sub.D for VEGF-A of 0.49 pM. See, e.g., WO 2017/218974.
TABLE-US-00006 AminoEncodingaflibercept (SEQIDNO:12) SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLI PDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNT IIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKL VNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFV RVHEKDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSL TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS RWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
[0132] In some embodiments of a soluble VEGF receptor includes a sequence that is at least 80% identical (e.g., at least 82%, at least 84%, at least 86%, at least 88%, at least 90%, at least 92%, at least 94%, at least 96%, at least 98%, or at least 99%) identical to SEQ ID NO: 12.
[0133] In some embodiments of the soluble VEGF receptor includes an extracellular domain that is or includes the sequence of SEQ ID NO: 12, except that it includes one, two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, or fifteen amino acid substitutions in the sequence of SEQ ID NO: 12.
[0134] Additional examples of soluble VEGF receptors are described in, e.g., Kendall et al., PNAS 90: 10705-10709, 1993; Kendall et al., Biochem Biophys Res Commun 226: 324-328, 1996; Failla et al., Int J Mol Sci 19(5):pii. E1306, 2018; and Jung et al., PLoS One 7(9): e44572.
Vectors
[0135] Recombinant AAV vectors or rAAVs are typically composed of, at a minimum, a transgene or a portion thereof and a regulatory sequence, and optionally 5 and 3 AAV inverted terminal repeats (ITRs). Such a recombinant AAV vector is packaged into a capsid and delivered to a selected target cell (e.g., a cochlear hair cell).
[0136] The AAV sequences of the vector typically comprise the cis-acting 5 and 3 ITR sequences (See, e.g., B. J. Carter, in Handbook of Parvoviruses, ed., P. Tijsser, CRC Press, pp. 155 168, 1990). Typical AAV ITR sequences are about 145 nucleotides in length. In some embodiments, at least 75% of a typical ITR sequence (e.g., at least 80%, at least 85%, at least 90%, or at least 95%) is incorporated into the AAV vector. The ability to modify these ITR sequences is within the skill of the art. (See, e.g., texts such as Sambrook et al., Molecular Cloning. A Laboratory Manual, 2d ed., Cold Spring Harbor Laboratory, New York, 1989; and K. Fisher et al., J Virol. 70:520 532, 1996). In some embodiments, any of the coding sequences described herein is flanked by 5 and 3 AAV ITR sequences in the AAV vectors. The AAV ITR sequences may be obtained from any known AAV, including presently identified AAV types.
[0137] AAV vectors as described herein may include any of the regulatory elements described herein (e.g., one or more of a promoter, a polyadenylation (poly(A)) signal sequence, and an IRES).
[0138] In some embodiments, the vector(s) is an adenovirus (see, e.g., Dmitriev et al. (1998) J Virol. 72: 9706-9713; and Poulin et al., J. Virol 8: 10074-10086, 2010). In some embodiments, the vector(s) is a retrovirus (see, e.g., Maier et al. (2010) Future Microbiol 5: 1507-23).
[0139] The vectors provided herein can be of different sizes. The choice of vector that is used in any of the compositions, kits, and methods described herein may depend on the size of the vector.
[0140] In some embodiments, the vector(s) can have a total number of nucleotides of up to 10 kb. In some embodiments, the viral vector(s) can have a total number of nucleotides in the range of about 1 kb to about 2 kb, 1 kb to about 3 kb, about 1 kb to about 4 kb, about 1 kb to about 5 kb, about 1 kb to about 6 kb, about 1 kb to about 7 kb, about 1 kb to about 8 kb, about 1 kb to about 9 kb, about 1 kb to about 10 kb, about 2 kb to about 3 kb, about 2 kb to about 4 kb, about 2 kb to about 5 kb, about 2 kb to about 6 kb, about 2 kb to about 7 kb, about 2 kb to about 8 kb, about 2 kb to about 9 kb, about 2 kb to about 10 kb, about 3 kb to about 4 kb, about 3 kb to about 5 kb, about 3 kb to about 6 kb, about 3 kb to about 7 kb, about 3 kb to about 8 kb, about 3 kb to about 9 kb, about 3 kb to about 10 kb, about 4 kb to about 5 kb, about 4 kb to about 6 kb, about 4 kb to about 7 kb, about 4 kb to about 8 kb, about 4 kb to about 9 kb, about 4 kb to about 10 kb, about 5 kb to about 6 kb, about 5 kb to about 7 kb, about 5 kb to about 8 kb, about 5 kb to about 9 kb, about 5 kb to about 10 kb, about 6 kb to about 7 kb, about 6 kb to about 8 kb, about 6 kb to about 9 kb, about 6 kb to about 10 kb, about 7 kb to about 8 kb, about 7 kb to about 9 kb, about 7 kb to about 10 kb, about 8 kb to about 9 kb, about 8 kb to about 10 kb, or about 9 kb to about 10 kb.
[0141] In some embodiments, the vector(s) is a lentivirus and can have a total number of nucleotides of up to 8 kb. In some examples, the lentivirus(es) can have a total number of nucleotides of about 1 kb to about 2 kb, about 1 kb to about 3 kb, about 1 kb to about 4 kb, about 1 kb to about 5 kb, about 1 kb to about 6 kb, about 1 kb to about 7 kb, about 1 kb to about 8 kb, about 2 kb to about 3 kb, about 2 kb to about 4 kb, about 2 kb to about 5 kb, about 2 kb to about 6 kb, about 2 kb to about 7 kb, about 2 kb to about 8 kb, about 3 kb to about 4 kb, about 3 kb to about 5 kb, about 3 kb to about 6 kb, about 3 kb to about 7 kb, about 3 kb to about 8 kb, about 4 kb to about 5 kb, about 4 kb to about 6 kb, about 4 kb to about 7 kb, about 4 kb to about 8 kb, about 5 kb to about 6 kb, about 5 kb to about 7 kb, about 5 kb to about 8 kb, about 6 kb to about 8kb, about 6 kb to about 7 kb, or about 7 kb to about 8 kb.
[0142] In some embodiments, the vector(s) is an adenovirus and can have a total number of nucleotides of up to 8 kb. In some embodiments, the adenovirus(es) can have a total number of nucleotides in the range of about 1 kb to about 2 kb, about 1 kb to about 3 kb, about 1 kb to about 4 kb, about 1 kb to about 5 kb, about 1 kb to about 6 kb, about 1 kb to about 7 kb, about 1 kb to about 8 kb, about 2 kb to about 3 kb, about 2 kb to about 4 kb, about 2 kb to about 5 kb, about 2 kb to about 6 kb, about 2 kb to about 7 kb, about 2 kb to about 8 kb, about 3 kb to about 4 kb, about 3 kb to about 5 kb, about 3 kb to about 6 kb, about 3 kb to about 7 kb, about 3 kb to about 8 kb, about 4 kb to about 5 kb, about 4 kb to about 6 kb, about 4 kb to about 7 kb, about 4 kb to about 8 kb, about 5 kb to about 6 kb, about 5 kb to about 7 kb, about 5 kb to about 8 kb, about 6 kb to about 7 kh, about 6 kb to about 8 kb, or about 7 kb to about 8 kb.
[0143] In some embodiments, the vector(s) is an adeno-associated virus (AAV vector) and can include a total number of nucleotides of up to 5 kb. In some embodiments, the AAV vector(s) can include a total number of nucleotides in the range of about 1 kb to about 2 kb, about 1 kb to about 3 kb, about 1 kb to about 4 kb, about 1 kb to about 5 kb, about 2 kb to about 3 kb, about 2 kb to about 4 kb, about 2 kb to about 5kb, about 3 kb to about 4 kb, about 3 kb to about 5 kb, or about 4 kb to about 5 kb.
[0144] A variety of different methods known in the art can be used to introduce any of vectors disclosed herein into a mammalian cell (e.g., an inner ear cell, a cochlear inner hair cell). Non-limiting examples of methods for introducing nucleic acid into a mammalian cell include: lipofection, transfection (e.g., calcium phosphate transfection, transfection using highly branched organic compounds, transfection using cationic polymers, dendrimer-based transfection, optical transfection, particle-based transfection (e.g., nanoparticle transfection), or transfection using liposomes (e.g., cationic liposomes)), microinjection, electroporation, cell squeezing, sonoporation, protoplast fusion, impalefection, hydrodynamic delivery, gene gun, magnetofection, viral transfection, and nucleofection.
[0145] Any of the vectors described herein can further include a control sequence, e.g., a control sequence selected from the group of a transcription initiation sequence, a transcription termination sequence, a promoter sequence, an enhancer sequence, an RNA splicing sequence, a polyadenylation (polyA) signal, and a Kozak consensus sequence. Non-limiting examples of these control sequences are described herein. In some embodiments, a promoter can be a native promoter, a constitutive promoter, an inducible promoter, and/or a tissue-specific promoter.
Promoters
[0146] The term promoter means a DNA sequence recognized by enzymes/proteins in a mammalian cell required to initiate the transcription of a specific gene. A promoter typically refers to, e.g., a nucleotide sequence to which an RNA polymerase and/or any associated factor binds and at which transcription is initiated. Non-limiting examples of promoters are described herein. Additional examples of promoters are known in the art.
[0147] In some embodiments, a vector (e.g., an adeno-associated virus (AAV) vector) encoding an antibody (e.g., an antibody that binds specifically to VEGF or an antigen-binding antibody fragment thereof,) can include a promoter and/or an enhancer. The vector encoding the antibody or antigen-binding antibody fragment can include any of the promoters and/or enhancers described herein or known in the art.
[0148] In some embodiments, the promoter is an inducible promoter, a constitutive promoter, a mammalian cell promoter, a viral promoter, a chimeric promoter, an engineered promoter, a tissue-specific promoter, or any other type of promoter known in the art. In some embodiments, the promoter is a RNA polymerase II promoter, such as a mammalian RNA polymerase II promoter. In some embodiments, the promoter is a RNA polymerase III promoter, including, but not limited to, a H1 promoter, a human U6 promoter, a mouse U6 promoter, or a swine U6 promoter. The promoter will generally be one that is able to promote transcription in an inner hair cell In some examples, the promoter is a cochlea-specific promoter or a cochlea-oriented promoter.
[0149] A variety of promoters are known in the art that can be used herein. Non-limiting examples of promoters that can be used herein include: human EF1a, human cytomegalovirus (CMV) (U.S. Pat. No. 5,168,062), human ubiquitin C (UBC), mouse phosphoglycerate kinase 1, polyoma adenovirus, simian virus 40 (SV40), -globin, -actin, -fetoprotein, -globin, -interferon, -glutamyl transferase, mouse mammary tumor virus (MMTV), Rous sarcoma virus, rat insulin, glyceraldehyde-3-phosphate dehydrogenase, metallothionein II (MT II), amylase, cathepsin, MI muscarinic receptor, retroviral LTR (e.g. human T-cell leukemia virus HTLV), AAV ITR, interleukin-2, collagenase, platelet-derived growth factor, adenovirus 5 E2, stromelysin, murine MX gene, glucose regulated proteins (GRP78 and GRP94), -2-macroglobulin, vimentin, MHC class I gene H-2 b, HSP70, proliferin, tumor necrosis factor, thyroid stimulating hormone a gene, immunoglobulin light chain, T-cell receptor, HLA DQ and DQ, interleukin-2 receptor, MHC class II, MHC class II HLA-DR, muscle creatine kinase, prealbumin (transthyretin), elastase I, albumin gene, c-fos, c-HA-ras, neural cell adhesion molecule (NCAM), H2B (TH2B) histone, rat growth hormone, human serum amyloid (SAA), troponin I (TN I), duchenne muscular dystrophy, human immunodeficiency virus, and Gibbon Ape Leukemia Virus (GALV) promoters. Additional examples of promoters are known in the art. See, e.g., Lodish, Molecular Cell Biology, Freeman and Company, New York 2007. In some embodiments, the promoter is the CMV immediate early promoter. In some embodiments, the promoter is a CAG promoter or a CAG/CBA promoter.
[0150] The term constitutive promoter refers to a nucleotide sequence that, when operably linked with a nucleic acid encoding a protein (e.g., an antibody or an antigen-binding antibody fragment), causes RNA to be transcribed from the nucleic acid in a mammalian cell under most or all physiological conditions.
[0151] Examples of constitutive promoters include, without limitation, the retroviral Rous sarcoma virus (RSV) LTR promoter, the cytomegalovirus (CMV) promoter (see, e.g., Boshart et al, Cell 41:521-530, 1985), the SV40 promoter, the dihydrofolate reductase promoter, the beta-actin promoter, the phosphoglycerol kinase (PGK) promoter, and the EF1-alpha promoter (Invitrogen).
[0152] Inducible promoters allow regulation of gene expression and can be regulated by exogenously supplied compounds, environmental factors such as temperature, or the presence of a specific physiological state, e.g., acute phase, a particular differentiation state of the cell, or in replicating cells only. Inducible promoters and inducible systems are available from a variety of commercial sources, including, without limitation, Invitrogen, Clontech, and Ariad. Additional examples of inducible promoters are known in the art.
[0153] Examples of inducible promoters regulated by exogenously supplied compounds include the zinc-inducible sheep metallothionine (MT) promoter, the dexamethasone (Dex)-inducible mouse mammary tumor virus (MMTV) promoter, the T7 polymerase promoter system (WO 98/10088); the ecdysone insect promoter (No et al, Proc. Natl. Acad. Sci. U.S.A. 93:3346-3351, 1996), the tetracycline-repressible system (Gossen et al, Proc. Natl. Acad. Sci. U.S.A. 89:5547-5551, 1992), the tetracycline-inducible system (Gossen et al, Science 268:1766-1769, 1995, see also Harvey et al, Curr. Opin. Chem. Biol. 2:512-518, 1998), the RU486-inducible system (Wang et al, Nat. Biotech. 15:239-243, 1997) and Wang et al, Gene Ther. 4:432-441, 1997), and the rapamycin-inducible system (Magari et al. J. Clin. Invest. 100:2865-2872, 1997).
[0154] The term tissue-specific promoter refers to a promoter that is active only in certain specific cell types and/or tissues (e.g., transcription of a specific gene occurs only within cells expressing transcription regulatory proteins that bind to the tissue-specific promoter).
[0155] In some embodiments, the regulatory sequences impart tissue-specific gene expression capabilities. In some cases, the tissue-specific regulatory sequences bind tissue-specific transcription factors that induce transcription in a tissue-specific manner.
[0156] Exemplary tissue-specific promoters include but are not limited to the following: a liver-specific thyroxin binding globulin (TBG) promoter, an insulin promoter, a glucagon promoter, a somatostatin promoter, a pancreatic polypeptide (PPY) promoter, a synapsin-1 (Syn) promoter, a creatine kinase (MCK) promoter, a mammalian desmin (DES) promoter, an alpha-myosin heavy chain (a-MHC) promoter, and a cardiac Troponin T (cTnT) promoter. Additional exemplary promoters include Beta-actin promoter, hepatitis B virus core promoter (Sandig et al., Gene Ther. 3:1002-1009, 1996), alpha-fetoprotein (AFP) promoter (Arbuthnot et al., Hum. Gene Ther. 7:1503-1514, 1996), bone osteocalcin promoter (Stein et al., Mol. Biol. Rep. 24:185-196, 1997); bone sialoprotein promoter (Chen et al., J. Bone Miner. Res. 11:654-664, 1996), CD2 promoter (Hansal et al., J. Immunol. 161:1063-1068, 1998); immunoglobulin heavy chain promoter; T cell receptor alpha-chain promoter, neuronal such as neuron-specific enolase (NSE) promoter (Andersen et al., Cell. Mol. Neurobiol. 13:503-515, 1993), neurofilament light-chain gene promoter (Piccioli et al., Proc. Natl. Acad. Sci. U.S.A. 88:5611-5615, 1991), and the neuron-specific vgf gene promoter (Piccioli et al., Neuron 15:373-384, 1995).
[0157] In some embodiments, the tissue-specific promoter is a cochlea-specific promoter. In some embodiments, the tissue-specific promoter is a cochlear hair cell-specific promoter. Non-limiting examples of cochlear hair cell-specific promoters include but are not limited to: a ATOH1 promoter, a POU4F3 promoter, a LHX3 promoter, a MYO7A promoter, a MYO6 promoter, a 9ACHR promoter, and a 10ACHR promoter. In some embodiments, the promoter is an cochlear hair cell-specific promoter such as a PRESTIN promoter or an ONCOMOD promoter. See, e.g., Zheng et al., Nature 405:149-155, 2000; Tian et al. Dev. Dyn. 231:199-203, 2004; and Ryan et al., Adv. Otorhinolaryngol. 66: 99-115, 2009.
Enhancers
[0158] In some instances, a vector (e.g., an AAV vector) can include an enhancer sequence. The term enhancer refers to a nucleotide sequence that can increase the level of transcription of a nucleic acid encoding a protein of interest (e.g., an antibody that binds specifically to VEGF or an antigen-binding antibody fragment thereof, or a soluble VEGF receptor). Enhancer sequences (50-1500 basepairs in length) generally increase the level of transcription by providing additional binding sites for transcription-associated proteins (e.g., transcription factors). In some embodiments, an enhancer sequence is found within an intronic sequence. Unlike promoter sequences, enhancer sequences can act at much larger distance away from the transcription start site (e.g., as compared to a promoter). Non-limiting examples of enhancers include a RSV enhancer, a CMV enhancer, and a SV40 enhancer.
Poly(A) Signal Sequence
[0159] In some embodiments, any of the vectors provided herein (e.g., an AAV vector) can include a polyadenylation (poly(A)) signal sequence. Most nascent eukaryotic mRNAs possess a poly(A) tail at their 3 end which is added during a complex process that includes cleavage of the primary transcript and a coupled polyadenylation reaction driven by the poly(A) signal sequence (see, e.g., Proudfoot et al., Cell 108:501-512, 2002). The poly(A) tail confers mRNA stability and transferability (Molecular Biology of the Cell, Third Edition by B. Alberts et al., Garland Publishing, 1994). In some embodiments, the poly(A) signal sequence is positioned 3 to the nucleic acid sequence encoding the antibody heavy chain, the antibody light chain, the antigen-binding antibody fragment, or the soluble VEGF receptor.
[0160] As used herein, polyadenylation refers to the covalent linkage of a polyadenylyl moiety, or its modified variant, to a messenger RNA molecule. In eukaryotic organisms, most messenger RNA (mRNA) molecules are polyadenylated at the 3 end. The 3 poly(A) tail is a long sequence of adenine nucleotides (e.g., 50, 60, 70, 100, 200, 500, 1000, 2000, 3000, 4000, or 5000) added to the pre-mRNA through the action of an enzyme, polyadenylate polymerase. In higher eukaryotes, the poly(A) tail is added onto transcripts that contain a specific sequence, the polyadenylation (or poly(A)) signal. The poly(A) tail and the protein bound to it aid in protecting mRNA from degradation by exonucleases. Polyadenylation is also important for transcription termination, export of the mRNA from the nucleus, and translation. Polyadenylation occurs in the nucleus immediately after transcription of DNA into RNA, but also can occur later in the cytoplasm. After transcription has been terminated, the mRNA chain is cleaved through the action of an endonuclease complex associated with RNA polymerase. The cleavage site is usually characterized by the presence of the base sequence AAUAAA near the cleavage site. After the mRNA has been cleaved, adenosine residues are added to the free 3 end at the cleavage site.
[0161] As used herein, a poly(A) signal sequence or polyadenylation signal sequence is a sequence that triggers the endonuclease cleavage of an mRNA and the addition of a series of adenosines to the 3 end of the cleaved mRNA.
[0162] There are several poly(A) signal sequences that can be used, including those derived from bovine growth hormone (bgh) (Woychik et al., Proc. Natl. Acad. Sci. U.S.A. 81(13):3944-3948, 1984; U.S. Pat. No. 5,122,458), mouse--globin, mouse--globin (Orkin et al., EMBO J. 4(2):453-456, 1985; Thein et al., Blood 71(2):313-319, 1988), human collagen, polyoma virus (Batt et al., Mol. Cell Biol. 15(9):4783-4790, 1995), the Herpes simplex virus thymidine kinase gene (HSV TK), IgG heavy-chain gene polyadenylation signal (US 2006/0040354), human growth hormone (hGH) (Szymanski et al., Mol. Therapy 15(7):1340-1347, 2007), the group consisting of SV40 poly(A) site, such as the SV40 late and early poly(A) site (Schek et al., Mol. Cell Biol. 12(12):5386-5393, 1992).
[0163] The poly(A) signal sequence can be AATAAA. The AATAAA sequence may be substituted with other hexanucleotide sequences with homology to AATAAA and that are capable of signaling polyadenylation, including ATTAAA, AGTAAA, CATAAA, TATAAA, GATAAA, ACTAAA, AATATA, AAGAAA, AATAAT, AAAAAA, AATGAA, AATCAA, AACAAA, AATCAA, AATAAC, AATAGA, AATTAA, or AATAAG (see, e.g., WO 06/12414).
[0164] In some embodiments, the poly(A) signal sequence can be a synthetic polyadenylation site (see, e.g., the pCl-neo expression vector of Promega that is based on Levitt el al, Genes Dev. 3(7):1019-1025, 1989). In some embodiments, the poly(A) signal sequence is the polyadenylation signal of soluble neuropilin-1 (sNRP) (AAATAAAATACGAAATG; SEQ ID NO: 11) (see, e.g., WO 05/073384). Additional examples of poly(A) signal sequences are known in the art.
Internal Ribosome Entry Site (IRES)
[0165] In some embodiments, a vector (e.g., an adeno-associated virus (AAV) vector) encoding an antibody (e.g., an antibody heavy chain and an antibody light chain), an antigen-binding antibody fragment, or a soluble VEGF receptor can include a polynucleotide internal ribosome entry site (IRES). An IRES sequence is used to produce more than one polypeptide from a single gene transcript. An IRES forms a complex secondary structure that allows translation initiation to occur from any position with an mRNA immediately downstream from where the IRES is located (see, e.g., Pelletier and Sonenberg, Mol. Cell. Biol. 8(3):1103-1112, 1988).
[0166] There are several IRES sequences known to those in skilled in the art, including those from, e.g., foot and mouth disease virus (FMDV), encephalomyocarditis virus (EMCV), human rhinovirus (HRV), cricket paralysis virus, human immunodeficiency virus (HIV), hepatitis A virus (HAV), hepatitis C virus (HCV), and poliovirus (PV). See e.g., Alberts, Molecular Biology of the Cell, Garland Science, 2002; and Hellen et al., Genes Dev. 15(13):1593-612, 2001.
[0167] In some embodiments, the IRES sequence that is incorporated into the AAV vector is the foot and mouth diseause virus (FMDV) 2A sequence. The Foot and Mouth Disease Virus 2A sequence is a small peptide (approximately 18 amino acids in length) that has been shown to mediate the cleavage of polyproteins (Ryan, M D et al., EMBO 4:928-933, 1994; Mattion et al., J. Virology 70:8124-8127, 1996; Furler et al., Gene Therapy 8:864-873, 2001; and Halpin et al., Plant Journal 4:453-459, 1999). The cleavage activity of the 2A sequence has previously been demonstrated in artificial systems including plasmids and gene therapy vectors (AAV and retroviruses) (Ryan et al., EMBO 4:928-933, 1994; Mattion et al., J. Virology 70:8124-8127, 1996; Furler et al., Gene Therapy 8:864-873, 2001; and Halpin et al., Plant Journal 4:453-459, 1999; de Felipe et al., Gene Therapy 6:198-208, 1999; de Felipe et al., Human Gene Therapy 11:1921-1931, 2000; and Klump et al., Gene Therapy 8:811-817, 2001).
Reporter Sequences
[0168] Any of the AAVs provided herein can optionally include a sequence encoding a reporter protein (a reporter sequence). Non-limiting examples of reporter sequences include DNA sequences encoding: a beta-lactamase, a beta-galactosidase (LacZ), an alkaline phosphatase, a thymidine kinase, a green fluorescent protein (GFP), a red fluorescent protein, an mCherry fluorescent protein, a yellow fluorescent protein, a chloramphenicol acetyltransferase (CAT), and a luciferase. Additional examples of reporter sequences are known in the art. When associated with regulatory elements which drive their expression, the reporter sequence can provide signals detectable by conventional means, including enzymatic, radiographic, colorimetric, fluorescence, or other spectrographic assays; fluorescent activating cell sorting (FACS) assays; immunological assays (e.g., enzyme linked immunosorbent assay (ELISA), radioimmunoassay (RIA), and immunohistochemistry).
[0169] In some embodiments, the reporter sequence is the LacZ gene, and the presence of a vector carrying the LacZ gene in a mammalian cell (e.g., a cochlear hair cell) is detected by assays for beta-galactosidase activity. When the reporter is a fluorescent protein (e.g., green fluorescent protein) or luciferase, the presence of a vector carrying the fluorescent protein or luciferase in a mammalian cell (e.g., a cochlear hair cell) may be measured by fluorescent techniques (e.g., fluorescent microscopy or FACS) or light production in a luminometer (e.g., a spectrophotometer or an IVIS imaging instrument). In some embodiments, the reporter sequence can be used to verify the tissue-specific targeting capabilities and tissue-specific promoter regulatory activity of any of the vectors described herein.
Flanking Regions Untranslated Regions (UTRs)
[0170] In some embodiments, any of the adeno-associated virus (AAV) vectors can include an untranslated region, such as a 5 UTR or a 3 UTR.
[0171] Untranslated regions (UTRs) of a gene are transcribed but not translated. The 5 UTR starts at the transcription start site and continues to the start codon but does not include the start codon. The 3 UTR starts immediately following the stop codon and continues until the transcriptional termination signal. There is growing body of evidence about the regulatory roles played by the UTRs in terms of stability of the nucleic acid molecule and translation. The regulatory features of a UTR can be incorporated into any of the vectors, compositions, kits, or methods as described herein to enhance the expression of an antibody (e.g., an antibody that binds specifically to VEGF), an antigen-binding antibody fragment (e.g., an antigen-binding fragment that binds specifically to VEGF), or a soluble VEGF receptor.
[0172] Natural 5 UTRs include a sequence that plays a role in translation initiation. They harbor signatures like Kozak sequences, which are commonly known to be involved in the process by which the ribosome initiates translation of many genes. Kozak sequences have the consensus sequence CCR(A/G)CCAUGG, where R is a purine (A or G) three bases upstream of the start codon (AUG), and the start codon is followed by another G. The 5 UTRs have also been known to form secondary structures that are involved in elongation factor binding.
[0173] In some embodiments, a 5 UTR is included in any of the vectors described herein. Non-limiting examples of 5 UTRs, including those from the following genes: albumin, serum amyloid A, Apolipoprotein A/B/E, transferrin, alpha fetoprotein, erythropoietin, and Factor VIII, can be used to enhance expression of a nucleic acid molecule, such as a mRNA.
[0174] In some embodiments, a 5 UTR from a mRNA that is transcribed by a cell in the cochlea can be included in any of the vectors, compositions, kits, and methods described herein.
[0175] 3 UTRs are known to have stretches of adenosines and uridines (in the RNA form) or thymidines (in the DNA form) embedded in them. These AU-rich signatures are particularly prevalent in genes with high rates of turnover. Based on their sequence features and functional properties, the AU-rich elements (AREs) can be separated into three classes (Chen et al., Mol. Cell. Biol. 15:5777-5788, 1995; Chen et al., Mol. Cell Biol. 15:2010-2018, 1995): Class I AREs contain several dispersed copies of an AUUUA motif within U-rich regions. For example, c-Myc and MyoD mRNAs contain class I AREs. Class II AREs possess two or more overlapping UUAUUUA(U/A) (U/A) nonamers. GM-CSF and TNF-alpha mRNAs are examples that contain class II AREs. Class III AREs are less well defined. These U-rich regions do not contain an AUUUA motif. Two well-studied examples of this class are c-Jun and myogenin mRNAs.
[0176] Most proteins binding to the AREs are known to destabilize the messenger, whereas members of the ELAV family, most notably HuR, have been documented to increase the stability of mRNA. HuR binds to AREs of all the three classes. Engineering the HuR specific binding sites into the 3 UTR of nucleic acid molecules will lead to HuR binding and thus, stabilization of the message in vivo.
[0177] In some embodiments, the introduction, removal, or modification of 3 UTR AREs can be used to modulate the stability of an mRNA encoding a protein of interest (e.g., any antibody described herein, any antigen-binding antibody fragment described herein, or any soluble VEGF receptor described herein). In other embodiments, AREs can be removed or mutated to increase the intracellular stability and thus increase translation and production of a protein of interest (e.g., any antibody described herein, any antigen-binding antibody fragment described herein, or any soluble VEGF receptor described herein).
[0178] In other embodiments, non-ARE sequences may be incorporated into the 5 or 3 UTRs. In some embodiments, introns or portions of intron sequences may be incorporated into the flanking regions of the polynucleotides in any of the vectors, compositions, kits, and methods provided herein. Incorporation of intronic sequences may increase protein production as well as mRNA levels.
Fc Mutations that Decrease the Half-Life of an Antibody, Antigen-Binding Antibody Fragment, or a Soluble VEGF Receptor in a Mammal
[0179] Any of the antibodies, antigen-binding antibody fragments, or soluble VEGF receptors described herein can include one or more (e.g., two, three, four, five, six, seven, eight, nine, or ten) amino acid substitutions in the Fc region that decrease the half-life of the antibody, the antigen-binding antibody fragment, or soluble VEGF receptor in a mammal, e.g., as compared to the half-life of an otherwise identical antibody, antigen-binding antibody fragment, or soluble VEGF receptor not including at least one of the one or more amino acid substituions in the Fc region. Methods for determining the half-life of an antibody, antigen-binding antibody fragment, or soluble VEGF receptor in a mammal are well-known in the art.
[0180] Non-limiting examples of point mutations in a Fc mutation that can decrease the half-life of an antibody, an antigen-binding antibody fragment, or soluble VEGF receptor are described in Leabman et al., MAbs 5(6):896-903, 2013.
Methods
[0181] Also provided herein are methods that include introducing into an inner ear of a mammal a therapeutically effective amount of an adeno-associated virus (AAV) vector that includes a nucleotide sequence encoding (a) a polypeptide including an antibody heavy chain variable domain (e.g., any of the exemplary antibody heavy chain variable domains described herein) operably linked to a signal peptide (e.g., any of the signal peptides described herein) and a polypeptide including an antibody light chain variable domain (e.g., any of the exemplary antibody light chain variable domains described herein) operably linked to a signal peptide (e.g., any of the signal peptides described herein); (b) a polypeptide including an antigen-binding antibody fragment (e.g., a scFv) (e.g., any of the exemplary antigen-binding antibody fragments described herein) operably linked to a signal peptide (e.g., any of the signal peptides described herein), or (c) a soluble VEGF receptor (e.g., any of the soluble VEGF receptors described herein) operably linked to a signal peptide (e.g., any of the signal peptides described herein). Also provided herein are methods for increasing the level of an antibody or an antigen-binding antibody fragment in an inner ear of a mammal in need thereof, that include: introducing into the inner ear of the mammal a therapeutically effective amount of an AAV vector that includes a nucleotide sequence encoding (a) a polypeptide including an antibody heavy chain variable domain (e.g., any of the antibody heavy chain variable domains described herein) operably linked to a signal peptide and a polypeptide including an antibody light chain variable domain (e.g., any of the antibody light chain variable domains described herein) operably linked to a signal peptide; or (b) a polypeptide including an antigen-binding antibody fragment (e.g., a scFv) (e.g., any of the exemplary antigen-binding antibody fragments described herein) operably linked to a signal peptide (e.g., any of the exemplary signal peptides described herein); where the introducing results in an increase (e.g., a 1% to 400% increase (or any of the subranges of this range described herein), or at least a 1%, at least a 10%, at least a 20%, at least a 30%, at least a 40%, at least a 50%, at least a 60%, at least a 70%, at least a 80%, at least a 90%, at least a 100%, at least a 150%, at least a 200%, at least a 250%, at least a 300%, at least a 350%, at least a 400%, at least a 450%, at least a 500%, at least a 550%, at least a 600%, at least a 650%, at least a 700% , at least a 750%, at least a 800%, at least a 850%, at least a 900%, at least a 950%, at least a 1000%, at least a 1100%, at least a 1200%, at least a 1300%, at least a 1400%, at least a 1500%, at least a 1600%, at least a 1700%, at least a 1800%, at least a 1900%, or at least a 2000% increase) in the level of the antibody or the antigen-binding antibody fragment in the inner ear of the mammal, e.g., as compared to the level of the antibody or the antigen-binding antibody fragment in the inner ear of the mammal prior to the administration.
[0182] Also provided herein are methods for increasing the level of a soluble VEGF receptor that include: introducing into the inner ear of the mammal a therapeutically effective amount of an AAV vector that includes a nucleotide sequence encoding a soluble VEGF receptor (e.g., any of the soluble VEGF receptors described herein) operably linked to a signal peptide (e.g., any of the signal peptides described herein); where the introducing results in an increase (e.g., a 1% to 400% increase (or any of the subranges of this range described herein), or at least a 1%, at least a 10%, at least a 20%, at least a 30%, at least a 40%, at least a 50%, at least a 60%, at least a 70%, at least a 80%, at least a 90%, at least a 100%, at least a 150%, at least a 200%, at least a 250%, at least a 300%, at least a 350%, at least a 400%, at least a 450%, at least a 500%, at least a 550%, at least a 600%, at least a 650%, at least a 700% , at least a 750%, at least a 800%, at least a 850%, at least a 900%, at least a 950%, at least a 1000%, at least a 1100%, at least a 1200%, at least a 1300%, at least a 1400%, at least a 1500%, at least a 1600%, at least a 1700%, at least a 1800%, at least a 1900%, or at least a 2000% increase) in the level of the soluble VEGF receptor in the inner ear of the mammal, e.g., as compared to the level of the soluble VEGF receptor in the inner ear of the mammal prior to the administration.
[0183] Also provided herein are methods for treating an inner ear disorder in a mammal in need thereof that include introducing into the inner ear of the mammal a therapeutically effective amount of an AAV vector that comprises a nucleotide sequence encoding: (a) a polypeptide including an antibody heavy chain variable domain (e.g., e.g., any of the antibody heavy chain variable domains described herein) operably linked to a signal peptide (e.g., any of the signal peptides described herein) and a polypeptide comprising an antibody light chain variable domain (e.g., any of the antibody light chain variable domains described herein) operably linked to a signal peptide (e.g., any of the signal peptides described herein); (b) a polypeptide including an antigen-binding antibody fragment (e.g., any of the exemplary antigen-binding antibody fragments described herein) linked to a signal peptide (e.g., any of the signal peptides described herein); or (c) a soluble VEGF receptor (e.g., any of the soluble VEGR receptors described herein) operably linked to a signal peptide (e.g., any of the signal peptides described herein), where the introducing results in the treatment of the inner ear disorder in the mammal. In some embodiments, treatment of an inner ear disorder results in a reduction (e.g., a 1% to 100% reduction, or any of the subranges of this range described herein) in the severity, frequency, or number of symptoms of an inner ear disorder in a mammal following the introducing as compared to before the introducing. In some embodiments, treatment of any inner ear disorder results in an increase (e.g., a 1% to 400% increase, or any of the subranges of this range described herein) in the hearing (e.g., one or more metrics of hearing) of the mammal following the introducing as compared to before the introducing.
[0184] In some embodiments of any of these methods, the antibody or the antigen-binding antibody fragment, or the soluble VEGF receptor, binds specifically to a vascular endothelial growth factor (VEGF) (e.g., one of more of VEGF-A, VEGF-B, VEGF-C, and VEGF-D, e.g., one or more of human VEGF-A, human VEGF-B, human VEGF-C, and human VEGF-D). In some embodiments of any of these methods, the AAV vector further includes one or both of a promoter and a Kozak sequence that are operably linked to the sequence encoding the antibody or the antigen-binding antibody fragment. In some embodiments wherein the AAV vector comprises a promoter selected from the group consisting of: an inducible promoter, a constitutive promoter, and a tissue-specific promoter. In some embodiments of any of these methods, the AAV vector further includes a polyadenylation signal sequence. In some embodiments of any of these methods, the mammal is a human. In some embodiments of any of these methods, the mammal (e.g., the human) has been identified as having an inner ear disorder. In some embodiments of any of these methods, the mammal (e.g., the human) has previously been diagnosed as having an inner ear disorder. In some embodiments of any of these methods, the vector includes a nucleic acid sequence encoding a polypeptide comprising an antibody heavy chain and an antibody light chain. In some embodiments of any of these methods, the vector includes a nucleic acid sequence encoding an antigen-binding antibody fragment. In some embodiments of any of these methods, the vector include a nucleic acid sequence encoding a soluble VEGF receptor operably linked to a signal peptide.
[0185] Also provided herein are methods of reducing a VEGF activity (e.g., one or more of VEGF-A, VEGF-B, VEGF-C, and VEGF-D, e.g., one or more of human VEGF-A, human VEGF-B, human VEGF-C, and human VEGF-D) in an inner ear of a mammal in need thereof that include: introducing into the inner ear of the mammal a therapeutically effective amount of an AAV vector that includes a nucleotide sequence encoding (a) a polypeptide including an antibody heavy chain variable domain (e.g., any of the antibody heavy chain variable domains described herein) operably linked to a signal peptide (e.g., any of the signal peptides described herein) and a polypeptide including an antibody light chain variable domain (e.g., any of the antibody light chain variable domains described herein) operably linked to a signal peptide (e.g., any of the signal peptides described herein); (b) a polypeptide including an antigen-binding antibody fragment (e.g., a Fab or a scFv) (e.g., any of the antigen-binding antibody fragments described herein) operably linked to a signal peptide (e.g., any of the signal peptides described herein); or (c) a soluble VEGF receptor (e.g., any of the soluble VEGF receptors described herein) operably linked to a signal peptide (e.g., any of the signal peptides described herein), where the polypeptide of (a) includes an antibody that binds specifically to a VEGF and reduces a VEGF activity, the polypeptide of (b) includes an antigen-binding antibody fragment that binds specifically to a VEGF and reduces a VEGF activity, or the soluble VEGF receptor of (c) binds specifically to one or more VEGF proteins and reduces the activity of the one or more VEGF proteins; and where the introducing results in a reduction (e.g., a 1% to 100% reduction, or any of the subranges of this range described herein) in a VEGF activity (e.g., an activity of one or more of VEGF-A, VEGF-B, VEGF-C, and VEGF-D, e.g., one or more human VEGF-A, human VEGF-B, human VEGF-C, and human VEGF-D) in the inner ear of the mammal, e.g., as compared to the VEGF activity in the mammal prior to the introducing. A reduction in a VEGF activity in a mammal can be detected using any of the exemplary methods described herein.
[0186] Also provided herein are methods of treating acoustic neuroma, vestibular schwannoma, or neurofibromatosis type II (NF2) in an inner ear of a mammal that include: introducing into the inner ear of the mammal a therapeutically effective amount of an AAV vector that includes a nucleotide sequence encoding (a) a polypeptide including an antibody heavy chain variable domain (e.g., any of the antibody heavy chain variable domains described herein) operably linked to a signal peptide (e.g., any of the signal peptides described herein) and a polypeptide including an antibody light chain variable domain (e.g., any of the antibody light chain variable domains described herein) operably linked to a signal peptide (e.g., any of the signal peptides described herein); (b) a polypeptide including an antigen-binding antibody fragment (e.g., a Fab or a scFv) (e.g., any of the antigen-binding antibody fragments described herein) operably linked to a signal peptide (e.g., any of the signal peptides described herein), or (c) a soluble VEGF receptor (e.g., any of the soluble VEGF receptors described herein) operably linked to a signal peptide (e.g., any of the signal peptides described herein); where the polypeptide of (a) encodes an antibody that binds specifically to a VEGF (e.g., one or more of VEGF-A, VEGF-B, VEGF-C, and VEGF-D, e.g., one or more of human VEGF-A, human VEGF-B, human VEGF-C, and human VEGF-D) and reduces the VEGF activity, the polypeptide of (b) encodes an antigen-binding antibody fragment that binds specifically to a VEGF (e.g., one or more of VEGF-A, VEGF-B, VEGF-C, and VEGF-D, e.g., one or more of human VEGF-A, human VEGF-B, human VEGF-C, and human VEGF-D) and reduces the VEGF activity, or the soluble VEGF receptor of (c) binds to specifically to one or more of VEGF-A, VEGF-B, VEGF-C, and VEGF-D (e.g., one or more of human VEGF-A, human VEGF-B, human VEGF-C, and human VEGF-D) and where the introducing results in treatment of acoustic neuroma, vestibular schwannoma, or neurofibromatosis type II (NF2) in the inner ear of the mammal. As described herein, successful treatment of one or more of an acoustic neuroma, vestibular schwannoma, or neurofibromatosis type II can be detected by observing a reduction (e.g., a 1% to 100% decrease, or any of the subranges of this range described herein) in the number, severity, or frequency of one or more symptoms of an acoustic neuroma, vestibular schwannoma, or neurofibromatosis type II, respectively, in the mammal, e.g., as compared to before the introducing step.
[0187] In some embodiments of any of these methods, the vector includes a nucleic acid sequence encoding a polypeptide encoding an antibody heavy chain variable domain (e.g., any of the antibody heavy chains described herein) and an antibody light chain variable domain (e.g., any of the antibody light chain variable domains described herein). In some embodiments of any of these methods, the vector includes a nucleic acid sequence encoding a polypeptide comprising an antigen-binding antibody fragment (e.g., any of the antigen-binding antibody fragments described herein). In some embodiments of any of these methods, the vector includes a nucleic acid sequence encoding a soluble VEGF receptor (e.g., any of the soluble VEGF receptors described herein) operably linked to a signal peptide (e.g., any of the signal peptides described herein). In some embodiments of any of these methods, the AAV vector further includes one or both of a promoter and a Kozak sequence that are operably linked to the sequence encoding the antibody or the antigen-binding antibody fragment. In some embodiments, the AAV vector comprises a promoter, where the promoter is selected from the group consisting of: an inducible promoter, a constitutive promoter, or a tissue-specific promoter. In some embodiments, the AAV vector further includes a polyadenylation signal sequence. In some embodiments of any of these methods, the mammal is a human. In some embodiments of any of these methods, the mammal (e.g., the human) has been identified as having an inner ear disorder. In some embodiments of any of these methods, the mammal (e.g., the human) has previously been diagnosed as having an inner ear disorder. In some embodiments of any of these methods, the mammal (e.g., the human) has been identified or diagnosed as having drug-induced hearing loss. In some embodiments of any of these methods, the mammal (e.g., the human) has been identified or diagnosed as having age-related hearing loss.
[0188] In some embodiments, the antibody or antigen-binding fragment thereof includes a Fc region that includes one or more point mutations that decrease the half-life of the antibody or antigen-binding antibody fragment in vivo.
[0189] In some embodiments of any of these methods, two or more doses of any of the adeno-associated virus (AAV) vectors described herein are introduced or administered into the inner ear of the mammal or subject. Some embodiments of any of these methods can include introducing or administering a first dose of the adeno-associated virus (AAV) vectors into the inner ear of the mammal or subject, assessing hearing function of the mammal or subject following the introducing or the administering of the first dose, and administering an additional dose of the adeno-associated virus (AAV) vector into the inner ear of the mammal or subject found not to have a hearing function within a normal range (e.g., as determined using any test for hearing known in the art).
[0190] In some embodiments of any of the methods described herein, the adeno-associated virus (AAV) vectors can be formulated for intra-cochlear administration. In some embodiments of any of the methods described herein, the adeno-associated virus (AAV) vectors described herein can be administered via intra-cochlear administration or local administration. In some embodiments of any of the methods described herein, the adeno-associated virus (AAV) vectors are administered through the use of a medical device (e.g., any of the exemplary medical devices described herein).
[0191] In some embodiments, intra-cochlear administration can be performed using any of the methods described herein or known in the art. For example, an adeno-associated virus (AAV) vector can be administered or introduced into the cochlea using the following surgical technique: first using visualization with a 0 degree, 2.5-mm rigid endoscope, the external auditory canal is cleared and a round knife is used to sharply delineate an approximately 5-mm tympanomeatal flap. The tympanomeatal flap is then elevated and the middle ear is entered posteriorly. The chorda tympani nerve is identified and divided, and a currette is used to remove the scutal bone, exposing the round window membrane. To enhance apical distribution of the administered or introduced adeno-associated virus (AAV) vector, a surgical laser may be used to make a small 2-mm fenestration in the oval window to allow for perilymph displacement during trans-round window membrane infusion of the adeno-associated virus (AAV) vectors. The microinfusion device is then primed and brought into the surgical field. The device is maneuvered to the round window, and the tip is seated within the bony round window overhang to allow for penetration of the membrane by the microneedle(s). The footpedal is engaged to allow for a measured, steady infusion of the adeno-associated virus (AAV) vectors. The device is then withdrawn and the round window and stapes foot plate are sealed with a gelfoam patch.
[0192] In some embodiments of any of the methods described herein, the subject or mammal is a rodent, a non-human primate, or a human. In some embodiments of any of the methods described herein, the subject or mammal is an adult, a teenager, a juvenile, a child, a toddler, an infant, or a newborn. In some embodiments of any of the methods described herein, the subject or mammal is 1-5, 1-10, 1-20, 1-30, 1-40, 1-50, 1-60, 1-70, 1-80, 1-90, 1-100, 1-110, 2-5, 2-10, 10-20, 20-30, 30-40, 40-50, 50-60, 60-70, 70-80, 80-90, 90-100, 100-110, 10-30, 10-40, 10-50, 10-60, 10-70, 10-80, 10-90, 10-100, 10-110, 20-40, 20-50, 20-60, 20-70, 20-80, 20-90, 20-100, 20-110, 30-50, 30-60, 30-70, 30-80, 30-90, 30-100, 40-60, 40-70, 40-80, 40-90, 40-100, 50-70, 50-80, 50-90, 50-100, 60-80, 60-90, 60-100, 70-90, 70-100, 70-110, 80-100, 80-110, or 90-110 years of age. In some embodiments of any of the methods described herein, the subject or mammal is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or 11 months of age.
[0193] In some embodiments of any of the methods described herein, the subject or mammal has or is at risk of developing hearing loss (e.g., drug-induced hearing loss). In some embodiments of any of the methods described herein, the subject or mammal has been previously identified as having a mutation in a VEGF gene.
[0194] In some embodiments, successful treatment of hearing loss (e.g., drug-induced hearing loss) can be determined in a subject using any of the conventional functional hearing tests known in the art. Non-limiting examples of functional hearing tests are various types of audiometric assays (e.g., pure-tone testing, speech testing, test of the middle ear, auditory brainstem response, and otoacoustic emissions).
[0195] Methods for introducing any of the adeno-associated virus (AAV) vectors described herein into a mammalian cell are known in the art (e.g., via lipofection or through the use of a viral vector, e.g., any of the viral vectors described herein).
Pharmaceutical Compositions and Kits
[0196] In some embodiments, any of the compositions described herein can further include one or more agents that promote the entry of a nucleic acid or any of the vectors described herein into a mammalian cell (e.g., a liposome or cationic lipid). In some embodiments, any of the vectors described herein can be formulated using natural and/or synthetic polymers. Non-limiting examples of polymers that may be included in any of the compositions described herein can include, but are not limited to, DYNAMIC POLYCONJUGATE (Arrowhead Research Corp., Pasadena, Calif.), formulations from Mirus Bio (Madison, Wis.) and Roche Madison (Madison, Wis.), PhaseRX polymer formulations such as, without limitation, SMARTT POLYMER TECHNOLOGY (PhaseRX, Seattle, Wash.), DMRI/DOPE, poloxamer, VAXFECTIN adjuvant from Vical (San Diego, Calif.), chitosan, cyclodextrin from Calando Pharmaceuticals (Pasadena, Calif.), dendrimers and poly (lactic-co-glycolic acid) (PLGA) polymers, RONDEL (RNAi/Oligonucleotide Nanoparticle Delivery) polymers (Arrowhead Research Corporation, Pasadena, Calif.), and pH responsive co-block polymers, such as, but not limited to, those produced by PhaseRX (Seattle, Wash.). Many of these polymers have demonstrated efficacy in delivering oligonucleotides in vivo into a mammalian cell (see, e.g., deFougerolles, Human Gene Ther. 19:125-132, 2008; Rozema et al., Proc. Natl. Acad. Sci. U.S.A. 104:12982-12887, 2007; Rozema et al., Proc. Natl. Acad. Sci. U.S.A. 104:12982-12887, 2007; Hu-Lieskovan et al., Cancer Res. 65:8984-8982, 2005; Heidel et al., Proc. Natl. Acad. Sci. U.S.A. 104:5715-5721, 2007).
[0197] Any of the compositions described herein can be, e.g., a pharmaceutical composition. A pharmaceutical composition can include any of the compositions described herein and one or more pharmaceutically or physiologically acceptable carriers, diluents, or excipients. Such compositions may comprise one or more buffers, such as neutral-buffered saline, phosphate-buffered saline, and the like; one or more carbohydrates, such as glucose, mannose, sucrose, and dextran; mannitol; one or more proteins, polypeptides, or amino acids, such as glycine; one or more antioxidants; one or more chelating agents, such as EDTA or glutathione; and/or one or more preservatives.
[0198] In some embodiments, the composition includes a pharmaceutically acceptable carrier (e.g., phosphate buffered saline, saline, or bacteriostatic water). Upon formulation, solutions will be administered in a manner compatible with the dosage formulation and in such amount as is therapeutically effective. The formulations are easily administered in a variety of dosage forms such as injectable solutions, injectable gels, drug-release capsules, and the like.
[0199] As used herein, the term pharmaceutically acceptable carrier includes solvents, dispersion media, coatings, antibacterial agents, antifungal agents, and the like that are compatible with pharmaceutical administration. Supplementary active compounds can also be incorporated into any of the compostions described herein.
[0200] In some embodiments, a single dose of any of the compositions described herein can include a total sum amount of the at least two different vectors of at least 1 ng, at least 2 ng, at least 4 ng, about 6 ng, about 8 ng, at least 10 ng, at least 20 ng, at least 30 ng, at least 40 ng, at least 50 ng, at least 60 ng, at least 70 ng, at least 80 ng, at least 90 ng, at least 100 ng, at least 200 ng, at least 300 ng, at least 400 ng, at least 500 ng, at least 1 g, at least 2 g, at least 4 g, at least 6 g, at least 8 g, at least 10 g, at least 12 g, at least 14 g, at least 16 g, at least 18 g, at least 20 g, at least 22 g, at least 24 g, at least 26 g, at least 28 g, at least 30 pg at least 32 g, at least 34 g, at least 36 g, at least 38 g, at least 40 g, at least 42 g, at least 44 g, at least 46 g, at least 48 g, at least 50 g, at least 52 g, at least 54 g, at least 56 g, at least 58 g, at least 60 g, at least 62 g, at least 64 g, at least 66 g, at least 68 g, at least 70 g, at least 72 g, at least 74 g, at least 76 g, at least 78 g, at least 80 g, at least 82 g, at least 84 g, at least 86 g, at least 88 g, at least 90 g, at least 92 g, at least 94 g, at least 96 g, at least 98 g, at least 100 g, at least 102 g, at least 104 g, at least 106 g, at least 108 g, at least 110 g, at least 112 g, at least 114 g, at least 116 g, at least 118 g, at least 120 g, at least 122 g, at least 124 g, at least 126 g, at least 128 g, at least 130 pg at least 132 g, at least 134 g, at least 136 g, at least 138 g, at least 140 g, at least 142 g, at least 144 g, at least 146 g, at least 148 g, at least 150 g, at least 152 g, at least 154 g, at least 156 g, at least 158 g, at least 160 g, at least 162 g, at least 164 g, at least 166 g, at least 168 g, at least 170 g, at least 172 g, at least 174 g, at least 176 g, at least 178 g, at least 180 g, at least 182 g, at least 184 g, at least 186 g, at least 188 g, at least 190 g, at least 192 g, at least 194 g, at least 196 g, at least 198 g, or at least 200 g, e.g., in a buffered solution.
[0201] The compositions provided herein can be, e.g., formulated to be compatible with their intended route of administration. A non-limiting example of an intended route of administration is local administration (e.g., intra-cochlear administration). In some embodiments, the therapeutic compositions are formulated to include a lipid nanoparticle. In some embodiments, the therapeutic compositions are formulated to include a polymeric nanoparticle. In some embodiments, the therapeutic compositions are formulated to comprise a mini-circle DNA. In some embodiments, the therapeutic compositions are formulated to comprise a CELiD DNA. In some embodiments, the therapeutic compositions are formulated to comprise a synthetic perilymph solution. An exemplary synthetic perilymph solution includes 20-200 mM NaCl; 1-5 mM KCl; 0.1-10 mM CaCl.sub.2; 1-10 mM glucose; 2-50 mM HEPES, having a pH of between about 6 and about 9.
[0202] Also provided are kits including any of the compositions described herein. In some embodiments, a kit can include a solid composition (e.g., a lyophilized composition including the at least two different vectors described herein) and a liquid for solubilizing the lyophilized composition. In some embodiments, a kit can include a pre-loaded syringe including any of the compositions described herein.
[0203] In some embodiments, the kit includes a vial comprising any of the compositions described herein (e.g., formulated as an aqueous composition, e.g., an aqueous pharmaceutical composition).
[0204] In some embodiments, the kits can include instructions for performing any of the methods described herein.
Devices and Surgical Methods
[0205] Provided herein are therapeutic delivery systems for treating hearing loss (e.g., acoustic neuromas/vestibular schwannomas and associated-hearing loss). In one aspect, the therapeutic delivery systems include i) a medical device capable of creating one or a plurality of incisions in a round window membrane of an inner ear of a human subject in need thereof, and ii) an effective dose of a composition (e.g., any of the compositions described herein). In some embodiments, the medical device includes a plurality of micro-needles.
[0206] Also provided herein are surgical methods for treatment of hearing loss (e.g., acoustic neuromas/vestibular schwannomas and associated-hearing loss). In some embodiments, the methods include the steps of: introducing into a cochlea of a human subject a first incision at a first incision point; and administering intra-cochlearly a therapeutically effective amount of any of the compositions provided herein. In some embodiments, the composition is administered to the subject at the first incision point. In some embodiments, the composition is administered to the subject into or through the first incision.
[0207] In some embodiments of any of the methods described herein, any of the compositions described herein is administered to the subject into or through the cochlea oval window membrane. In some embodiments of any of the methods described herein, any of the compositions described herein is administered to the subject into or through the cochlea round window membrane. In some embodiments of any of the methods described herein, the composition is administered using a medical device capable of creating a plurality of incisions in the round window membrane. In some embodiments, the medical device includes a plurality of micro-needles. In some embodiments, the medical device includes a plurality of micro-needles including a generally circular first aspect, where each micro-needle has a diameter of at least about 10 microns. In some embodiments, the medical device includes a base and/or a reservoir capable of holding the composition. In some embodiments, the medical device includes a plurality of hollow micro-needles individually including a lumen capable of transferring the composition. In some embodiments, the medical device includes a means for generating at least a partial vacuum.
[0208] The invention is further described in detail by reference to the following experimental examples. These examples are provided for purposes of illustration only, and are not intended to be limiting unless otherwise specified. Thus, the invention should in no way be construed as being limited to the following examples, but rather should be construed to encompass any and all variations that become evident as a result of the teaching provided herein.
[0209] Without further description, it is believed that one of ordinary skill in the art can, using the preceding description and the following illustrative examples, make and utilize the compositions of the present invention and practice the claimed methods. The following working examples specifically point out various aspects of the present invention, and are not to be construed as limiting in any way the remainder of the disclosure.
EXAMPLES
Example 1
Construction of Viral Vectors
[0210] Four different recombinant AAV vectors were generated and are shown in
[0211] The vector in
TABLE-US-00007 CCTGCAGGCAGCTGCGCGCTCGCTCGCTCACTGAGGCCGCCCGGGCGTCG GGCGACCTTTGGTCGCCCGGCCTCAGTGAGCGAGCGAGCGCGCAGAGAGG GAGTGGCCAACTCCATCACTAGGGGTTCCTGCGGCCGCACGCGT(5 ITR;SEQIDNO:36); GACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTA GTTCATAGCCCATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGG CCCGCCTGGCTGACCGCCCAACGACCCCCGCCCATTGACGTCAATAATGA CGTATGTTCCCATAGTAACGCCAATAGGGACTTTCCATTGACGTCAATGG GTGGACTATTTACGGTAAACTGCCCACTTGGCAGTACATCAAGTGTATCA TATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCT GGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTAC ATCTACGTATTAGTCATCGCTATTACCATGGGTCGAGGTGAGCCCCACGT TCTGCTTCACTCTCCCCATCTCCCCCCCCTCCCCACCCCCAATTTTGTAT TTATTTATTTTTTAATTATTTTGTGCAGCGATGGGGGCGGGGGGGGGGGG GGCGCGCGCCAGGCGGGGCGGGGCGGGGCGAGGGGCGGGGCGGGGCGAGG CGGAGAGGTGCGGCGGCAGCCAATCAGAGCGGCGCGCTCCGAAAGTTTCC TTTTATGGCGAGGCGGCGGCGGCGGCGGCCCTATAAAAAGCGAAGCGCGC GGCGGGCGGGAGTCGCTGCGTTGCCTTCGCCCCGTGCCCCGCTCCGCGCC GCCTCGCGCCGCCCGCCCCGGCTCTGACTGACCGCGTTACTCCCACAGGT GAGCGGGCGGGACGGCCCTTCTCCTCCGGGCTGTAATTAGCGCTTGGTTT AATGACGGCTCGTTTCTTTTCTGTGGCTGCGTGAAAGCCTTAAAGGGCTC CGGGAGGGCCCTTTGTGCGGGGGGGAGCGGCTCGGGGGGTGCGTGCGTGT GTGTGTGCGTGGGGAGCGCCGCGTGCGGCCCGCGCTGCCCGGCGGCTGTG AGCGCTGCGGGCGCGGCGCGGGGCTTTGTGCGCTCCGCGTGTGCGCGAGG GGAGCGCGGCCGGGGGCGGTGCCCCGCGGTGCGGGGGGGCTGCGAGGGGA ACAAAGGCTGCGTGCGGGGTGTGTGCGTGGGGGGGTGAGCAGGGGGTGTG GGCGCGGCGGTCGGGCTGTAACCCCCCCCTGCACCCCCCTCCCCGAGTTG CTGAGCACGGCCCGGCTTCGGGTGCGGGGCTCCGTGCGGGGCGTGGCGCG GGGCTCGCCGTGCCGGGCGGGGGGTGGCGGCAGGTGGGGGTGCCGGGCGG GGCGGGGCCGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCGCGGCGGCC CCCGGAGCGCCGGCGGCTGTCGAGGCGCGGCGAGCCGCAGCCATTGCCTT TTATGGTAATCGTGCGAGAGGGCGCAGGGACTTCCTTTGTCCCAAATCTG TGCGGAGCCGAAATCTGGGAGGCGCCGCCGCACCCCCTCTAGCGGGCGCG GGGCGAAGCGGTGCGGCGCCGGCAGGAAGGAAATGGGCGGGGAGGGCCTT CGTGCGTCGCCGCGCCGCCGTCCCCTTCTCCCTCTCCAGCCTCGGGGCTG TCCGCGGGGGGACGGCTGCCTTCGGGGGGGACGGGGCAGGGCGGGGTTCG GCTTCTGGCGTGTGACCGGCGGCTCTAGAGCCTCTGCTAACCATGTTCAT GCCTTCTTCTTTTTCCTACAG(CBAsequence;SEQIDNO: 37); CTCCTGGGCAACGTGCTGGTTATTGTGACCGGTGCCACC(spacer; SEQIDNO:38); ATGTACCGGATGCAGCTGCTGAGCTGTATCGCCCTGTCTCTGGCCCTGGT CACCAATTCT(IL-2secretionsignalsequence;SEQID NO:39); GAGGTGCAGCTGGTGGAATCTGGCGGCGGACTTGTTCAACCTGGCGGCTC TCTGAGACTGAGCTGTGCCGCTTCTGGCTACACCTTCACCAACTACGGCA TGAACTGGGTCCGACAGGCCCCTGGCAAAGGCCTTGAATGGGTCGGATGG ATCAACACCTACACCGGCGAGCCAACATACGCCGCCGACTTCAAGCGGAG ATTCACCTTCAGCCTGGACACCAGCAAGAGCACCGCCTACCTGCAGATGA ACAGCCTGAGAGCCGAGGACACCGCCGTGTACTACTGCGCCAAGTATCCC CACTACTACGGCAGCAGCCACTGGTACTTTGACGTGTGGGGACAGGGCAC ACTGGTCACAGTGTCTAGCGCCTCTACAAAGGGCCCCAGCGTTTTCCCAC TGGCTCCTAGCAGCAAGTCTACCAGCGGAGGAACAGCCGCTCTGGGCTGT CTGGTCAAGGACTACTTTCCCGAGCCTGTGACCGTGTCCTGGAATTCTGG CGCTCTGACAAGCGGCGTGCACACCTTTCCAGCTGTGCTGCAAAGCAGCG GCCTGTACTCTCTGAGCAGCGTCGTGACAGTGCCAAGCAGCTCTCTGGGC ACCCAGACCTACATCTGCAATGTGAACCACAAGCCTAGCAACACCAAGGT GGACAAGAAGGTGGAACCCAAGAGCTGCGACAAGACCCACACCTGTCCTC CATGTCCTGCTCCAGAACTGCTCGGCGGACCTTCCGTGTTCCTGTTTCCT CCAAAGCCTAAGGACACCCTGATGATCAGCAGAACCCCTGAAGTGACCTG CGTGGTGGTGGATGTGTCCCACGAGGATCCCGAAGTGAAGTTCAATTGGT ACGTGGACGGCGTGGAAGTGCACAACGCCAAGACCAAGCCTAGAGAGGAA CAGTACAACAGCACCTACAGAGTGGTGTCCGTGCTGACCGTGCTGCACCA GGATTGGCTGAACGGCAAAGAGTACAAGTGCAAGGTGTCCAACAAGGCCC TGCCTGCTCCTATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCTAGG GAACCCCAGGTTTACACACTGCCTCCAAGCCGGGAAGAGATGACCAAGAA CCAGGTGTCCCTGACCTGCCTCGTGAAGGGCTTCTACCCTTCCGATATCG CCGTGGAATGGGAGAGCAATGGCCAGCCAGAGAACAACTACAAGACAACC CCTCCTGTGCTGGACAGCGACGGCTCATTCTTCCTGTACAGCAAGCTGAC AGTGGACAAGTCCAGATGGCAGCAGGGCAACGTGTTCAGCTGCAGCGTGA TGCACGAGGCCCTGCACAACCACTACACCCAGAAGTCTCTGAGCCTGTCT CCTGGCAAG(sequenceencodingheavychainof bevacizumab;SEQIDNO:40); CGGAAGAGAAGA(linkersequence;SEQIDNO:41); GGCTCTGGCGAAGGCAGAGGCAGCCTGCTTACATGTGGCGACGTGGAAGA GAACCCCGGACCT(T2Asequence;SEQIDNO:42); ATGTATAGAATGCAGCTCCTGTCCTGCATTGCCCTGAGCCTGGCTCTCGT GACCAACAGC(IL-2secretionsignalsequence;SEQID NO:43); GACATCCAGATGACACAGAGCCCCAGCAGCCTGTCTGCCTCTGTGGGAGA CAGAGTGACCATCACCTGTAGCGCCAGCCAGGACATCTCCAACTACCTGA ACTGGTATCAGCAAAAGCCCGGCAAGGCCCCTAAGGTGCTGATCTACTTC ACAAGCAGCCTGCACTCCGGCGTGCCCAGCAGATTTTCTGGCTCTGGCAG CGGCACCGACTTCACCCTGACCATATCTAGCCTGCAGCCTGAGGACTTCG CCACCTACTACTGCCAGCAGTACAGCACCGTGCCTTGGACATTTGGCCAG GGCACAAAGGTGGAAATCAAGCGGACTGTGGCCGCTCCTAGCGTGTTCAT CTTTCCACCTAGCGACGAGCAGCTGAAGTCTGGCACAGCCTCTGTCGTGT GCCTGCTGAACAACTTCTACCCCAGAGAAGCCAAGGTGCAGTGGAAAGTG GACAATGCCCTGCAGAGCGGCAACAGCCAAGAGAGCGTGACAGAGCAGGA CTCCAAGGATAGCACCTATAGCCTGAGCAGCACCCTGACACTGAGCAAGG CCGACTACGAGAAGCACAAAGTGTACGCCTGCGAAGTGACCCACCAGGGC CTTTCTAGCCCTGTGACCAAGAGCTTCAACCGGGGCGAATGTTAA (sequenceencodinglightchainofbevacizumab;SEQ IDNO:44); GAGCTCGCTGATCAGCCTCGA(linkersequence;SEQID NO:45); CTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCT TCCTTGACCCTGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGA GGAAATTGCATCGCATTGTCTGAGTAGGTGTCATTCTATTCTGGGGGGTG GGGTGGGGCAGGACAGCAAGGGGGAGGATTGGGAAGACAATAGCAGGCAT GCTGGGGATGCGGTGGGCTCTATGG(bovinegrowthhormone polyAtailsequence;SEQIDNO:46); AAGCTTGAATTCAGCTGACGTGCCTCGGACCGCT(linker sequence;SEQIDNO:47); and AGGAACCCCTAGTGATGGAGTTGGCCACTCCCTCTCTGCGCGCTCGCTCG CTCACTGAGGCCGGGCGACCAAAGGTCGCCCGACGCCCGGGCTTTGCCCG GGCGGCCTCAGTGAGCGAGCGAGCGCGCAGCTGCCTGCAGG(3ITR; SEQIDNO:48).
[0212] The IL-2 signal sequence encoded by each of SEQ ID NOs: 39 and 43 is MYRMQLLSCIALSLALVTNS (SEQ ID NO: 49). The T2A sequence encoded by SEQ ID NO: 42 is GSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 50). SEQ ID NO: 40 encodes the heavy chain of bevacizumab (SEQ ID NO: 6). SEQ ID NO: 44 encodes the light chain of bevacizumab (SEQ ID NO: 5). The last three nucleotides in SEQ ID NO: 44 are a stop codon.
[0213] The vector in
TABLE-US-00008 CCTGCAGGCAGCTGCGCGCTCGCTCGCTCACTGAGGCCGCCCGGGCGTCG GGCGACCTTTGGTCGCCCGGCCTCAGTGAGCGAGCGAGCGCGCAGAGAGG GAGTGGCCAACTCCATCACTAGGGGTTCCTGCGGCCGCACGCGT(3 ITR;SEQIDNO:36); GACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTA GTTCATAGCCCATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGG CCCGCCTGGCTGACCGCCCAACGACCCCCGCCCATTGACGTCAATAATGA CGTATGTTCCCATAGTAACGCCAATAGGGACTTTCCATTGACGTCAATGG GTGGACTATTTACGGTAAACTGCCCACTTGGCAGTACATCAAGTGTATCA TATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCT GGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTAC ATCTACGTATTAGTCATCGCTATTACCATGGGTCGAGGTGAGCCCCACGT TCTGCTTCACTCTCCCCATCTCCCCCCCCTCCCCACCCCCAATTTTGTAT TTATTTATTTTTTAATTATTTTGTGCAGCGATGGGGGCGGGGGGGGGGGG GGCGCGCGCCAGGCGGGGCGGGGCGGGGCGAGGGGCGGGGCGGGGCGAGG CGGAGAGGTGCGGCGGCAGCCAATCAGAGCGGCGCGCTCCGAAAGTTTCC TTTTATGGCGAGGCGGCGGCGGCGGCGGCCCTATAAAAAGCGAAGCGCGC GGCGGGCGGGAGTCGCTGCGTTGCCTTCGCCCCGTGCCCCGCTCCGCGCC GCCTCGCGCCGCCCGCCCCGGCTCTGACTGACCGCGTTACTCCCACAGGT GAGCGGGCGGGACGGCCCTTCTCCTCCGGGCTGTAATTAGCGCTTGGTTT AATGACGGCTCGTTTCTTTTCTGTGGCTGCGTGAAAGCCTTAAAGGGCTC CGGGAGGGCCCTTTGTGCGGGGGGGAGCGGCTCGGGGGGTGCGTGCGTGT GTGTGTGCGTGGGGAGCGCCGCGTGCGGCCCGCGCTGCCCGGCGGCTGTG AGCGCTGCGGGCGCGGCGCGGGGCTTTGTGCGCTCCGCGTGTGCGCGAGG GGAGCGCGGCCGGGGGCGGTGCCCCGCGGTGCGGGGGGGCTGCGAGGGGA ACAAAGGCTGCGTGCGGGGTGTGTGCGTGGGGGGGTGAGCAGGGGGTGTG GGCGCGGCGGTCGGGCTGTAACCCCCCCCTGCACCCCCCTCCCCGAGTTG CTGAGCACGGCCCGGCTTCGGGTGCGGGGCTCCGTGCGGGGCGTGGCGCG GGGCTCGCCGTGCCGGGCGGGGGGTGGCGGCAGGTGGGGGTGCCGGGCGG GGCGGGGCCGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCGCGGCGGCC CCCGGAGCGCCGGCGGCTGTCGAGGCGCGGCGAGCCGCAGCCATTGCCTT TTATGGTAATCGTGCGAGAGGGCGCAGGGACTTCCTTTGTCCCAAATCTG TGCGGAGCCGAAATCTGGGAGGCGCCGCCGCACCCCCTCTAGCGGGCGCG GGGCGAAGCGGTGCGGCGCCGGCAGGAAGGAAATGGGCGGGGAGGGCCTT CGTGCGTCGCCGCGCCGCCGTCCCCTTCTCCCTCTCCAGCCTCGGGGCTG TCCGCGGGGGGACGGCTGCCTTCGGGGGGGACGGGGCAGGGCGGGGTTCG GCTTCTGGCGTGTGACCGGCGGCTCTAGAGCCTCTGCTAACCATGTTCAT GCCTTCTTCTTTTTCCTACAG(CBAsequence;SEQIDNO: 37); CTCCTGGGCAACGTGCTGGTTATTGTGACCGGTGCCACC(linker sequence;SEQIDNO:38); ATGTACCGGATGCAGCTGCTGAGCTGTATCGCCCTGTCTCTGGCCCTGGT CACCAATTCT(IL-2secretionsignalsequence;SEQID NO:39); GAGGTGCAGCTGGTGGAATCTGGCGGCGGACTTGTTCAACCTGGCGGCTC TCTGAGACTGAGCTGTGCCGCTTCTGGCTACGACTTCACCCACTACGGCA TGAACTGGGTCCGACAGGCCCCTGGCAAAGGCCTTGAATGGGTCGGATGG ATCAACACCTACACCGGCGAGCCAACATACGCCGCCGACTTCAAGCGGAG ATTCACCTTCAGCCTGGACACCAGCAAGAGCACCGCCTACCTGCAGATGA ACAGCCTGAGAGCCGAGGACACCGCCGTGTACTACTGCGCCAAGTATCCC TACTACTACGGCACCAGCCACTGGTACTTTGACGTGTGGGGACAGGGCAC ACTGGTCACAGTGTCTAGCGCCTCTACAAAGGGCCCCAGCGTTTTCCCAC TGGCTCCTAGCAGCAAGTCTACCAGCGGAGGAACAGCCGCTCTGGGCTGT CTGGTCAAGGACTACTTTCCCGAGCCTGTGACCGTGTCCTGGAATTCTGG CGCTCTGACAAGCGGCGTGCACACCTTTCCAGCTGTGCTGCAAAGCAGCG GCCTGTACTCTCTGAGCAGCGTCGTGACAGTGCCAAGCAGCTCTCTGGGC ACCCAGACCTACATCTGCAATGTGAACCACAAGCCTAGCAACACCAAGGT GGACAAGAAGGTGGAACCCAAGAGCTGCGACAAGACCCACACCGGCAAG (sequenceencodingranibizumabheavychain;SEQID NO:52); CGGAAGAGAAGA(linkersequence;SEQIDNO:41); GGCTCTGGCGAAGGCAGAGGCAGCCTGCTTACATGTGGCGACGTGGAAGA GAACCCCGGACCT(T2Asequence;SEQIDNO:42); ATGTATAGAATGCAGCTCCTGTCCTGCATTGCCCTGAGCCTGGCTCTCGT GACCAACAGC(IL-2signalsecretionsequence;SEQID NO:43); GACATCCAGCTGACACAGAGCCCCAGCAGCCTGTCTGCCTCTGTGGGAGA CAGAGTGACCATCACCTGTAGCGCCAGCCAGGACATCTCCAACTACCTGA ACTGGTATCAGCAAAAGCCCGGCAAGGCCCCTAAGGTGCTGATCTACTTC ACAAGCAGCCTGCACTCCGGCGTGCCCAGCAGATTTTCTGGCTCTGGCAG CGGCACCGACTTCACCCTGACCATATCTAGCCTGCAGCCTGAGGACTTCG CCACCTACTACTGCCAGCAGTACAGCACCGTGCCTTGGACATTTGGCCAG GGCACAAAGGTGGAAATCAAGCGGACTGTGGCCGCTCCTAGCGTGTTCAT CTTTCCACCTAGCGACGAGCAGCTGAAGTCTGGCACAGCCTCTGTCGTGT GCCTGCTGAACAACTTCTACCCCAGAGAAGCCAAGGTGCAGTGGAAAGTG GACAATGCCCTGCAGAGCGGCAACAGCCAAGAGAGCGTGACAGAGCAGGA CTCCAAGGATAGCACCTATAGCCTGAGCAGCACCCTGACACTGAGCAAGG CCGACTACGAGAAGCACAAAGTGTACGCCTGCGAAGTGACCCACCAGGGC CTTTCTAGCCCTGTGACCAAGAGCTTCAACCGGGGCGAATGTTAA (sequenceencodingranibizumablightchain;SEQID NO:53). GAGCTCGCTGATCAGCCTCGA(linkersequence;SEQIDNO: 45); CTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCT TCCTTGACCCTGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGA GGAAATTGCATCGCATTGTCTGAGTAGGTGTCATTCTATTCTGGGGGGTG GGGTGGGGCAGGACAGCAAGGGGGAGGATTGGGAAGACAATAGCAGGCAT GCTGGGGATGCGGTGGGCTCTATGG(bovinegrowthhormone polyAtailsequence;SEQIDNO:46); and AAGCTTGAATTCAGCTGACGTGCCTCGGACCGCT(linker;SEQID NO:47); AGGAACCCCTAGTGATGGAGTTGGCCACTCCCTCTCTGCGCGCTCGCTCG CTCACTGAGGCCGGGCGACCAAAGGTCGCCCGACGCCCGGGCTTTGCCCG GGCGGCCTCAGTGAGCGAGCGAGCGCGCAGCTGCCTGCAGG(SEQID NO:48).
[0214] The IL-2 signal sequence encoded by each of SEQ ID NOs: 39 and 43 is MYRMQLLSCIALSLALVTNS (SEQ ID NO: 49). The T2A sequence encoded by SEQ ID NO: 42 is GSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 50). SEQ ID NO: 52 encodes the heavy chain of ranibizumab
TABLE-US-00009 SEQIDNO:53 (EVQLVESGGGLVQPGGSLRLSCAASGYDFTHYGMNWVRQAPGKGLEWVG WINTYTGEPTYAADFKRRFTFSLDTSKSTAYLQMNSLRAEDTAVYYCAKY PYYYGTSHWYFDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALG CLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL GTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTGK;SEQIDNO:54).
encodes the light chain of bevacizumab (SEQ ID NO: 7). The last three nucleotides in SEQ ID NO: 53 are a stop codon.
[0215]
TABLE-US-00010 CCTGCAGGCAGCTGCGCGCTCGCTCGCTCACTGAGGCCGCCCGGGCGTCG GGCGACCTTTGGTCGCCCGGCCTCAGTGAGCGAGCGAGCGCGCAGAGAGG GAGTGGCCAACTCCATCACTAGGGGTTCCTGCGGCCGCACGCGT(5 ITR;SEQIDNO:36); GACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTA GTTCATAGCCCATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGG CCCGCCTGGCTGACCGCCCAACGACCCCCGCCCATTGACGTCAATAATGA CGTATGTTCCCATAGTAACGCCAATAGGGACTTTCCATTGACGTCAATGG GTGGACTATTTACGGTAAACTGCCCACTTGGCAGTACATCAAGTGTATCA TATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCT GGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTAC ATCTACGTATTAGTCATCGCTATTACCATGGGTCGAGGTGAGCCCCACGT TCTGCTTCACTCTCCCCATCTCCCCCCCCTCCCCACCCCCAATTTTGTAT TTATTTATTTTTTAATTATTTTGTGCAGCGATGGGGGCGGGGGGGGGGGG GGCGCGCGCCAGGCGGGGCGGGGCGGGGCGAGGGGCGGGGCGGGGCGAGG CGGAGAGGTGCGGCGGCAGCCAATCAGAGCGGCGCGCTCCGAAAGTTTCC TTTTATGGCGAGGCGGCGGCGGCGGCGGCCCTATAAAAAGCGAAGCGCGC GGCGGGCGGGAGTCGCTGCGTTGCCTTCGCCCCGTGCCCCGCTCCGCGCC GCCTCGCGCCGCCCGCCCCGGCTCTGACTGACCGCGTTACTCCCACAGGT GAGCGGGCGGGACGGCCCTTCTCCTCCGGGCTGTAATTAGCGCTTGGTTT AATGACGGCTCGTTTCTTTTCTGTGGCTGCGTGAAAGCCTTAAAGGGCTC CGGGAGGGCCCTTTGTGCGGGGGGGAGCGGCTCGGGGGGTGCGTGCGTGT GTGTGTGCGTGGGGAGCGCCGCGTGCGGCCCGCGCTGCCCGGCGGCTGTG AGCGCTGCGGGCGCGGCGCGGGGCTTTGTGCGCTCCGCGTGTGCGCGAGG GGAGCGCGGCCGGGGGCGGTGCCCCGCGGTGCGGGGGGGCTGCGAGGGGA ACAAAGGCTGCGTGCGGGGTGTGTGCGTGGGGGGGTGAGCAGGGGGTGTG GGCGCGGCGGTCGGGCTGTAACCCCCCCCTGCACCCCCCTCCCCGAGTTG CTGAGCACGGCCCGGCTTCGGGTGCGGGGCTCCGTGCGGGGCGTGGCGCG GGGCTCGCCGTGCCGGGCGGGGGGTGGCGGCAGGTGGGGGTGCCGGGCGG GGCGGGGCCGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCGCGGCGGCC CCCGGAGCGCCGGCGGCTGTCGAGGCGCGGCGAGCCGCAGCCATTGCCTT TTATGGTAATCGTGCGAGAGGGCGCAGGGACTTCCTTTGTCCCAAATCTG TGCGGAGCCGAAATCTGGGAGGCGCCGCCGCACCCCCTCTAGCGGGCGCG GGGCGAAGCGGTGCGGCGCCGGCAGGAAGGAAATGGGCGGGGAGGGCCTT CGTGCGTCGCCGCGCCGCCGTCCCCTTCTCCCTCTCCAGCCTCGGGGCTG TCCGCGGGGGGACGGCTGCCTTCGGGGGGGACGGGGCAGGGCGGGGTTCG GCTTCTGGCGTGTGACCGGCGGCTCTAGAGCCTCTGCTAACCATGTTCAT GCCTTCTTCTTTTTCCTACAG(CBAsequence;SEQIDNO:37); CTCCTGGGCAACGTGCTGGTTATTGTGACCGGTGCCACC(linker sequence;SEQIDNO:38); ATGTACCGGATGCAGCTGCTGAGCTGTATCGCCCTGTCTCTGGCCCTGGT CACCAATTCT(IL-2secretionsignalsequence;SEQID NO:39); GAGGTGCAGCTGGTGGAATCTGGCGGCGGACTTGTTCAACCTGGCGGCTC TCTGAGACTGAGCTGTGCCGCTTCTGGCTACGACTTCACCCACTACGGCA TGAACTGGGTCCGACAGGCCCCTGGCAAAGGCCTTGAATGGGTCGGATGG ATCAACACCTACACCGGCGAGCCAACATACGCCGCCGACTTCAAGCGGAG ATTCACCTTCAGCCTGGACACCAGCAAGAGCACCGCCTACCTGCAGATGA ACAGCCTGAGAGCCGAGGACACCGCCGTGTACTACTGCGCCAAGTATCCC TACTACTACGGCACCAGCCACTGGTACTTTGACGTGTGGGGACAGGGCAC ACTGGTCACAGTGTCTAGCGCCTCTACAAAGGGCCCCAGCGTTTTCCCAC TGGCTCCTAGCAGCAAGTCTACCAGCGGAGGAACAGCCGCTCTGGGCTGT CTGGTCAAGGACTACTTTCCCGAGCCTGTGACCGTGTCCTGGAATTCTGG CGCTCTGACAAGCGGCGTGCACACCTTTCCAGCTGTGCTGCAAAGCAGCG GCCTGTACTCTCTGAGCAGCGTCGTGACAGTGCCAAGCAGCTCTCTGGGC ACCCAGACCTACATCTGCAATGTGAACCACAAGCCTAGCAACACCAAGGT GGACAAGAAGGTGGAACCCAAGAGCTGCGACAAGACCCACACCGGCAAG (sequenceencodingranibizumabheavychain;SEQID NO:52); CGGAAGAGAAGA(linkersequence;SEQIDNO:41); GGCTCTGGCGAAGGCAGAGGCAGCCTGCTTACATGTGGCGACGTGGAAGA GAACCCCGGACCT(T2Asequence;SEQIDNO:42); ATGTATAGAATGCAGCTCCTGTCCTGCATTGCCCTGAGCCTGGCTCTCGT GACCAACAGC(IL-2signalsecretionsequence;SEQID NO:43); GACATCCAGCTGACACAGAGCCCCAGCAGCCTGTCTGCCTCTGTGGGAGA CAGAGTGACCATCACCTGTAGCGCCAGCCAGGACATCTCCAACTACCTGA ACTGGTATCAGCAAAAGCCCGGCAAGGCCCCTAAGGTGCTGATCTACTTC ACAAGCAGCCTGCACTCCGGCGTGCCCAGCAGATTTTCTGGCTCTGGCAG CGGCACCGACTTCACCCTGACCATATCTAGCCTGCAGCCTGAGGACTTCG CCACCTACTACTGCCAGCAGTACAGCACCGTGCCTTGGACATTTGGCCAG GGCACAAAGGTGGAAATCAAGCGGACTGTGGCCGCTCCTAGCGTGTTCAT CTTTCCACCTAGCGACGAGCAGCTGAAGTCTGGCACAGCCTCTGTCGTGT GCCTGCTGAACAACTTCTACCCCAGAGAAGCCAAGGTGCAGTGGAAAGTG GACAATGCCCTGCAGAGCGGCAACAGCCAAGAGAGCGTGACAGAGCAGGA CTCCAAGGATAGCACCTATAGCCTGAGCAGCACCCTGACACTGAGCAAGG CCGACTACGAGAAGCACAAAGTGTACGCCTGCGAAGTGACCCACCAGGGC CTTTCTAGCCCTGTGACCAAGAGCTTCAACCGGGGCGAATGT (sequenceencodingranibizumablightchain;SEQID NO:56); GGCTCCGGAGAGGGCAGAGGAAGTCTGCTAACATGCGGTGACGTCGAGGA GAATCCTGGCCCA(linkersequence;SEQIDNO:57); ATGGAGAGCGACGAGAGCGGCCTGCCCGCCATGGAGATCGAGTGCCGCAT CACCGGCACCCTGAACGGCGTGGAGTTCGAGCTGGTGGGCGGCGGAGAGG GCACCCCCGAGCAGGGCCGCATGACCAACAAGATGAAGAGCACCAAAGGC GCCCTGACCTTCAGCCCCTACCTGCTGAGCCACGTGATGGGCTACGGCTT CTACCACTTCGGCACCTACCCCAGCGGCTACGAGAACCCCTTCCTGCACG CCATCAACAACGGCGGCTACACCAACACCCGCATCGAGAAGTACGAGGAC GGCGGCGTGCTGCACGTGAGCTTCAGCTACCGCTACGAGGCCGGCCGCGT GATCGGCGACTTCAAGGTGATGGGCACCGGCTTCCCCGAGGACAGCGTGA TCTTCACCGACAAGATCATCCGCAGCAACGCCACCGTGGAGCACCTGCAC CCCATGGGCGATAACGATCTGGATGGCAGCTTCACCCGCACCTTCAGCCT GCGCGACGGCGGCTACTACAGCTCCGTGGTGGACAGCCACATGCACTTCA AGAGCGCCATCCACCCCAGCATCCTGCAGAACGGGGGCCCCATGTTCGCC TTCCGCCGCGTGGAGGAGGATCACAGCAACACCGAGCTGGGCATCGTGGA GTACCAGCACGCCTTCAAGACCCCGGATGCAGATGCCGGTGAAGAATAA (sequenceencodingTurboGFP;SEQIDNO:58); GAGCTCGCTGATCAGCCTCGA(linkersequence;SEQIDNO: 45); CTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCT TCCTTGACCCTGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGA GGAAATTGCATCGCATTGTCTGAGTAGGTGTCATTCTATTCTGGGGGGTG GGGTGGGGCAGGACAGCAAGGGGGAGGATTGGGAAGACAATAGCAGGCAT GCTGGGGATGCGGTGGGCTCTATGG(bovinegrowthhormone polyAtailsequence;SEQIDNO:46); AAGCTTGAATTCAGCTGACGTGCCTCGGACCGCT(linker sequence;SEQIDNO:47); and AGGAACCCCTAGTGATGGAGTTGGCCACTCCCTCTCTGCGCGCTCGCTCG CTCACTGAGGCCGGGCGACCAAAGGTCGCCCGACGCCCGGGCTTTGCCCG GGCGGCCTCAGTGAGCGAGCGAGCGCGCAGCTGCCTGCAGG(3ITR; SEQIDNO:48).
[0216] The IL-2 signal sequence encoded by each of SEQ ID NOs: 39 and 43 is MYRMQLLSCIALSLALVTNS (SEQ ID NO: 49). The T2A sequence encoded by SEQ ID NO: 42 is GSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 50). SEQ ID NO: 52 encodes the heavy chain of ranibizumab (SEQ ID NO: 54). SEQ ID NO: 56 encodes the light chain of bevacizumab (SEQ ID NO: 7). SEQ ID NO: 58 encodes TurboGFP (MESDESGLPAMEIECRITGTLNGVEFELVGGGEGTPEQGRMTNKMKSTKGA LTFSPYLLSHVMGYGFYHFGTYPSGYENPFLHAINNGGYTNTRIEKYEDGGV LHVSFSYRYEAGRVIGDFKVMGTGFPEDSVIFTDKIIRSNATVEHLHPMGDND LDGSFTRTFSLRDGGYYSSVVDSHMHFKSAIHPSILQNGGPMFAFRRVEEDHS NTELGIVEYQHAFKTPDADAGEE; SEQ ID NO: 59). The last three nucleotides in SEQ ID NO: 58 is a stop codon.
[0217]
TABLE-US-00011 CCTGCAGGCAGCTGCGCGCTCGCTCGCTCACTGAGGCCGCCCGGGCGTCG GGCGACCTTTGGTCGCCCGGCCTCAGTGAGCGAGCGAGCGCGCAGAGAGG GAGTGGCCAACTCCATCACTAGGGGTTCCTGCGGCCGCACGCGT(5 ITR;SEQIDNO:36); GACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTA GTTCATAGCCCATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGG CCCGCCTGGCTGACCGCCCAACGACCCCCGCCCATTGACGTCAATAATGA CGTATGTTCCCATAGTAACGCCAATAGGGACTTTCCATTGACGTCAATGG GTGGACTATTTACGGTAAACTGCCCACTTGGCAGTACATCAAGTGTATCA TATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCT GGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTAC ATCTACGTATTAGTCATCGCTATTACCATGGGTCGAGGTGAGCCCCACGT TCTGCTTCACTCTCCCCATCTCCCCCCCCTCCCCACCCCCAATTTTGTAT TTATTTATTTTTTAATTATTTTGTGCAGCGATGGGGGCGGGGGGGGGGGG GGCGCGCGCCAGGCGGGGCGGGGCGGGGCGAGGGGCGGGGCGGGGCGAGG CGGAGAGGTGCGGCGGCAGCCAATCAGAGCGGCGCGCTCCGAAAGTTTCC TTTTATGGCGAGGCGGCGGCGGCGGCGGCCCTATAAAAAGCGAAGCGCGC GGCGGGCGGGAGTCGCTGCGTTGCCTTCGCCCCGTGCCCCGCTCCGCGCC GCCTCGCGCCGCCCGCCCCGGCTCTGACTGACCGCGTTACTCCCACAGGT GAGCGGGCGGGACGGCCCTTCTCCTCCGGGCTGTAATTAGCGCTTGGTTT AATGACGGCTCGTTTCTTTTCTGTGGCTGCGTGAAAGCCTTAAAGGGCTC CGGGAGGGCCCTTTGTGCGGGGGGGAGCGGCTCGGGGGGTGCGTGCGTGT GTGTGTGCGTGGGGAGCGCCGCGTGCGGCCCGCGCTGCCCGGCGGCTGTG AGCGCTGCGGGCGCGGCGCGGGGCTTTGTGCGCTCCGCGTGTGCGCGAGG GGAGCGCGGCCGGGGGCGGTGCCCCGCGGTGCGGGGGGGCTGCGAGGGGA ACAAAGGCTGCGTGCGGGGTGTGTGCGTGGGGGGGTGAGCAGGGGGTGTG GGCGCGGCGGTCGGGCTGTAACCCCCCCCTGCACCCCCCTCCCCGAGTTG CTGAGCACGGCCCGGCTTCGGGTGCGGGGCTCCGTGCGGGGCGTGGCGCG GGGCTCGCCGTGCCGGGCGGGGGGTGGCGGCAGGTGGGGGTGCCGGGCGG GGCGGGGCCGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCGCGGCGGCC CCCGGAGCGCCGGCGGCTGTCGAGGCGCGGCGAGCCGCAGCCATTGCCTT TTATGGTAATCGTGCGAGAGGGCGCAGGGACTTCCTTTGTCCCAAATCTG TGCGGAGCCGAAATCTGGGAGGCGCCGCCGCACCCCCTCTAGCGGGCGCG GGGCGAAGCGGTGCGGCGCCGGCAGGAAGGAAATGGGCGGGGAGGGCCTT CGTGCGTCGCCGCGCCGCCGTCCCCTTCTCCCTCTCCAGCCTCGGGGCTG TCCGCGGGGGGACGGCTGCCTTCGGGGGGGACGGGGCAGGGCGGGGTTCG GCTTCTGGCGTGTGACCGGCGGCTCTAGAGCCTCTGCTAACCATGTTCAT GCCTTCTTCTTTTTCCTACAG(CBAsequence;SEQIDNO:37); CTCCTGGGCAACGTGCTGGTTATTGTGACCGGTGCCACC(spacer; SEQIDNO:38); ATGTACCGGATGCAGCTGCTGAGCTGTATCGCCCTGTCTCTGGCCCTGGT CACCAATTCT(IL-2secretionsignalsequence;SEQID NO:39); AGCGATACCGGCAGACCCTTCGTGGAAATGTACAGCGAGATCCCCGAGAT CATCCACATGACCGAGGGCAGAGAGCTGGTCATCCCCTGCAGAGTGACAA GCCCCAACATCACCGTGACTCTGAAGAAGTTCCCTCTGGACACACTGATC CCCGACGGCAAGAGAATCATCTGGGACAGCCGGAAGGGCTTCATCATCAG CAACGCCACCTACAAAGAGATCGGCCTGCTGACCTGTGAAGCCACCGTGA ATGGCCACCTGTACAAGACCAACTACCTGACACACAGACAGACCAACACC ATCATCGACGTGGTGCTGAGCCCTAGCCACGGCATTGAACTGTCTGTGGG CGAGAAGCTGGTGCTGAACTGTACCGCCAGAACCGAGCTGAACGTGGGCA TCGACTTCAACTGGGAGTACCCCAGCAGCAAGCACCAGCACAAGAAACTG GTCAACCGGGACCTGAAAACCCAGAGCGGCAGCGAGATGAAGAAATTCCT GAGCACCCTGACCATCGACGGCGTGACCAGATCTGACCAGGGCCTGTACA CATGTGCCGCCAGCTCTGGCCTGATGACCAAGAAAAACAGCACCTTCGTG CGGGTGCACGAGAAGGACAAGACCCACACCTGTCCTCCATGTCCTGCTCC AGAACTGCTCGGCGGACCTTCCGTGTTCCTGTTTCCTCCAAAGCCTAAGG ACACCCTGATGATCAGCAGAACCCCTGAAGTGACCTGCGTGGTGGTGGAT GTGTCCCACGAGGATCCCGAAGTGAAGTTCAATTGGTACGTGGACGGCGT GGAAGTGCACAACGCCAAGACCAAGCCTAGAGAGGAACAGTACAATAGCA CCTACAGAGTGGTGTCCGTGCTGACCGTGCTGCACCAGGATTGGCTGAAC GGCAAAGAGTACAAGTGCAAGGTGTCCAACAAGGCCCTGCCTGCTCCTAT CGAGAAAACCATCTCCAAGGCCAAGGGCCAGCCTAGGGAACCCCAGGTTT ACACACTGCCTCCAAGCAGGGACGAGCTGACAAAGAACCAGGTGTCCCTG ACCTGCCTGGTCAAGGGCTTCTACCCTTCCGATATCGCCGTGGAATGGGA GAGCAATGGCCAGCCTGAGAACAACTACAAGACAACCCCTCCTGTGCTGG ACAGCGACGGCTCATTCTTCCTGTACAGCAAGCTGACAGTGGACAAGAGC AGATGGCAGCAGGGCAACGTGTTCAGCTGCAGCGTGATGCACGAGGCCCT GCACAACCACTACACCCAGAAGTCCCTGAGCCTGTCTCCTGGATAA (sequenceencodingaflibercept;SEQIDNO:61); GAGCTCGCTGATCAGCCTCGA(linkersequence;SEQIDNO: 45); CTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCT TCCTTGACCCTGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGA GGAAATTGCATCGCATTGTCTGAGTAGGTGTCATTCTATTCTGGGGGGTG GGGTGGGGCAGGACAGCAAGGGGGAGGATTGGGAAGACAATAGCAGGCAT GCTGGGGATGCGGTGGGCTCTATGG(bovinegrowthhormone polyAtailsequence;SEQIDNO:46); AAGCTTGAATTCAGCTGACGTGCCTCGGACCGCT(linker sequence;SEQIDNO:47); and AGGAACCCCTAGTGATGGAGTTGGCCACTCCCTCTCTGCGCGCTCGCTCG CTCACTGAGGCCGGGCGACCAAAGGTCGCCCGACGCCCGGGCTTTGCCCG GGCGGCCTCAGTGAGCGAGCGAGCGCGCAGCTGCCTGCAGG(3ITR; SEQIDNO:48).
[0218] The IL-2 signal sequence encoded by SEQ ID NO: 39 is MYRMQLLSCIALSLALVTNS (SEQ ID NO: 49). SEQ ID NO: 61 encodes aflibercept (SEQ ID NO: 12). The last three nucleotides in SEQ ID NO: 61 is a stop codon.
[0219] To determine protein expression driven by the AAV vectors shown in
[0220] As shown in
Example 2
Binding Activity of Anti-Human VEGF Monoclonal Antibodies
[0221] A set of experiments were performed to determine the binding activity of bevacizumab produced in HEK293FT cells following transfection with the AAV vector shown in
[0222] The samples, bevacizumab in medium from HEK293TF cells transfected with the AAV vector shown in
[0223] The binding affinities of the conditioned medium samples and mouse anti-human VEGF antibody (R&D) samples were measured in 1 kinetics buffer in Octet HTX biosensor instrument. The binding features and K.sub.D values were generated by the Octet analysis software, Data Analysis HT10.0. As shown in
[0224] In summary, the anti-hVEGF mouse antibody (R&D) showed high binding affinity (K.sub.D was lower than measurable range of 1.010.sup.12 M). The bevacizumab conditioned medium sample showed high binding affinity (K.sub.D was lower than measurable range). No K.sub.D value could be extrapolated from the binding data of control conditioned medium sample.
[0225] In sum, these data show that the AAV vectors provided herein can result in expression and secretion of anti-VEGF antibodies and can be used to express anti-VEGF antibodies in the inner ear of a mammal.
Other Embodiments
[0226] It is to be understood that while the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.
[0227] All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including definitions, will control. Section headings and any descriptions of materials, methods, and examples are illustrative only and not intended to be limiting.