ANTISENSE ANTIBIOTICS AND BACTERIAL SECRETION BASED DELIVERY SYSTEM TO ELIMINATE DRUG-RESISTANT BACTERIA
20210087565 ยท 2021-03-25
Inventors
- Anushree Chatterjee (Lafayette, CO, US)
- Jocelyn Campos (Boulder, CO, US)
- Kristen Alice Eller (Boulder, CO, US)
Cpc classification
A61K47/645
HUMAN NECESSITIES
C12N15/74
CHEMISTRY; METALLURGY
A61K47/64
HUMAN NECESSITIES
C12N15/113
CHEMISTRY; METALLURGY
A61K35/744
HUMAN NECESSITIES
A61K47/549
HUMAN NECESSITIES
C12N15/70
CHEMISTRY; METALLURGY
International classification
C12N15/113
CHEMISTRY; METALLURGY
A61K35/744
HUMAN NECESSITIES
A61K47/64
HUMAN NECESSITIES
C07K14/00
CHEMISTRY; METALLURGY
C12N15/70
CHEMISTRY; METALLURGY
C12N15/74
CHEMISTRY; METALLURGY
Abstract
The present inventions relates to systems, methods and compositions for the rational design of a new classes of antibiotics targeting non-traditional pathways and genes including metabolism, cell signaling, and stress response using sequence-specific peptide nucleic acids (PNAs). The invention further includes systems, methods and compositions for the efficient delivery of PNAs to intracellular pathogens through a novel use of the bacterial secretion system in combination with a cell lysis switch.
Claims
1. An antisense peptide nucleic acid configured to be complementary to at least one target sequence in a bacterial gene, wherein said peptide nucleic acid is configured to be capable of hybridizing to said target sequence and further inhibit expression of said bacterial gene; wherein said antisense peptide nucleic acid is introduced into a bacterium having an endogenous or exogenous expresses Type III secretion system configured to inject said antisense peptide nucleic acid into a eukaryotic cell; and wherein said bacterium comprises a genetically engineered bacterium having a polynucleotide coding sequence operably linked to an inducible promoter encoding a heterologous cell lysis kill switch, having at least one heterologous cell lysis protein; wherein said heterologous cell lysis protein comprises a holin-endolysin protein according to SEQ ID NO. 34.
2. (canceled)
3. The antisense peptide nucleic acid of claim 1 and further comprising a cell penetrating peptide conjugated to said antisense peptide nucleic acid sequence.
4. The antisense peptide nucleic acid of claim 3 wherein said cell penetrating peptide is selected from the group consisting of: (KFF).sub.3K; penetratin; NLS; TAT; Arg(9); D-Arg(9); 10HC; cyLoP-1; and Pep-1.
5. The antisense peptide nucleic acid of claim 4 wherein said cell penetrating peptide is conjugated to said antisense peptide nucleic acid sequence via a linker.
6. (canceled)
7. The antisense peptide nucleic acid of claim 1 wherein said at least one target sequence in a bacterial gene comprises a start codon of a bacterial gene.
8. The antisense peptide nucleic acid of claim 1 wherein said bacterial gene comprises a bacterial gene related to one or more antibiotic pathways such that inhibition of said bacterial gene has a bactericidal and/or bacteriostatic effect, or wherein said bacterial gene comprises a bacterial gene related to a non-traditional antibiotic pathway such that inhibition of said bacterial gene has a bactericidal and/or bacteriostatic effect.
9. (canceled)
10. The antisense peptide nucleic acid of claim 8 wherein said bacterial gene comprises a bacterial gene selected from the group consisting of: folC; ffh; lexA; gyrB; and rpsD.
11. The antisense peptide nucleic acid of claim 8 wherein said antisense peptide nucleic acid configured to be complementary to at least one target sequence in a bacterial gene comprises and antisense peptide nucleic acid configured to be complementary to a nucleic acid sequence selected from the group consisting of: SEQ ID NO's. 1-19.
12-16. (canceled)
17. The antisense peptide nucleic acid of claim 1 wherein said bacterial gene comprises a bacterial gene selected from the group consisting of: a bacterial gene in E. coli, a bacterial gene in K. pneumoniae, and/or a bacterial gene in S. enteric, a multi-drug resistant (MDR) bacteria, carbapenem resistant Enterobacteriaceae Klebsiella pneumonia (CREKP), MDR tuberculosis (MDRTB), MDR Salmonella enterica, MDR Salmonella typhimurium (MDRST), methicillin-resistant Staphylococcus aureus (MRSA), vancomycin-resistant S. aureus (VRSA), extended spectrum -lactamase Klebsiella pneumoniae (ESBL K. pneumoniae), vancomycin-resistant Enterococcus (VRE), carbapenem-resistant Enterobacteriaceae Escherichia coli (CRE E. coli), MDR Escherichia coli (MDR E. coli), New-Delhi metallo--lactamase producing Klebsiella pneumoniae (NDM-1 K. pneumoniae) and MDR Acinetobacter baumannii (MRAB).
18-26. (canceled)
27. A method of delivering an antisense peptide nucleic acid to a host comprising the steps: generating at least one antisense peptide nucleic acid configured to be complementary to at least one target sequence in a bacterial gene, wherein said antisense peptide nucleic acid is configured to be capable of hybridizing to said target sequence and inhibit expression of said bacterial gene; transforming a delivery bacteria with a polynucleotide coding sequence operably linked to an inducible promoter encoding a heterologous cell lysis kill switch, wherein said cell lysis kill switch comprises a polynucleotide expressing: a heterologous holin-endolysin construct according to amino acid sequence SEQ ID NO. 34; a heterologous bacterial secretion system; a heterologous transcriptional activator that induces expression of said heterologous bacterial secretion system; introducing said antisense peptide nucleic acid into said transformed delivery bacteria having said heterologous cell lysis kill switch; and introducing a therapeutically effective amount of said transformed delivery bacteria having one or more of said antisense peptide nucleic acids and further allowing the transport of said antisense peptide nucleic acid into a host cell through said bacterial secretion system and through cell membrane pores formed by said heterologous cell lysis kill switch; lysing said transformed delivery bacteria through the action of said heterologous cell lysis kill switch.
28. The method of claim 27 wherein said bacterial secretion system comprises a bacterial secretion system selected from the group consisting of: a Type-III secretion system, and Type-IV secretion system.
29. The method of claim 27 wherein said transformed delivery bacteria is a probiotic to the host, symbiotic to the host, or endosymbiotic with the host.
30-31. (canceled)
32. The method of claim 27 wherein said heterologous transcriptional activator comprises heterologous VirB transcriptional activator according to amino acid sequence according to SEQ ID NO. 35.
33. (canceled)
34. The method of claim 27 wherein said inducible promoter comprises a promoter that is induced by entry into a host cell.
35. The method of claim 34 wherein said promoter that is induced by entry into a host cell comprises an Ipac promoter from Shigella flexneri induced by entry into a mammalian host cell.
36. The method of claim 27 and further comprising a cell penetrating peptide conjugated to said antisense peptide nucleic acid configured to be complementary to at least one target sequence in a bacterial gene and wherein said cell penetrating peptide is selected from the group consisting of: (KFF).sub.3K; penetratin; NLS; TAT; Arg(9); D-Arg(9); 10HC; cyLoP-1; and Pep-1.
37-38. (canceled)
39. The method of claim 27 wherein said bacterial gene comprises a bacterial gene related to one or more antibiotic pathways such that inhibition of said bacterial gene has a bactericidal and/or bacteriostatic effect or wherein said bacterial gene comprises a bacterial gene related to a non-traditional antibiotic pathway such that inhibition of said bacterial gene has a bactericidal and/or bacteriostatic effect.
40. (canceled)
41. The method of claim 39 wherein said bacterial gene comprises a bacterial gene selected from the group consisting of: folC; ffh; lexA; gyrB; and rpsD.
42. The method of claim 39 wherein said antisense peptide nucleic acid configured to be complementary to at least one target sequence in a bacterial gene comprises and antisense peptide nucleic acid configured to be complementary to a nucleic acid sequence selected from the group consisting of: SEQ ID NO's. 1-19.
43-47. (canceled)
48. The method of claim 27 wherein said bacterial gene comprises a bacterial gene selected from the group consisting of: E. coli, K. pneumoniae, S. enterica, a multi-drug resistant (MDR) bacteria, carbapenem resistant Enterobacteriaceae Klebsiella pneumonia (CREKP), MDR tuberculosis (MDRTB), MDR Salmonella enterica, MDR Salmonella typhimurium (MDRST), methicillin-resistant Staphylococcus aureus (MRSA), vancomycin-resistant S. aureus (VRSA), extended spectrum -lactamase Klebsiella pneumoniae (ESBL K. pneumoniae), vancomycin-resistant Enterococcus (VRE), carbapenem-resistant Enterobacteriaceae Escherichia coli (CRE E. coli), MDR Escherichia coli (MDR E. coli), New-Delhi metallo--lactamase producing Klebsiella pneumoniae (NDM-1 K. pneumoniae) and MDR Acinetobacter baumannii (MRAB).
49-67. (canceled)
Description
BRIEF DESCRIPTION OF DRAWINGS
[0044] The above and other aspects, features, and advantages of the present disclosure will be better understood from the following detailed descriptions taken in conjunction with the accompanying figures, all of which are given by way of illustration only, and are not limiting the presently disclosed embodiments, in which:
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
(CFU.sub.SL1344-mCherry.sup.Lysed/CFU.sub.SL1344-mCherry.sup.Infected With)
to normalized SL1344-Holin:
(CFU.sub.Holin.sup.Lysed/CFU.sub.Holin.sup.Infected With)
where triangles represent individual biological replicates. (C) Normalized intracellular load of each HeLa biological replicate presented as the CFU count of each bacterial strain divided by the total intracellular bacterial load lysed from the individual HeLa cells. Above each bar is the associated MOI that was used to infect the specific biological replicate. Data shown are the average of 3 biological replicates with standard deviation shown as error bars. Significance (represented by an asterisk, p-val<0.05) was determined relative to no treatment.
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
MODE(S) FOR CARRYING OUT THE INVENTION(S)
[0072] The following detailed description is provided to aid those skilled in the art in practicing the various embodiments of the present disclosure, including all the methods, uses, compositions, etc., described herein. Even so, the following detailed description should not be construed to unduly limit the present disclosure, as modifications and variations in the embodiments herein discussed may be made by those of ordinary skill in the art without departing from the spirit or scope of the present discoveries.
[0073] Generally, the inventive technology includes the use of predictive homology to design novel broad-pathogen and gene-specific antisense RNA-inhibitors against clinical isolates of bacteria pathogens. Additional embodiment may include systems and methods to generate novel antibiotic compounds, and in particular novel antisense PNA-antibiotic compounds. In one embodiment, the invention includes the generation of novel antisense-PNA molecules directed to inhibit or downregulate non-traditional antibiotic pathways that may be effective at inhibiting cell growth in MDR clinical isolates. Additional preferred embodiments may include the use of novel antisense-PNA molecules as adjuvants and/or potentiators in combination with antibiotics, preferably directed to MDR bacteria. In certain embodiments, such antisense-PNA molecules may resensitize previously resistant bacterial strains to one or more traditional antibiotics.
[0074] In one specific embodiment, the invention may include methods, systems and compositions to treat MDR bacteria via the systematic design of gene/pathogen-specific PNA antisense therapeutics. In this preferred embodiment, PNA therapeutics may block the translation of a desired gene by binding to the transcriptional initiation region (TIR) for targeted growth inhibition or killing of the desired pathogen. Additional, embodiments of the invention may systems and methods for the novel introduction of antisense-PNA molecules to an intracellular environment through the use of bacterial Type-3 secretion system (T3SS) delivery method. Additional embodiments may include the incorporation introduction of antisense-PNA molecules to an intracellular environment through the use of bacterial (T3SS) delivery system in a non-pathogenic probiotic or endosymbiotic bacterium. In certain embodiments, such PNAs may also be directed to target essential genes in viral, fungal or parasitic pathogens.
[0075] As noted, in additional embodiments of the invention may systems and methods for the novel introduction of various therapeutic and/or diagnostic molecules to an intracellular environment through the use of bacterial secretion system, such as a Type-III (T3SS) or IV (T4SS) secretion system delivery method. Additional embodiments may include the introduction of therapeutic and/or diagnostic molecules, such as an antisense oligonucleotide, to an intracellular environment through the use of bacterial (T3SS) or (T4SS) delivery system in non-pathogenic probiotic bacteria. In certain embodiments, such PNAs or other antisense oligomers may also be directed to target essential genes in viruses among other pathogens. Additional non-limiting examples may include the delivery of one or more therapeutic and/or diagnostic molecules he use of bacterial (T3SS) or (T4SS) delivery system in non-pathogenic probiotic bacteria may be selected from the group consisting of: antibodies, therapeutic peptides, CRISPR, Zinc Fingers, or TALENS, as well as other small compounds or molecules, such as for example antibiotics.
[0076] Additional embodiments may include the introduction of antisense oligomers, such as a PNAs, as well as other therapeutic and/or diagnostic molecules to an intracellular environment through the use of bacterial (T3SS) or (T4SS) delivery system in a bacteroides, such as lactobactillus, L. bulgaricus, S. thermophillus, B. acidifaciens B. barnesiaes, B. caccae, B. caecicola, B. caecigallinarum, B. cellulosilyticus, B. cellulosolvens, B. clarus, B. coagulans, B. coprocola, B. coprophilus, B. coprosuis, B. distasonis, B. dorei, B. eggerthii, B. gracilis, B. faecichinchillae, B. faecis, B. finegoldii, B. fluxus, B. fragilis, B. galacturonicus, B. gallinaceum, B. gallinarum, B. goldsteinii, B. graminisolvens, B. helcogene, B. intestinalis, B. luti, B. massiliensis, B. melaninogenicus, B. nordii, B. oleiciplenus, B. oris, B. ovatus, B. paurosaccharolyticus, B. pectinophilus, B. plebeius, B. polypragmatus, B. propionicifaciens, B. putredinis, B. pyogenes, B. reticulotermitis, B. rodentium, B. salanitronis, B. salyersiae, B. sartorii, B. stercoris, B. stercoris, B. suis, B. tectus, B. thetaiotaomicron, B. uniformis, B. vulgatus, B. xylanisolvens, and B. xylanolyticusxylanolyticus.
[0077] In some embodiments, gene expression of a group of genes in a bacterium may be modulated by an antisense oligomer, such as an antisense PNA-based system. As used herein, PNAs may be DNA analogs in which the phosphate backbone has been replaced by (2-aminoethyl) glycine carboyl units that are linked to the nucleotide bases by the glycine amino nitrogen and methylene carbonyl linkers. The backbone is thus composed of peptide bonds linking the nucleobases. Because the PNA backbone is composed of peptide linkages, the PNA is typically referred to as having an amino-terminal and a carboxy-terminal end. However, a PNA can be also referred to as having a 5 and a 3 end in the conventional sense, with reference to the complementary nucleic acid sequence to which it specifically hybridizes. The sequence of a PNA molecule is described in conventional fashion as having nucleotides G, U, T, A, and C that correspond to the nucleotide sequence of the DNA molecule. Such polynucleotides can be synthesized, for example, using an automated DNA synthesizer. Typically, PNAs are synthesized using either Boc or Fmoc chemistry. PNAs and other polynucleotides can be chemically derivatized by methods known to those skilled in the art. For example, PNAs have amino and carboxy groups at the 5 and 3 ends, respectively, that can be further derivatized. Custom PNAs can also be synthesized and purchased commercially. Since PNA is structurally markedly different from DNA, PNA is very resistant to both proteases and nucleases, and is not recognized by the hepatic transporter(s) recognizing DNA.
[0078] Certain embodiments provide a PNA system for treating a bacterial infection and in particular a MDR bacterium. In accordance with these embodiments, a system can function to target traditional and/or non-traditional antibiotic pathways that may kill or arrest bacteria growth. In some embodiments, a PNA system for treating a bacteria infection includes at least one, at least two, at least three, or at least four or more PNAs, wherein each PNA includes a sequence of at least 5, and up to 20 or more nucleic acids capable of hybridizing to a target sequence of a single (i.e., unique) gene of the bacterium or other pathogen. In some embodiments, the antisense PNA molecules of the PNA system may be configured to target an essential gene of a pathogen, or a combination thereof. Exemplary groups of target genes are generally described above.
[0079] In some embodiments, an essential gene from a traditional, or non-traditional antibiotic target pathway may include essential genes related to metabolism, cell signaling, and stress response may be capable of killing or inhibiting MDR bacterial strains. The genetic DNA sequence, or RNA/mRNA sequences associated with antibiotic resistance that may be targeted with the novel PNAs-based system described herein can be any sequence that confers antibiotic resistance, or aids in development of resistance. In other embodiments, the RNA sequence associated with antibiotic resistance is a regulatory RNA affecting the antibiotic resistance of bacteria. In particular embodiments, the RNA sequence is a small RNA (sRNA) sequence. Regulatory RNAs can affect antibiotic resistance of bacteria by regulating, for example, RNA synthesis, protein synthesis, cell membrane integrity, membrane transporters, and cell wall turnover. These processes and mechanisms are known to be involved in antibiotic resistance of bacteria. Example target genes may include: folC (H2-folate synthetase); ffh (signal recognition particle); lexA (SOS response repressor; gyrB (gyrase subunit B); and/or rpsD (30S ribosomal protein). Naturally such embodiments are exemplary only and not intended to be limiting.
[0080] Certain preferred embodiments provide a PNA system for treating a bacterial infection, and in particular, a MDR bacterial infection. Common drug-resistant bacteria that may be treated by the systems, methods and compositions described herein may include, but not be limited to: carbapenem resistant Enterobacteriaceae Klebsiella pneumonia (CREKP), MDR tuberculosis (MDRTB), MDR Salmonella enterica, MDR Salmonella typhimurium (MDRST), methicillin-resistant Staphylococcus aureus (MRSA), vancomycin-resistant S. aureus (VRSA), extended spectrum -lactamase Klebsiella pneumoniae (ESBL K. pneumoniae), vancomycin-resistant Enterococcus (VRE), carbapenem-resistant Enterobacteriaceae Escherichia coli (CRE E. coli), MDR Escherichia coli (MDR E. coli), New-Delhi metallo--lactamase producing Klebsiella pneumoniae (NDM-1 K. pneumoniae) and MDR Acinetobacter baumannii (MRAB).
[0081] It will be recognized by those of skill in the art that any of the DNA or mRNA sequences described above can be targeted by antisense inhibitors. Target sequences can be those of E. coli or the homologous gene or mRNA sequence in another target bacterium. Given the benefit of this disclosure, those of skill in the art will be able to identify a target sequence and design an antisense inhibitor oligomer to target the gene or mRNA sequence. Target sites on DNA or RNA (e.g. sRNA) associated with antibiotic resistance can be any site to which binding of an antisense oligomer will inhibit the function of the DNA or RNA sequence. Inhibition can be caused by steric interference resulting from an antisense oligomer binding the DNA RNA sequence, thereby preventing proper transcription of the DNA sequence or translation of the RNA sequence. Target sites, such as those identified as SEQ ID NOs. 1-14, on an essential gene associated with an antibiotic or other essential pathway, can be any site to which binding of an antisense oligomer will inhibit transcription of the gene.
[0082] In certain embodiments, antisense sequences are designed to be centered on the start codon of a target gene. For example, as shown in
[0083] More particularly, target sites on an mRNA sequence associated with a traditional or non-traditional antibiotic resistance can be any site to which binding of an antisense oligomer will inhibit expression of the mRNA sequence. Protein functional sites on mRNA have been shown to be effective antisense sites for blocking ribosomal binding and migration. These include the ribosomal binding site (RBS) and translation start site (TSS), which are located in the 5 untranslated region (UTR). In particular embodiments, the target site is a ribosomal binding site (RBS), a translational start site (TSS), or a YUNR motif Targeting an RBS inhibits ribosomal binding to the mRNA, thereby preventing translation of the mRNA, while targeting a TSS, prevents a bound ribosome from migrating past the start codon, thereby inhibiting translation. Targeting a 5 YUNR motif results in a rate-limiting interaction between mRNA and ribosome, and can prevent ribosomal migration, thereby inhibiting mRNA translation.
[0084] An antisense oligomer can be complementary to a single target site or to two or more target sites. For example, an antisense oligomer can be complementary to any one of a TSS, RBS, or YUNR motif. However, an antisense oligomer can be complementary to two or more of the target sites. In particular embodiments, each individual antisense oligomer is complementary to a single target site. Wherein each individual antisense oligomer is complementary to a single target site, the antisense oligomer can be about 10-mers to about 20-mers in length. In certain embodiments, the antisense oligomer is about 12-mers in length. In certain embodiments, the antisense inhibitory oligomers are designed with the target sequence in the middle of the oligomer, with 3-5 nucleotides flanking the overlapping region. This provides for antisense oligomers with both high affinity and specificity. Wherein an individual antisense oligomer is complementary to two or more target sites, the antisense oligomer can be up to about 40-mers in length.
[0085] Because of the neutral PNA backbone, antisense PNAs tend to be hydrophobic. This hydrophobicity can impede uptake of the antisense PNA into bacterial cells. In order to overcome this, in a certain embodiment, a PNA can be linked to a cell penetrating peptide, for example as identified as amino acid sequence=SEQ ID NO. 23. Many cell penetrating peptides are known in the art, including but not limited to (KFF).sub.3K, penetratin, NLS, TAT, Arg(9), D-Arg(9), 10HC, cyLoP-1, Pep-1, and those cell penetrating peptides describe in U.S. Pat. No. 9,238,042 (Frederick et al., 2016, such specific CPP sequences being incorporated herein by reference), and can be linked to an antisense antibiotic oligomer, such as a PNA.
[0086] Antisense PNA sequences may be approximately twelve peptide nucleic acids long, centered on the mRNA target site or start codon. Antisense antibiotic oligomers may comprise the antisense sequence linked to a CPP such as a (KFF).sub.3K CPP attached at the N-terminus via an O-linker. Antisense antibiotic oligomers can comprise RNA or a nucleic acid analog such as PNA, morpholino, LNA, BNA, GNA, TNA, or 2-O-methyl-substituted RNA.
[0087] In other embodiments, antisense inhibitor oligomers are designed against a target gene from one or more bacterial strain, and may be selected from the group of folC (SEQ ID NO. 1-2); rpsD (SEQ ID NO. 3-5); ffh (SEQ ID NO. 6-8); lexA (SEQ ID NO. 9-11); and gyrB (SEQ ID NO. 12-14). In certain embodiments, the antisense oligomers may comprise a CPP linked to the antisense inhibitor oligomer via an O-linker. Sequences and bacterial strains for such antisense inhibitor oligomers are provided in Table 1 and
[0088] A composition of the present disclosure can comprise one or more antisense oligomers, such as an antisense PNA. Where the composition comprises a single antisense oligomer, the antisense oligomer is capable of bactericidal effects, or has bacteriostatic effects. For example, a composition can comprise antisense PNA according to SEQ ID NO. 15, targeting -folC of E. coli according to SEQ ID NOs. 1 or 2, and which binds to the translational start site of folC mRNA. By preventing translation of folC mRNA, this pathway may be inhibited and thereby induce a bactericidal effect. Alternately, an antisense PNA may have a bactericidal effect on its own. As demonstrated in the figures and description contain herein, -rpsD significantly reduced the growth of all clinical isolates, with 99%, 98% and 99% growth inhibition across CRE E. coli, MDR E. coli and MDR STm respectively.
[0089] Also provided herein are compositions including 14 or more unique antisense PNA oligomers that target the sequences identified as SEQ ID NOs. 1-14. (See Table 1). Additionally, antisense PNA compositions identified in
[0090] Such compositions can also have bactericidal or bacteriostatic effects, or can prevent emergence of antibiotic resistance. At least one antisense oligomer may be present in the composition at a pharmaceutically effective concentration or therapeutically effective amount. The pharmaceutically effective concentration of an antisense oligomer will depend on several factors, including but not limited to the oligomer's backbone composition, the affinity of the oligomer for its target, the specificity of the oligomer for its target, and the ability of the oligomer to enter the cell. In certain embodiments, a pharmaceutically effective concentration of an antisense oligomer is that concentration that prevents development of adaptive resistance. In particular embodiments, wherein the antisense oligomer is an antisense PNA.
[0091] As described above, the antisense antibiotic oligomers can be used in a synergistic combination with other known antimicrobial agents which may selected from the group consisting of: penicillins, cephalosporins, carbacephems, cephamycins, carbapenems, monobactams, aminoglycosides, glycopeptides, quinolones, tetracyclines, macrolides, and fluoroquinolones. Examples of antibiotic agents may be further selected from the group consisting of: Penicillin G (CAS Registry No.: 61-33-6); Methicillin (CAS Registry No.: 61-32-5); Nafcillin (CAS Registry No.: 147-52-4); Oxacillin (CAS Registry No.: 66-79-5); Cloxacillin (CAS Registry No.: 61-72-3); Dicloxacillin (CAS Registry No.; 3116-76-5); Ampicillin (CAS Registry No.: 69-53-4); Amoxicillin (CAS Registry No.: 26787-78-0); Ticarcillin (CAS Registry No.: 34787-01-4); Carbenicillin (CAS Registry No.: 4697-36-3); Mezlocillin (CAS Registry No.: 51481-65-3); Azlocillin (CAS Registry No.: 37091-66-0); Piperacillin (CAS Registry No.: 61477-96-1); Imipenem (CAS Registry No.: 74431-23-5); Aztreonam (CAS Registry No.: 78110-38-0); Cephalothin (CAS Registry No.: 153-61-7); Cefazolin (CAS Registry No.: 25953-19-9); Cefaclor (CAS Registry No.: 70356-03-5); Cefamandole formate sodium (CAS Registry No.: 42540-40-9); Cefoxitin (CAS Registry No.: 35607-66-0); Cefuroxime (CAS Registry No.: 55268-75-2); Cefonicid (CAS Registry No.: 61270-58-4); Cefinetazole (CAS Registry No.: 56796-20-4); Cefotetan (CAS Registry No.: 69712-56-7); Cefprozil (CAS Registry No.: 92665-29-7); Lincomycin (CAS Registry No.: 154-21-2); Linezolid (CAS Registry No.: 165800-03-3); Loracarbef (CAS Registry No.: 121961-22-6); Cefetamet (CAS Registry No.: 65052-63-3); Cefoperazone (CAS Registry No.: 62893-19-0); Cefotaxime (CAS Registry No.: 63527-52-6); Ceftizoxime (CAS Registry No.: 68401-81-0); Ceftriaxone (CAS Registry No.: 73384-59-5); Ceftazidime (CAS Registry No.: 72558-82-8); Cefepime (CAS Registry No.: 88040-23-7); Cefixime (CAS Registry No.: 79350-37-1); Cefpodoxime (CAS Registry No.: 80210-62-4); Cefsulodin (CAS Registry No.: 62587-73-9); Fleroxacin (CAS Registry No.: 79660-72-3); Nalidixic acid (CAS Registry No.: 389-08-2); Norfloxacin (CAS Registry No.: 70458-96-7); Ciprofloxacin (CAS Registry No.: 85721-33-1); Ofloxacin (CAS Registry No.: 82419-36-1); Enoxacin (CAS Registry No.: 74011-58-8); Lomefloxacin (CAS Registry No.: 98079-51-7); Cinoxacin (CAS Registry No.: 28657-80-9); Doxycycline (CAS Registry No.: 564-25-0); Minocycline (CAS Registry No.: 10118-90-8); Tetracycline (CAS Registry No.: 60-54-8); Amikacin (CAS Registry No.: 37517-28-5); Gentamicin (CAS Registry No.: 1403-66-3); Kanamycin (CAS Registry No.: 8063-07-8); Netilmicin (CAS Registry No.: 56391-56-1); Tobramycin (CAS Registry No.: 32986-56-4); Streptomycin (CAS Registry No.: 57-92-1); Azithromycin (CAS Registry No.: 83905-01-5); Clarithromycin (CAS Registry No.: 81103-11-9); Erythromycin (CAS Registry No.: 114-07-8); Erythromycin estolate (CAS Registry No.: 3521-62-8); Erythromycin ethyl succinate (CAS Registry No.: 41342-53-4); Erythromycin glucoheptonate (CAS Registry No.: 23067-13-2); Erythromycin lactobionate (CAS Registry No.: 3847-29-8); Erythromycin stearate (CAS Registry No.: 643-22-1); Vancomycin (CAS Registry No.: 1404-90-6); Teicoplanin (CAS Registry No.: 61036-64-4); Chloramphenicol (CAS Registry No.: 56-75-7); Clindamycin (CAS Registry No.: 18323-44-9); Trimethoprim (CAS Registry No.: 738-70-5); Sulfamethoxazole (CAS Registry No.: 723-46-6); Nitrofurantoin (CAS Registry No.: 67-20-9); Rifampin (CAS Registry No.: 13292-46-1); Mupirocin (CAS Registry No.: 12650-69-0); Metronidazole (CAS Registry No.: 443-48-1); Cephalexin (CAS Registry No.: 15686-71-2); Roxithromycin (CAS Registry No.: 80214-83-1); Co-amoxiclavuanate; combinations of Piperacillin and Tazobactam; and their various salts, acids, bases, and other derivatives.
[0092] As generally shown in
[0093] Wherein the composition comprises one or more PNAs having bactericidal or bacteriostatic effects, a subject can be treated for bacterial infection by administering an appropriate dose of the composition. Optionally, such compositions can comprise one or more conventional antibiotics. Compositions described herein can be administered similarly to currently available antibiotics, including but not limited to oral administration, nasal administration, intravenous administration, intramuscular administration, intraperitoneal administration, topical administration, local delivery methods, and in feed and water supplies.
[0094] Subjects to be treated for a bacterial infection can be selected from the group of: human; feed animals including but not limited to cattle, swine, poultry, goat, and sheep; companion animals including but not limited to dog, cat, rodent, bird, and reptile; and laboratory animals. Subjects to be re-sensitized to an antibiotic can be those who have shown resistance to an antibiotic, or to whom an antibiotic is to be given where there is common drug resistance to the antibiotic. A composition described herein can also be provided to a subject in order to prevent or delay development of antibiotic resistance.
[0095] Methods are provided for treating a bacterial infection in a subject in need thereof. Subjects to be treated for a bacterial infection are administered a composition described herein, thereby treating the bacterial infection. In certain embodiments, the composition used for treating a bacterial infection targets at least one mRNA sequence that encodes a protein essential for bacterial homeostasis. In certain embodiments, the composition does not comprise a conventional antibiotic, while in other embodiments, the composition does comprise at least one conventional antibiotic. In yet other embodiments, a composition comprising at least one PNA capable of affecting translation of at least one drug resistance-associated enzyme or protein is administered to the subject first, followed by administration of an antibiotic. In preferred embodiments, the subject is human. In some embodiments, a PNA may be delivered through a T3SS of a bacterium, such as a probiotic, and may further be used in conjunction with the administration of an antibiotic.
[0096] Examples of suitable probiotic microorganisms include yeasts such as Saccharomyces, Debaromyces, Candida, Pichia and Torulopsis, molds such as Aspergillus, Rhizopus, Mucor, and Penicillium and Torulopsis and bacteria such as the genera Bifidobacterium, Bacteroides, Clostridium, Fusobacterium, Melissococcus, Propionibacterium, Streptococcus, Enterococcus, Lactococcus, Staphylococcus, Peptostrepococcus, Bacillus, Pediococcus, Micrococcus, Leuconostoc, Weissella, Aerococcus, Oenococcus and Lactobacillus. Specific examples of suitable probiotic microorganisms are: Saccharomyces cereviseae, Bacillus coagulans, Bacillus licheniformis, Bacillus subtilis, Bifidobacterium bifidum, Bifidobacterium infantis, Bifidobacterium longum, Enterococcus faecium, Enterococcus faecalis, Lactobacillus acidophilus, Lactobacillus alimentarius, Lactobacillus casei subsp. casei, Lactobacillus casei Shirota, Lactobacillus curvatus, Lactobacillus delbruckii subsp. lactis, Lactobacillus farciminus, Lactobacillus gasseri, Lactobacillus helveticus, Lactobacillus johnsonii, Lactobacillus reuteri, Lactobacillus rhamnosus (Lactobacillus GG), Lactobacillus sake, Lactococcus lactis, Micrococcus varians, Pediococcus acidilactici, Pediococcus pentosaceus, Pediococcus acidilactici, Pediococcus halophilus, Streptococcus faecalis, Streptococcus thermophilus, Staphylococcus carnosus, and Staphylococcus xylosus.
[0097] The formulation of therapeutic compositions and their subsequent administration (dosing) is believed to be within the skill of those in the art. Optimal dosing schedules can be calculated from measurements of drug accumulation in the body of a subject. Persons of ordinary skill can easily determine optimum dosages, dosing methodologies and repetition rates. Optimum dosages may vary depending on the relative potency of individual PNAs, and can generally be estimated based on EC.sub.50s found to be effective in in vitro and in vivo animal models. In general, dosage is from 0.01 g to 100 g per kg of body weight, and may be given once or more daily, weekly, or monthly. Persons of ordinary skill in the art can easily estimate repetition rates for dosing based on measured residence times and concentrations of the antisense antibiotic oligomers in bodily fluids or tissues. Following successful treatment, it may be desirable to have the subject undergo maintenance therapy to prevent the recurrence of the disease state, wherein one or more PNAs is administered in maintenance doses, ranging from 0.01 g to 100 g per kg of body weight. In certain embodiments, a patient is treated with a dosage of one or more PNAs that is at least about 1, at least about 2, at least about 3, at least about 4, at least about 5, at least about 6, at least about 7, at least about 8, at least about 9, at least about 10, at least about 15, at least about 20, at least about 25, at least about 30, at least about 35, at least about 40, at least about 45, at least about 50, at least about 60, at least about 70, at least about 80, at least about 90, or at least about 100 mg/kg body weight.
[0098] As noted above, in one embodiment of the invention, the present inventors present a novel approach which takes advantage of an exemplary Type III secretion system (T3SS) to deliver PNAs (see generally results in
[0099] In one embodiment, one or more antisense PNAs, which may further be coupled with a CPP, may be introduced to a bacterium having a T3SS. In a preferred embodiment, one or more PNAs may be introduced and taken up by a bacterium having a T3SS which may subsequently be introduced to an infected cell or tissue. The PNAs may act according to its design and inhibit expression of one or more target genes, initiating a bacteriostatic or bactericidal effect. In a preferred embodiment, bacteria, having a T3SS may include bacteria that are a naturally occurring, or a probiotic or endosymbiont with the host that has a T3SS. As used herein, the term probiotic generally refers to bacteria that may colonize a target host for sufficient time to deliver one or more PNAs to said host. In this embodiment, a probiotic may be introduced to, and uptake, one or more PNAs which may then be administered to the host allowing intracellular transport and delivery to the targeted PNAs to the host cell. Administration of an antibiotic may also be coupled with the aforementioned treatment.
[0100] To address the issue of poor PNA transport properties, in certain embodiment the present inventors may repurpose a bacterial T3SS. As noted above, T3SS are molecular machines used by many Gram-negative bacterial pathogens including Shigella, Yersinia, Salmonella and Pseudomonas, to inject proteins, known as effectors, directly into eukaryotic host cells. These proteins manipulate host signal transduction pathways and cellular processes to the pathogen's advantage. Here, the present inventors may re-purpose the intrinsic T3SS in, for example, Shigella flexneri or Salmonella typhimurium for developing a delivery vehicle for the designed antisense molecules, such as antisense PNAs, which may further be coupled with a CPP. Using a probiotic may also allow the present inventors to switch PNA payload in a facile manner. One improvement of this platform is the ability to reduce the need for approval from regulatory bodies such as FDA for each antisense molecule, such as a PNA, used in the invention.
[0101] As noted above, the present inventors have demonstrated that Salmonella (which express T3SS) pretreated with PNAs is capable of carrying the PNA into epithelial HeLa and macrophage cell. As such, in certain embodiments, the invention includes a system in which the T3SS functions will be introduced in a non-pathogenic strain of bacteria, such as E. coli Nissle 1917, a probiotic strain that is easily culturable and has been tested in humans for treatment of irritable bowel syndrome. E. coli Nissle 1917 encoding the T3SS may be incubated with PNA-(KFF).sub.3K molecules for 3-6 hours to ensure entry of PNA molecules into cells. Due to lack of proteases or nucleases that are known to degrade PNAs, once imported into E. coli the PNA-CPP may be stable inside the cell. The amount of PNA-(KFF).sub.3K uptake may be quantified by measuring fluorescence of a FITC labeled PNA molecule (FITC-(KFF).sub.3K-PNA).
[0102] In a preferred embodiment, the present inventors may adopt the T3SS from the pathogen Shigella flexneri and modify the system to generate a protein delivery system composed of three modules: (1) the 31 kb long minimal DNA sequence that encodes delivery apparatus of a functional T3SS from S. flexneri, and (2) the transcriptional activator VirB to induce expression of the T3SS, and (iii) a kill switch circuit under the control of the Ipac promoter. Ipac is the native Shigella T3SS encoded translocator protein that gets activated once Shigella invades a mammalian cell to activate cell lysis once E. coli enters mammalian cells.
[0103] In one embodiment, the present inventors may adopt such a kill switch design based on the expression of holin and antiholin (Biobricks part Ba_K112808) system. Holin is a protein that forms pores in cell membranes. Anti-holin forms a dimer with holin, which is inactive. The Ipac controlled expression of Holin will activate pore formation once the T3SS encoding E. coli Nissle 1917 has successfully infected a mammalian cell. Once pores are formed by holin, lysozyme is expected to access the periplasmic space and degrade the cell wall, causing cell lysis and likely release of PNA-CPP molecules, which will eventually target the infecting pathogen. Using the probiotic strategy PNAs will no longer be in the blood stream, therefore the present inventors may eliminate the issue of low bioavailability, as well as, transport into unintended host cells will be prevented, thereby addressing the toxicity issue. An alternative embodiment would be to use the T3SS from Salmonella or broad-host Type IV secretion system such as that encoded by the RK2 plasmid system to deliver PNA or other antisense molecules.
[0104] The terminology used herein is for describing embodiments and is not intended to be limiting. As used herein, the singular forms a, and and the include plural referents, unless the content and context clearly dictate otherwise. Thus, for example, a reference to a target gene may include a combination of two or more such target genes. Unless defined otherwise, all scientific and technical terms are to be understood as having the same meaning as commonly used in the art to which they pertain.
[0105] The present invention includes all compositions and methods relying on correlations between the reported PNAs and the bacterial effects host. Such methods include methods for determining whether a patient is predicted to respond to administration of PNA and/or antibiotic therapy, as well as methods for assessing the efficacy of PNA and/or antibiotic therapy, therapy. Such diagnostic information may be used to more effectively treat or kill, for example, MDR bacteria, while reducing or ameliorating further drug resistance. This diagnostic activity may be done in vivo, or ex vivo.
[0106] Further included are methods for improving the efficacy of a therapy for bacterial infection by administering to a subject a therapeutically effective amount of an agent that alters the activity or expression of a target gene in a pathogenic bacteria. In this context, the term effective is to be understood broadly to include reducing or alleviating the signs or symptoms of a bacterial infection, improving the clinical course of a bacterial infection, enhancing killing of bacteria, or reducing any other objective or subjective indicia of a bacterial infection. Different drugs, doses and delivery routes can be evaluated by performing the method using different drug administration conditions. The markers may also be used as pharmaceutical compositions or in kits.
[0107] The present invention includes all compositions and methods relying on correlations between the reported PNAs and the antibiotic sensitivity of a bacteria. Such methods include methods for determining whether a patient is predicted to respond to administration of PNA, or PNA+antibiotic therapy, as well as methods for assessing the efficacy of such therapies generally. In one embodiment, the action, whether alone or synergistically with another antibiotic, or select PNAs may be measured and/or characterized such that it may be a predictor of clinical outcome in patients prior to receiving antibiotic therapy, or patients that have severe infection possibly resulting in resistance to traditional antibiotics. Further included, are methods for improving the efficacy of an antibiotic therapy by administering to a subject a therapeutically effective amount of a PNA that alters the activity or expression of one or more target genes and/or that works synergistically to improve the bacteriostatic or bactericidal effects of an antibiotic.
[0108] Further included are methods for improving the efficacy of a cancer therapy by administering to a subject a therapeutically effective amount of one or more PNAs, or a carrier bacteria expressing a PNA, such a probiotic and the like. In this context, the term effective or effective amount or therapeutically effective amount is to be understood broadly to include reducing a bacterial population through a bactericidal or bacteria static mechanisms, improving the clinical course of the disease, or reducing any other objective or subjective indicia of the disease, or inducing an observable effect. Different doses and delivery routes can be evaluated by performing the method using different administration conditions. Toxicity and therapeutic efficacy of such compositions can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD.sub.50 (the dose lethal to 50% of the population) and the ED.sub.50 (the dose therapeutically effective in 50% of the population). The dose ratio between toxic and therapeutic effects is the therapeutic index, and it can be expressed as the ratio LD.sub.50/ED.sub.50. Compounds that exhibit large therapeutic indices are preferred. The data obtained from these cell culture assays and additional animal studies can be used in formulating a range of dosage for human use. The dosage of such compounds lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity. The dosage varies within this range depending upon the dosage form employed, sensitivity of the patient, and the route of administration.
[0109] As used herein, antisense oligomers or antisense oligonucleotide means any antisense molecule that may modulate the expression of one or more genes. Examples may include antisense PNAs, antisense RNA. This terms also encompasses RNA or DNA oligomers such as interfering RNA molecules, such as dsRNA, dsDNA, mRNA, siRNA, or hpRNA as well as locked nucleic acids, BNA, polypeptides and other oligomers and the like.
[0110] The term PNA peptide nucleic acid, as used herein, refers to a DNA mimic with a neutral polyamide backbone on which the nucleic acid bases are attached in the same manner as they are to the phosphate backbone of DNA. PNAs can be synthesized routinely by standard peptide chemistry and can be labeled with biotin or various other labels as either part of the solid phase synthesis, or following cleavage from the resin. See, e.g., Chollet et al., Nucleic Acids Research, Vol. 13, No. 5, pp. 1529-1541 (1985).
[0111] As used herein, the term gene or polynucleotide refers to a single nucleotide or a polymer of nucleic acid residues of any length. The polynucleotide may contain deoxyribonucleotides, ribonucleotides, and/or their analogs and may be double-stranded or single stranded. A polynucleotide can comprise modified nucleic acids (e.g., methylated), nucleic acid analogs or non-naturally occurring nucleic acids and can be interrupted by non-nucleic acid residues. For example, a polynucleotide includes a gene, a gene fragment, cDNA, isolated DNA, mRNA, tRNA, rRNA, isolated RNA of any sequence, recombinant polynucleotides, primers, probes, plasmids, and vectors. Included within the definition are nucleic acid polymers that have been modified, whether naturally or by intervention.
[0112] The term target sequence, may mean a nucleotide sequence, such as a DNA sequence, or a mRNA sequence, that may be complementary to an antisense molecules, and preferably an antisense peptide nucleic acid.
[0113] The term including is used herein to mean, and is used interchangeably with, the phrase including but not limited to. The term or is used herein to mean, and is used interchangeably with, the term and/or, unless context clearly indicates otherwise.
[0114] The term homologous or sequence identity as used herein means a nucleic acid (or fragment thereof), including morpholino nucleic acids, or a protein (or a fragment thereof) having a degree of homology to the corresponding natural reference nucleic acid or protein that may be in excess of 70%, or in excess of 80%, or in excess of 85%, or in excess of 90%, or in excess of 91%, or in excess of 92%, or in excess of 93%, or in excess of 94%, or in excess of 95%, or in excess of 96%, or in excess of 97%, or in excess of 98%, or in excess of 99%). For example, in regard to peptides or polypeptides, the percentage of homology or identity as described herein is typically calculated as the percentage of amino acid residues found in the smaller of the two sequences which align with identical amino acid residues in the sequence being compared, when four gaps in a length of 100 amino acids may be introduced to assist in that alignment (as set forth by Dayhoff, in Atlas of Protein Sequence and Structure, Vol. 5, p. 124, National Biochemical Research Foundation, Washington, D.C. (1972)). In one embodiment, the percentage of homology as described above is calculated as the percentage of the components found in the smaller of the two sequences that may also be found in the larger of the two sequences (with the introduction of gaps), with a component being defined as a sequence of four contiguous amino acids. Also included as substantially homologous is any protein product which may be isolated by virtue of cross reactivity with antibodies to the native protein product. Sequence identity or homology can be determined by comparing the sequences when aligned so as to maximize overlap and identity while minimizing sequence gaps. In particular, sequence identity may be determined using any of a number of mathematical algorithms. A non-limiting example of a mathematical algorithm used for comparison of two sequences is the algorithm of Karlin & Altschul, Proc. Natl. Acad. Sci. USA 1990, 87, 2264-2268, modified as in Karlin & Altschul, Proc. Natl. Acad. Sci. USA 1993, 90, 5873-5877.
[0115] In another embodiment, the invention includes PNAs that have substantial sequence similarity to the PNAs described herein. Two PNAs have substantial sequence identity when there is at least about 70% sequence identity, at least about 80% sequence identity, at least about 90% sequence identity, at least about 95% sequence identity or at least 99% sequence identity. Reference to one PNA refers explicitly to a homolog having substantial sequence similarity.
[0116] In yet another embodiment, the PNA comprises at least one modified phosphate backbone selected from the group consisting of a phosphorothioate, a phosphorodithioate, a phosphoramidothioate, a phosphoramidate, a phosphordiamidate, a methylphosphonate, an alkyl phosphotriester, and a formacetal or analog thereof.
[0117] Optionally, the therapeutic methods of the present invention may be combined with other antibiotic therapies. For example, when two or more different treatments are combined, the treatments may work synergistically and allow reduction of dosage of each of the treatments, thereby reducing the detrimental side effects exerted by each compound at higher dosages. As such, in certain embodiments, the use of PNAs in conjunction with antibiotics may allow a reduction in the dosage of said antibiotic. This embodiment not only saves time and money, but also reduces the emergence of bacterial antibiotic resistance.
[0118] As used herein, the term endogenous refers to any material from or produced inside an organism, cell, tissue or system.
[0119] As used herein, the term exogenous refers to any material introduced from or produced outside an organism, cell, tissue or system.
[0120] As used herein, the terms inhibit and inhibition means to reduce a molecule, a reaction, an interaction, a gene, an mRNA, and/or a protein's expression, stability, function or activity by a measurable amount, or to prevent such entirely. Inhibitors are compounds that, e.g., bind to, partially or totally block stimulation, decrease, prevent, delay activation, inactivate, desensitize, or down regulate a protein, a gene, and an mRNA stability, expression, function and activity, e.g., antagonists.
[0121] As used herein, the terms complementary or complement also refer to a nucleic acid comprising a sequence of consecutive nucleobases or semiconsecutive nucleobases (e.g., one or more nucleobase moieties are not present in the molecule) capable of hybridizing to another nucleic acid strand or duplex even if less than all the nucleobases do not base pair with a counterpart nucleobase. In certain embodiments, a complementary nucleic acid comprises a sequence in which about 70%, about 71%, about 72%, about 73%, about 74%, about 75%, about 76%, about 77%, about 78%, about 79%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%), about 98%), about 99%, or about 100%, and any range derivable therein, of the nucleobase sequence is capable of base-pairing with a single or double stranded nucleic acid molecule during hybridization. In certain embodiments, the term complementary refers to a nucleic acid that may hybridize to another nucleic acid strand or duplex in stringent conditions, as would be understood by one of ordinary skill in the art.
[0122] The invention now being generally described will be more readily understood by reference to the following examples, which are included merely for the purposes of illustration of certain aspects of the embodiments of the present invention. The examples are not intended to limit the invention, as one of skill in the art would recognize from the above teachings and the following examples that other techniques and methods can satisfy the claims and can be employed without departing from the scope of the claimed invention. Indeed, while this invention has been particularly shown and described with references to preferred embodiments thereof, it will be understood by those skilled in the art that various changes in form and details may be made therein without departing from the scope of the invention encompassed by the appended claims.
EXAMPLES
Example 1: Rational Design of PNAs Across Multiple Pathogens Against Non-Traditional Antibiotic Pathways and Novel Genes to Inhibit Multi-Drug Resistant Bacteria
[0123] The present inventors developed a bioinformatics toolbox to design gene-specific antisense-PNA RNA-inhibitors against five clinical isolates of Enterobacteriaceae, including carbapenem-resistant E. coli and extended spectrum -lactamase-producing K. pneumoniae. Our toolbox uses predictive homology to design PNAs against a total of 303 well-characterized essential genes in E. coli as identified in the Database of Essential Genes. Unique 12-mer PNAs were designed to complement the start codon (AUG) of essential genes of interest in the middle of the oligomer, with 4-5 nucleotides flanking the start codon. These were refined to 260 candidates that did not show any potential off-targets at the start codon (STC) of an untargeted gene in E. coli MG1655 (
[0124] The present inventors sampled five PNA molecules, a small fraction of the design space of 71 PNA candidates, with significant therapeutic success (>50%) in comparison to current small molecule screening which achieves about <0.0001% success. These PNA molecules target non-traditional pathways including H2-folate synthetase (folC) in folate biosynthesis, the signal recognition particle protein gene (ffh) which is essential for protein translocation, and the gene for SOS response repressor protein (lexA) (
[0125] The present inventors analyzed the PNAs for off-targets within the start codon region of genes in S. enterica and K. pneumoniae when allowing for zero and single base pair mismatches. All PNAs had no zero basepair mismatch off-targets except for -rpsD which showed one off-target in Salmonella (
Example 2: Antisense Antibiotics Inhibit Growth of Clinical Isolates
[0126] The PNAs were used to treat five randomly selected highly-resistant clinical isolates of Enterobacteriaceae including a carbapenem-resistant Enterobacteriaceae (CRE) E. coli, a multidrug-resistant (MDR) E. coli, an extended spectrum -lactamase (ESBL)-producing K. pneumoniae (KPN), a New Delhi Metallo -lactamase 1 (NDM-1) KPN, and an isolate of MDR S. enterica which was shown to be serovar typhimurium (STm). Phenotypic antibiotic resistance characterization of the clinical isolates was performed to determine sensitive (S), intermediate (I), and resistant (R) phenotypes using the 2016-2017 Clinical & Laboratory Standards Institute (CLSI) sensitive/resistant breakpoint values (Table 4). The present inventors screened nine antibiotics of varied mechanisms and classes including penicillins (ampicillin), cephalosporins (ceftriaxone), carbapenems (meropenem), aminoglycosides (gentamicin and kanamycin), tetracyclines (tetracycline), fluoroquinolones (ciprofloxacin), quinolones (nalidixic acid), and phenicols (chloramphenicol) (
[0127] In addition to antibiotic screening, the clinical isolates' genotypic resistance profile was screened using genome sequencing (
[0128] Despite significant resistance to traditional antibiotics, strong growth inhibition of clinical isolates was observed with PNA treatment (
[0129] The present inventors next sought to further understand why certain PNA therapies were more effective than others through analysis of mRNA concentration, mRNA secondary structure, and protein interaction networks. Surprisingly, the most effective PNAs targeted RNAs with the highest intracellular mRNA concentration, producing a strong exponential decay relationship between the PNA efficacy and RNA levels (R.sup.2=0.86) (
Example 3: Antisense-PNA Acts as a Potentiator and Adjuvant with Small-Molecule Traditional Antibiotics in MDR Bacteria
[0130] Given the highly resistant phenotype of our clinical isolates and the need for a variety of antimicrobial treatment options, the present inventors next tested the ability of our PNAs to work as potentiators or adjuvants in combination with small-molecule antibiotics. A fraction of the PNAs that were either not effective or partially effective against the clinical isolates at 10 M were combined with antibiotic concentrations below the minimum inhibitory concentration (MIC) for the isolate. Using the Bliss-Independence model we evaluated the effect of combination (Equation 1), where an S-value>0 indicates synergy. Treatment of CRE E. coli with -gyrB, which showed a partial therapeutic effect at 10 M, in combination with antibiotics chloramphenicol (8 g/mL,
[0131] This result is striking given that this isolate possessed specific resistance genes for chloramphenicol (PheCml45) and gentamicin (AadB) (
[0132] The present inventors also evaluated antibiotic potentiation in ESBL KPN using three different PNAs that showed no or minimal growth inhibition as monotherapy at 10 M: -ffh, -lexA, and -gyrB. These PNAs showed a strong adjuvant activity using 2 g/mL tetracycline, which is below the CLSI sensitive breakpoint, even though the clinical isolate was capable of surviving at 32 g/mL tetracycline (
[0133] The present inventors next investigated a case where the PNA exhibited partial monotherapy effect, but the clinical isolate (NDM-1 KPN) was resistant to the last resort antibiotic meropenem (
Example 4: Using Bacterial Type III Secretion System (T3SS) to Enhance PNA Transport
[0134] Despite the tremendous potential of PNAs as both mono- and co-therapies, one of the main challenges limiting their application is their poor uptake by living cells. Since PNA is a hydrophobic molecule it does not transport easily across cell membranes. A number of cellular delivery approaches have been developed including electroporation, co-transfection with DNA, and conjugation to cell-penetrating peptides (CPPs) or nanoparticles. The inventive technology disclosed herein includes a novel approach which takes advantage of the bacterial Type III secretion system (T3SS) to deliver PNAs. The T3SS is a molecular machine used by many gram-negative bacterial pathogens including Salmonella, Shigella, Yersinia, and Pseudomonas, to inject proteins, known as effectors, directly into eukaryotic host cells initiating engulfment and intracellular uptake of bacteria within host cells.
[0135] The present inventors utilized the intrinsic T3SS encoded by Salmonella as a delivery vehicle for the designed PNAs (
[0136] For all cases, HeLa cells were infected at time t=0 with SL1344 for 45 minutes with a multiplicity of infection (MOI) of bacteria to HeLa cells of approximately 10:1. For the T3SS-PNA treatment method HeLa cells were co-incubated with SL1344 and either -rpsD or -lexA for 45 minutes, allowing the PNA to enter the Salmonella while simultaneously transporting the PNA-carrying Salmonella into the HeLa cells using the T3SS. This 45 minute co-incubation was not long enough for the PNA to decrease bacterial viability (
Example 5: Using T3SS and Cell Lysis Switch to Eliminate a Secondary Intracellular Infection
[0137] While the T3SS, unaltered, can be used to transport PNA into mammalian cells, infection by Salmonella can lead to the death of the host cell as well as systemic infection; however by combining the T3SS with a lysis switch to release the PNA from the Salmonella, we can transform the T3SS into a therapeutic delivery tool. Here the present inventors implemented a novel method of PNA delivery and release to treat a secondary infection, using the T3SS and the naturally programmed cell lysis of the holin-endolysin system. The holin-endolysin system is part of the phage lysis cassette which consists of holin, antiholin, and endolysin. Holin functions by accumulating in the inner membrane of the bacteria until a concentration-dependent step causes the proteins to associate and form holes along the inner membrane. The present inventors posited that the T3SS in Salmonella would carry the PNA into infected mammalian cells and the programmed cell lysis will release the intracellular PNA to the target infection for treatment.
[0138] To that end, the present inventors built a delivery strain of Salmonella by expressing the holin lysis cassette, encoding a holin-antiholin according to SEQ ID NO. 34, under control of an inducible laciQ promoter (referred to as SL1344-Holin,
FIG. 6: Materials and Methods.
[0139] Single basepair mismatch off-targets: -rpsD in S. enterica showed homology with the start site of rtcA (Table 2) when allowing for zero basepair mismatches. The rtcA gene codes for RNA 3-terminal phosphate cyclase and plays a role in end healing within an RNA repair pathway. When allowing for a 1-bp mismatch on the start codon for all the PNAs, the present inventors found no off-targets for -lexA and -gyrB, whereas -ffh, -folC, -rpsD showed 2, 3, 5 off-targets respectively (
[0140] Antibiotic resistant genome screening of clinical isolates: CRE E. coli was found to have five -lactam resistance genes, two aminoglycoside resistance genes, and one gene each for phenicol, tetracycline, sulfonamide, and trimethoprim resistance. NDM-1 KPN was found to have seven -lactam resistance genes, three genes each for fluoroquinolone and aminoglycoside resistance and one gene each for tetracycline, sulfonamide, and trimethoprim resistance.
[0141] Predicted RNA Folding of PNA targets: The folding of each PNA target theoretical sequence was analyzed using the RNAfold Web. The PNA target regions of ffh (
[0142] Connected cellular pathways and protein network interactions affected by knockdown PNA targets: Based on protein network interactions predictions from the STRING Database (
[0143] Cellular pathway interactions based on PNA target knockdowns (
[0144] Bioinformatics toolbox for PNA design: Essential genes were identified using the Keio collection entry in the Database of Essential Genes (DEG), which was then used to extract the nucleic acid sequences from the corresponding genome downloaded from the RefSeq database. PNA sequences were extracted using the DEG gene names and a custom Python script as the reverse complements of 12-mer nucleotide sequences centered on the mRNA AUG start codons (STC) for genes of interest. These sequences were screened for off-target alignments within the E. coli genome from which the PNA sequences originated and for homology within the KPN and STm genomes using the Bowtie short-read alignment tool (alignment settings: -v 0-1 12 -a), allowing for no basepair mismatches or gaps within the sequence alignment. The Bedtools intersect function was used to identify alignments that overlapped with genome features, and a custom Python script was used to parse this data and calculate the alignments' proximities to gene STCs. Off-target or homology inhibition was defined as a sequence alignment overlapping the STC of a gene that the PNA was not specifically designed to inhibit. Thermodynamic considerations for PNA sequences were screened for using a custom Python script designed to search for potential solubility and self-interference issues. The former was addressed by looking for purine stretches greater than 5 bases, a purine content of greater than 50%, or a guanine-peptide content of greater than 35%. The latter was addressed by looking for self-complementary sequences of greater than 5 bases. PNA target pathways were identified using EcoCyc and Regulon Database.
[0145] PNA synthesis: PNAs were ordered from PNA Bio Inc. (Newbury Park, Calif.) conjugated to cell penetrating peptide KFFKFFKFFK (SEQ ID NO. 18). PNA was re-suspended in H.sub.2O with 5% DMSO at 100 M. Stocks were stored at 20 C. for long-term and at 4 C. for working stocks to minimize freeze/thaw cycles. PNA used for toxicity studies (
[0146] Bacterial Cell culture: The clinical isolates were obtained from the lab of Nancy Madinger at the University of Colorado Anschutz campus. Clinical isolates were grown in Cation Adjusted Mueller Hinton broth (CAMHB) (Becton, Dickinson and Company 212322) at 37 C. with 225 rpm shaking or on solid CAMHB with 1.5% agar at 37 C. Clinical isolates were maintained as freezer stocks in 90% CAMHB, 10% glycerol at 80 C. Freezer stocks were streaked out onto solid CAMHB and incubated for 16 h to produce single colonies prior to experiments. For each biological replicate, a single colony was picked from solid media and grown for 16 h in liquid CAMHB prior to experiments. Non-clinical isolates, such as E. coli MG1655 (ATCC700926) and Salmonella entorica serovar typhimurium SL1344, were cultured in liquid 2% lysogeny broth (LB) or on 2% LB with 1.5% agar for solid plates. S. typhimurium cultures were supplemented with 30 g/mL streptomycin and SL1344 strains containing plasmids pFPV (SL1344-mCherry) or pRG1 modified with a lacIq promoter (SL1344-Holin) were supplemented with 100 g/mL ampicillin. Freezer stocks were stored in 60% LB broth, 40% glycerol at 80 C. Freezer stocks were streaked out onto solid LB and incubated for 16 h to produce single colonies before experiments. For biological replicates, single colonies were started in liquid LB and grown for 16 hours prior to experiments. E. coli MG1655 PNA growth experiments were carried out in M9 media (1M9 minimal media salts solution (MP Biomedicals), 2.0 mM MgSO.sub.4, and 0.1 mM CaCl.sub.2 in sterile water) with 0.4% glucose.
[0147] Antibiotic resistance screening: Sensitive/resistant breakpoints were taken from the 2016-2017 Clinical & Laboratory Standards Institute report (Table 4). Liquid cultures of the clinical strains were diluted to a 0.5 McFarland standard and added to the respective antibiotic test condition. The antibiotic minimum inhibitory concentration (MIC) for each clinical isolate was determined as the lowest antibiotic concentration which prevented visible cell growth for 24 h. Strains were: sensitive if the MIC was equal to or below the sensitive-breakpoint concentration, resistant if the MIC was greater than or equal to the resistant-breakpoint concentration, and intermediate if the MIC was in-between.
[0148] Genome sequencing library prep and data analysis: Liquid cultures were inoculated from individual colonies off of solid cation-adjusted Mueller-Hinton broth (CAMHB) for each clinical isolate. Cultures were grown for 16 h as described above and then 1 mL of culture was used to isolate DNA using the Wizard DNA Purification Kit (Promega). A Nanodrop 2000 (Thermo Scientific) was used to measure DNA concentration and purity. For library preparation, >2 g of DNA was submitted in 50-100 L samples. The libraries were prepared for sequencing using Nextera XT DNA Library Preparation Kit (Illumina), and the sequencing was run with a 2250 bp MiSeq run (Illumina).
[0149] Sequencing reads were first trimmed using TRIMMOMATIC v0.32 for length and quality with a sliding window. For further analysis, the trimmed files, of only paired sequences, were transferred to Illumina BaseSpace (http://basespace.illumina.com). We assessed the sequencing quality using FASTQC v1.0.0 and performed de novo genome assembly with SPAdes Genome Assembler v3.6.0. The assembly was further corrected and improved using Rescaf v 1.0.1, and then we performed annotation using PROKKA v1.0.0. Antibiotic resistance genes were identified and characterized using SEAR and ARG-ANNOT pipelines. Integrated Genomics Viewer was used for data visualization.
[0150] Homology analysis for PNA in clinical isolates: Clinical isolate genome assemblies with annotation were loaded as contigs into UGENE v1.26.0. In each clinical isolate genome, we searched for each of the five 12-mer target sequences that were selected for the gene-targets. If a target sequence was found to match the start site of the same targeted gene in the clinical isolate we recorded the target as having homology in that genome.
[0151] PNA growth assay: Biological replicates were diluted 1:10,000 into treatment condition in 384-well plates and measured for 24 h in a Tecan GENios at 562 nm with a bandwidth of 35 nm. Media absorbance blanks were subtracted from data prior to analysis. Normalized optical density (OD) data is shown normalized to the time point where the no treatment growth curves reached saturation phase which varied across biological replicates.
[0152] Potentiation of antibiotics with PNAs: Combination growth curve experiments were performed following the same procedure as the PNA growth assay mentioned above, except for the addition of antibiotics tetracycline (2 g/mL), gentamicin (4 g/mL), chloramphenicol (8 g/mL), and meropenem (8 g/mL) where appropriate. Combinatorial effects were evaluated using the Bliss Independence model where the S parameter defines a deviation from no interaction as is defined as:
[0153] Where OD.sub.AB is the OD at saturation time in only antibiotic, OD.sub.0 is the OD at saturation in no treatment, OD.sub.PNA is the OD at saturation in only antisense-PNA at 10 M, and OD.sub.AB, P.sub.NA is the OD at saturation in a combination of antibiotic and antisense-PNA. Saturation time was determined as the time when the no treatment control reached its saturation growth phase. S>0 is a deviation towards synergy and S<0 is a deviation towards antagonism.
[0154] HeLa Cell Culture: HeLa cells were stored as freezer stocks in 10% dimethyl sulfoxide (DMSO, Sigma) plus fully media: Dulbecco's Modified Eagle Medium (DMEM, Fisher Scientific), 10% Fetal Bovine Serum (FBS, Advanced, Atlanta Biologics), and 50 units/mL Penicillin-Streptomycin (P/S; Fisher Scientific). For biological replicates a single freezer stock, passage two, was split into three different culture flasks and each flask continuously passaged as individual biological replicates in full media. Cells were cultured at 37 C., 5% CO.sub.2, and controlled humidity. Cells were passaged at 80% confluency with 0.25% trypsin (HyClone). HeLa cells were seeded in 96 well tissue culture treated plates (Fisher Scientific) at 45,000 cells/mL respectively in 100 L per well 24 hours prior to infection.
[0155] Salmonella infection of HeLa cells and PNA treatment: For a single infection (
[0156] At 18 h post-infection, wells for CFU analysis were washed thrice with 300 L DPBS and lysed with 30 L of 0.1% Triton X-100 for 15 minutes at room temperature. After 15 min, 270 L of PBS was added to each well then serially diluted and plated on sold LB media supplemented with 40 g/mL streptomycin. Plates were incubated for 16 hours at 37 C. and CFU per milliliter determined. Wells for staining and imaging were fixed with 4% methanol-free paraformaldehyde at room temperature for 20 minutes. Staining for nuclei was performed using 100 L per well of 2.5 g/mL DAPI (Santa Cruz Biotechnology) for 5 minutes at room temperature then washed thrice with DPBS before staining with 100 L of 0.165 M Alexa Fluor 647 Phalloidin (Thermo Fisher) supplemented with 0.25% Triton X-100 for 20 minutes at room temperature. Cells were rinsed with DPBS and stored in 65% glycerol at 4 C. Images were acquired using an EVOS FL microscope and analyzed using ImageJ.
[0157] Double infection of HeLa cells and PNA treatment: For the double infection of HeLa cells with SL1344-mCherry and SL1344-Holin (
[0158] Effect of PNA after 45 min of incubation during HeLa infection: SL1344 were cultured as described above and split 1:10 and regrown for 4 hours. Samples were rinsed with PBS and diluted to a concentration equivalent to an MOI of 30 for a 24 hour grown culture of HeLa cells in 100 L. PNA (100 mM) was added at 5 L to 45 L of bacteria and incubated for 45 minutes at culturing conditions. Samples (10 L) were taken at t=0 (before PNA addition) and t=45 min (after PNA treatment), and serially diluted, plated, and grown for 16 hours at 37 C. and CFU counted.
[0159] Error and Significance Analysis: Error bars represent one standard deviation from the mean of biological replicates. In all cases, significance designated with an asterisk (*) is defined as p<0.05 using a Student's t test.
[0160] PNA Synthesis: Synthesis of the PNA molecules was carried out in solid-phase on Fmoc-MBHA resin (0.22 mmol/g loading) at a 0.02 millimolar scale. Fmoc deprotection steps were performed using piperidine and coupling was performed using HATU as an activator. Post-coupling acetylation was carried out with a 5%/6% v/v solution of acetic anhydride and 2,6-lutidine, respectively, in DMF. Cleavage was performed for 2 hours using a 88%/2%/5%/5% v/v solution of TFA, TIPS, phenol, and water, respectively. The PNA molecule was precipitated in ethyl ether, centrifuged, and the purified using high pressure liquid chromatography.
[0161] Gel Shift Mobility Assay: Synthetic DNA oligonucleotides that are 57-60 nucleotides in length were incubated with their respective PNA binding site at 37 C. overnight. The concentration of the DNA fragments was held at 500 nM, while the PNA was always in excess at 1 M. The reactions were performed in 1TE with 20 mM KCl (pH 7.0). The formation of PNA-ssDNA complexes was observed on a 20% polyacrylamide nondenaturing gel using 1TBE running buffer. 1SYBR-Gold was used to stain and visualize the DNA using about 50 mL to coat the gel in low-light conditions for 20 minutes. The gel was directly put on a UV sample tray and imaged using the Gel Doc EZ Imaging system from Bio-Rad.
[0162] Plasmid and strain construction: The SL1344-Holin strain contains a modified pRG1 plasmid that is IPTG inducible. The original pRG1 plasmid expresses the SRRz genes of the lysis cassette..sup.8 The lacIq gene was inserted in between the SalI and BamHI cut sites. The lacIq gene was extracted from the E. coli strain DH5z1 by colony PCR with Phusion High-Fidelity DNA Polymerase (New England Biolabs) and with the following primers: forward primer (5-AAAGGATCCCATCACTGCCCGCTTTCCAGTCG-3) and reverse primer (5-AAAGTCGACCCGACACCATCGAATGGTGCAAAACCTTTCG-3). The PCR products were subsequently gel-purified (Zymoclean Gel DNA Recovery Kit, Zymo Research Corporation), digested sequentially with BamHI and SaII (FastDigest Enzymes, Thermo Scientific) as per provided protocols, and PCR-purified (GeneJET PCR Purification Kit, Thermo Scientific) between and after digestion. The pRG1 backbone was also digested with BamHI and SaII and gel purified, and T4 DNA Ligase (Thermo Scientific) was used to ligate the pRG1 backbone and the extracted lacIq gene. Ligations were transformed into electrocompetent SL1344 cells and plasmid minipreps were performed using Zyppy Plasmid Miniprep Kit (Zymo Research). Confirmation was done by measuring the optical density with and without 1 mM IPTG (
[0163] Optical Density Growth Measurements of SL1344-Holin: Single colonies of each bacterial strain were picked and grown in LB supplemented with 30 g/mL Streptomycin and 100 g/mL Ampicillin. Overnight cultures were diluted 1:1,000 into 100 L of LB supplemented with 30 g/mL Streptomycin and 100 g/mL Ampicillin and 1 mM IPTG where appropriate in a 96-well plate. Cultures were grown at 37 C., with shaking, for 24 hours and OD.sub.600n measured every 30 minutes using a GENios plate reader (Tecan Group Ltd.) operating under Magellan software (version 7.2).
[0164] String Database Analysis: Gene names for each of the PNA-targeted RNA sequences were entered into the STRING database and searched in the organisms of Escherichia coli K12 MG1655, Klebsiella pneumoniae subspecies pneumoniae MGH 78578, and Salmonella enterica subspecies enterica serovar typhimurium strain LT2. The meaning of network edges was set to confidence, and all active interaction sources were used. The minimum interaction score was left at 0.400, while the max number of interactions was set to 250 for the 1.sup.st shell. Counts of nodes and clusters were taken from the analysis tab. Counts of significantly enriched KEGG.sup.9 pathway IDs were extracted from the analysis tab.
[0165] Quantitative real-time polymerase chain reaction: Individual colonies of E. coli MG1655 were grown 16 h in liquid and subsequently diluted 1:10,000 into liquid media. Cells were collected when they reached exponential phase; determined as OD 0.4-0.5. 200 L of culture was added to Bacteria RNAprotect (Qiagen) and pelleted following the manufacturer's instructions. Samples were flash frozen in an ethanol-dry ice bath and stored at 80 C. RNaseZap (Life Technologies) was used to protect extracted RNA from RNases. GeneJET RNA purification kit (Thermo Scientific) was used to extract RNA from frozen cell pellets followed by treatment with Turbo DNA-free kit (Ambion). 100 ng of cDNA was synthesized using Maxima Universal First Stand cDNA synthesis kit (Thermo Scientific). Primers for qPCR, listed in Table 7, were purchased from Integrated DNA Technologies. 1.5 ng of cDNA was used for 10 L qPCR reaction with Maxima SYBR Green qPCR master mix with ROX normalization (Thermo Scientific) using QuantStudio 6 flex system (Thermo Scientific). Transcript levels were analyzed following the Cq method concerning moderately expressed housekeeping gene cysG.
[0166] Osteoblast Precursor Cell Culture: MC3T3-E1 osteoblast precursor cells were stored in liquid nitrogen in growth media supplemented with %10 dimethyl sulfoxide (DMSO, Sigma). Osteoblasts were recovered from freezer stocks and cultured in growth media consisting of -Minimum Essential Media (-MEM, Gibco) supplemented with 10% Fetal Bovine Serum (FBS, Advanced, Atlanta Biologics), and 50 units/mL Penicillin-Streptomycin (P/S, Fisher Scientific) at 37 C., 5% CO.sub.2, and controlled humidity. For biological replicates a freezer stock, at passage 9, was split three ways and each replicate continuously passaged as individual biological replicates at 80% confluency using 0.25% trypsin (HyClone). For toxicity experiments osteoblasts, between passages 10 and 15, were seeded on to 96-well tissue culture treated plates (Fisher Scientific) at 100,000 cells/mL in 100 L 24 hours before infection or treatment.
[0167] Osteoblast Precursor Infection and Toxicity Measurement: Osteoblast cells were infected by replacing the growth media with Dulbecco's phosphate-buffered saline containing Salmonella at a concentration equivalent to a multiplicity of infection of 30 and incubated at growth conditions for 45 minutes. After infection media was replaced with growth media supplemented with 30 g/mL gentamicin instead of Penicillin-Streptomycin, incubated for 75 minutes, and replaced with fresh gentamicin containing media and treatment conditions (150 L per well). After 18 hours of treatment 90 L of supernatant was used to determine lactate dehydrogenase (LDH) release as a measure of cytotoxicity using the CytoSelect LDH Cytotoxicity Assay Kit. Percent toxicity is defined and measured as:
TABLES
[0168]
TABLE-US-00001 TABLE1 HomologybetweenmRNAandPNAofbacterialreference sequences.Antisense-PNAmoleculesorderedfromPNA BioInc.Thetargetsequenceisboldedandunderlined andthestartcodonisitalicized. Pathogens with Sequenceofthe PNA homology targetedmRNA(5to3) SEQIDNO. folC E.coli AGCGG TCAAACG SEQIDNO.1 rpsD E.coli TGGAGAA
GATATTT SEQIDNO.2 K.pneumoniae TGGAGAA
GATATTT SEQIDNO.3 S.enterica TGGAGAA
GATATTT SEQIDNO.4 S.enterica, AAAGGAT
GGATCAT SEQIDNO.5 rtcA ffh E.coli GGCGAGA
TAATTTA SEQIDNO.6 K.pneumoniae GGCGAGA
TAATTTA SEQIDNO.7 S.enterica GGCGAGA
TAATTTA SEQIDNO.8 lexA E.coli CAGGGGG
GTTAACG SEQIDNO.9 K.pneumoniae CAGGGGG
GTTAACG SEQIDNO.10 S.enterica CAGGGGG
GTTAACG SEQIDNO.11 gyrB E.coli GAGAAAC
TTCTTAT SEQIDNO.12 K.pneumoniae GAGAAAC
TTCTTAT SEQIDNO.13 S.enterica GAGAAAC
TTCTTAT SEQIDNO.14
TABLE-US-00002 TABLE 2 Predicted 0-bp mismatch off-targets of antisense-PNA molecules in each reference bacterial genome and clinical isolate. The label STC denotes gene off-targets for which the antisense-PNA aligns to the start codon, and which will therefore be much more likely to experience translational inhibition. Bacterial Reference Genome Results Salmonella enterica serovar Typhimurium PNA E. coli MG1655 K. pneumoniae MGH 78578 SL1344 -folC None KPN_04193 (putative 6-phosphofructokinase) None uxaC -rpsD cueO Non-protein coding region wcaM narI rtcA (STC) -ffh None None None -lexA None None None -gyrB Last 5 nt of psiE None None Clinical Isolates Results MDR E. CRE E. coli coli ESBL KPN NDM-1 KPN STm -folC Prokka 00542 None pfka1 pfkA1 None Prokka 03005 -rpsD cueO cueO frlD Non-protein Prokka03791 Non-protein coding region Prokka 03488 coding region rtcA (STC) -ffh uhpC uhpC yhes1 yheS2 None -lexA None None None None None -gyrB Non-protein None Non-protein None None coding region coding region Last 5 bp of yhbX
TABLE-US-00003 TABLE3 DNAoligonucleotidescontainingPNA-targetgene sequencethatwereutilizedforDNA-PNAcomplex formationinEMSA.SyntheticDNAoligonucleotides purchasedfromIDTthatare60ntinlength, containedthePNA-targetgenesequenceboldedand underlined.Thenonsenseoligonucleotidewasa randomized60ntsequencethathadnocomplementation foranyPNAbinding,thatservedasanon-binding control. Oligo/ Primer Target Purpose gene Oligo/PrimerSequence(5to3) SEQIDNO. Antisense rpsD ATTTAGGTGACACTATAGAAGTGG SEQIDNO.20 oligomer AGAAAG AGATATTTG for GGTCCTAAGCTC -rpsD Antisense lexA ATTTAGGTGACACTATAGAAGCAG SEQIDNO.21 oligomer GGGGCGGA
AAGCGTTAACGG for CCAGGCAACAAG -lexA Nonsense N/A GAATTCGAATTCGGTCAGTGCGTC SEQIDNO.22 oligomer CTGCTGATGTGCTCAGTATCTCTA TCACTGATAGGG
TABLE-US-00004 TABLE 4 CLSI sensitive/resistant breakpoints. CLSI breakpoints (g/mL) for 2016-2017 were used to determine antibiotic resistance of clinical isolates. Antibiotic Sensitive Intermediate Resistant Ampicillin (AMP) 8 16 32 Ceftriaxone (FRX) 1 2 4 Meropenem (MER) 1 2 4 Gentamicin (GEN) 4 8 16 Kanamycin (KAN) 16 32 64 Tetracycline (TET) 4 8 16 Ciprofloxacin (CIP) 1 2 4 (E. coli and K. pneumoniae) Ciprofloxacin 0.06 0.125 1 (Salmonella enterica) Nalidixic Acid (NXA) 6 N/A 32 Chloramphenicol (CHL) 8 16 32
TABLE-US-00005 TABLE 5 Unique antibiotic resistance genes identified in clinical isolates. Italicized label represents antibiotic class the gene confers resistance to where: Bla is for -lactam resistance, Flq is for fluoroquinolone resistance, AGly is for amino- glycoside resistance, Phe is for phenicol resistance, Tet is for tetracycline resistance, Sul is for sulfonamide resistance, and Tmt if for trimethoprim resistance. Non-italicized portion is the unique gene identified by ARG-ANNOT. CRE E. coli MDR E. coli ESBL KPN NDM-1 KPN STm Bla AmpC1 Bla AmpC2 Bla SHV-11 Bla TEM-217 AGly Bla AmpH Bla PBP Bla AmpH Bla NDM-1 Aac6-Iaa Bla AmpC2 Bla ampH Bla Oxa-9 Bla CTX-M Bla PBP Bla CMY-94 Bla TEM-219 Bla TEM-171 Bla SHV-73 Bla PBP Bla TEM-10 Bla TEM-220 Bla PBP AGly AadB Bla CTX-M Bla KPC-3 Bla AmpH AGly StrA/B AGly Sat-2A Bla PBP Bla PBP Phe PheCm145 Tmt DfrA1 Flq OqxBgb Flq QnrB1 Tet TetB Phe CatA1 AGly Flq Qnr-S1 Sul SulI AadA1-pm Flq OqxBgb Tmt Dfr24 AGly Aac6-Ib AGly StrB AGly RmtF AGly Ant3 Tet TetA/R Sul SulI Tmt DfrA1
TABLE-US-00006 TABLE 6 Genetic and phenotypic antibiotic resistance characterization. Red cells correspond to full resistance across an antibiotic class. Yellow is partial resistance to the class, and green is full sensitivity to the class. CRE E. MDR E. ESBL NDM-1 coli coli KPN KPN STm # of # of # of # of # of Antibiotic Resistance Resistance Resistance Resistance Resistance Type Genes Genes Genes Genes Genes -lactams 5 6 7 7 1 Amino- 2 1 2 3 1 glycosides Tetracyclines 1 0 0 1 0 Fluorquin- 0 0 1 3 0 olones Phenicols 1 1 0 0 0
TABLE-US-00007 TABLE7 RT-qPCRprimersusedforgeneexpressionanalysis. ThelengthofqPCRproductsarebetween160and200nt. ForwardPrimer ReversePrimer Product Gene (5.fwdarw.3) (5.fwdarw.3) Length SEQIDNO. gyrB CGGGTCCATAGTGGTTTCCC GTGAGAAACTGCGTGGCTTG 191 SEQIDNO.24,25 folC GCTCAAGCAGTTGTTCTGCC TCTCACCGGGCGTATGAAAG 176 SEQIDNO.26,27 ffh TTCCATACGCACCAGCACTT CGCGCAGGCAGAGAAATTAG 193 SEQIDNO.28,29 rpsD CAGCCAGGTTGGCTTTTCAC AGAAGCACGTCAGCTGGTTA 178 SEQIDNO.30,31 lexA GTTAACGGCCAGGCAACAAG TCAATAACGCCTTTGCGTGC 162 SEQIDNO.32,33
TABLE-US-00008 TABLE8 PNAsLibrarysequences. ATACCATGATTA -folC SEQIDNO.15 GACAATGTTTGA -ffh SEQIDNO.16 cGGAATGAAAGC -lexA SEQIDNO.17 GTTGATGTCGAA -gyrB SEQIDNO.18 AGAAAATGGCAA -rpsD SEQIDNO.19
REFERENCES
[0169] The following references are incorporated into the specification in their entirety: [0170] 1. United States Center for Disease Control. Antibiotic Resistance Threats. (2013). [0171] 2. Tacconelli, E. & Magrini, N. Global priority list of antibiotic-resistant bacteria to guide research, discovery, and development of new antibiotics. (2017). [0172] 3. Baba, T. et al. Construction of Escherichia coli K-12 in-frame, single-gene knockout mutants: the Keio collection. Mol. Syst. Biol. 2, 1-11 (2006). [0173] 4. Courtney, C. & Chatterjee, A. cis-Antisense RNA and Transcriptional Interference: Coupled Layers of Gene Regulation. J. Gene Ther. 2, 1-9 (2014). [0174] 5. Dryselius, R., Aswasti, S. K., Rajarao, G. K., Nielsen, P. E. & Good, L. The translation start codon region is sensitive to antisense PNA inhibition in Escherichia coli. Oligonucleotides 13, 427-33 (2003). [0175] 6. V. V. Demidov, V. N. Potaman, M. D. Frank-Kamenetskii, M. Egholm, O. Buchardt, S. H. Sonnichsen, P. E. N. Stability of peptide nucleic acids in human serum and cellular extracts. Biochem. Pharmacol. 48, 1310-1313 (1994). [0176] 7. Nielsen, P. E., Egholm, M., Berg, R. H. & Buchardt, O. Sequence-selective recognition of DNA by strand displacement with a thymine-substituted polyamide. Science 254, 1497-500 (1991). [0177] 8. Nielsen, P. E. & Haaima, G. Peptide nucleic acid (PNA). A DNA mimic with a pseudopeptide backbone. Chem. Soc. Rev. 26, 73 (1997). [0178] 9. Hyrup, B. & Nielsen, P. E. Peptide Nucleic Acids (PNA): Synthesis, Properties and Potential Applications. Bioorg. Med. Chem. 4, 5-23 (1996). [0179] 10. Courtney, C. M. & Chatterjee, A. Sequence-Specific Peptide Nucleic Acid-Based Antisense Inhibitors of TEM-1 -Lactamase and Mechanism of Adaptive Resistance. ACS Infect. Dis. 1, 253-263 (2015). [0180] 11. Good, L. & Nielsen, P. E. Inhibition of translation and bacterial growth by peptide nucleic acid targeted to ribosomal RNA. Proc. Natl. Acad. Sci. U.S.A 95, 2073-2076 (1998). [0181] 12. Mondhe, M., Chessher, A., Goh, S., Good, L. & Stach, J. E. M. Species-selective killing of bacteria by antimicrobial peptide-PNAs. PLoS One 9, e89082 (2014). [0182] 13. Bognar, A. L., Osborne, C., Shane, B., Singer, S. C. & Ferone, R. Folylpoly--glutamate synthetase-dihydrofolate synthetase. J. Biol. Chem. 260, 5625-5630 (1985). [0183] 14. Phillips, G. J. & Silhavy, T. J. The E. coli ffh gene is necessary for viability and efficient protein export. Nature 359, 744-746 (1992). [0184] 15. Little, J. W. & Mount, D. W. The SOS Regulatory System of Escherichia coli. Cell 29, 11-22 (1982). [0185] 16. Das, U. & Shuman, S. 2-Phosphate cyclase activity of RtcA: a potential rationale for the operon organization of RtcA with an RNA repair ligase RtcB in Escherichia coli and other bacterial taxa. Rna 19, 1355-1362 (2013). [0186] 17. Kils Jensen, K., rum, H., Nielsen, P. E. & Nordn, B. Kinetics for Hybridization of Peptide Nucleic Acids (PNA) with DNA and RNA Studied with the BIAcore Technique. [0187] 18. Hatamoto, M., Ohashi, A. & Imachi, H. Peptide nucleic acids (PNAs) antisense effect to bacterial growth and their application potentiality in biotechnology. Appl. Microbiol. Biotechnol. 86, 397-402 (2010). [0188] 19. Kurupati, P., Tan, K. S. W., Kumarasinghe, G. & Poh, C. L. Inhibition of gene expression and growth by antisense peptide nucleic acids in a multiresistant -lactamase-producing Klebsiella pneumoniae strain. Antimicrob. Agents Chemother. 51, 805-811 (2007). [0189] 20. Soofi, M. A. & Seleem, M. N. Targeting essential genes in Salmonella enterica serovar typhimurium with antisense peptide nucleic acid. Antimicrob. Agents Chemother. 56, 6407-6409 (2012). [0190] 21. Savard, P. & Perl, T. M. A call for action: managing the emergence of multidrug-resistant Enterobacteriaceae in the acute care settings. Curr. Opin. Infect. Dis. 25, 371-377 (2012). [0191] 22. CLSI M100 S27:2017-Performance Standards to Antimicrobial Susceptibility Testing; 27th Edition. 62-71 (2017). [0192] 23. Brdy, J. Thoughts and facts about antibiotics: Where we are now and where we are heading. J. Antibiot. (Tokyo). 65, 441-441 (2012). [0193] 24. Hegreness, M., Shoresh, N., Damian, D., Hartl, D. & Kishony, R. Accelerated evolution of resistance in multidrug environments. Proc. Nat. Acad. Sci. U.S.A 105, 13977-81 (2008). [0194] 25. Vazquez-Torres, A. et al. Extraintestinal dissemination of Salmonella by CD18-expressing phagocytes. Nature 401, 804-808 (1999). [0195] 26. O'Leary, N. A. et al. Reference sequence (RefSeq) database at NCB: current status, taxonomic expansion, and functional annotation. Nucleic Acids Res. 44, D733-45 (2016). [0196] 27. Langmead, B., Trapnell, C., Pop, M. & Salzberg, S. L. Ultrafast and memory-efficient alignment of short DNA sequences to the human genome. Genome Biol. 10, R25 (2009). [0197] 28. Quinlan, A. R. & Hall, I. M. BEDTools: a flexible suite of utilities for comparing genomic features. Bioinformatics 26, 841-2 (2010). [0198] 29. Zhou, K. et al. Novel reference genes for quantifying transcriptional responses of Escherichia coli to protein overexpression by quantitative PCR. BMC Mol. Biol. 12, 18-26 (2011). [0199] 30. Bolger, A. M. et al. Trimmomatic: A flexible trimmer for Illumina sequence data. Bioinformatics 30, 2114-2120 (2014). [0200] 31. Zerbino, D. R. & Birney, E. Velvet: algorithms for de novo short read assembly using de Bruijn graphs. Genome Res. 18, 821-829 (2008). [0201] 32. Bankevich, A. et al. SPAdes: a new genome assembly algorithm and its applications to single-cell sequencing. J. Comput. Biol. 19, 455-477 (2012). [0202] 33. Seemann, T. Prokka: rapid prokaryotic genome annotation. Bioinformatics 30, 2068-2069 (2014). [0203] 34. Rowe, W. et al. Search Engine for Antimicrobial Resistance: A Cloud Compatible Pipeline and Web Interface for Rapidly Detecting Antimicrobial Resistance Genes Directly from Sequence Data. PLoS One 10, e0133492 (2015). [0204] 35. Gupta, S. K. et al. ARG-annot, a new bioinformatic tool to discover antibiotic resistance genes in bacterial genomes. Antimicrob. Agents Chemother. 58, 212-220 (2014). [0205] 36. Thorvaldsdttir, H., Robinson, J. T. & Mesirov, J. P. Integrative Genomics Viewer (IGV): high-performance genomics data visualization and exploration. Brief Bioinform. 14, 178-92 (2013). [0206] 37.
TABLE-US-00009 SEQUENCEIDENTIFICATION DNA folC-E.coli Artificial SEQIDNO.1 ATACCATGATTA DNA rpsD-E.coli Artificial SEQIDNO.2 AGAAAATGGCAA DNA rpsD-K.pneumoniae Artificial SEQIDNO.3 AGAAAATGGCAA DNA rpsD-S.enterica Artificial SEQIDNO.4 AGAAAATGGCAA DNA rpsD-S.enterica,rtcA Artificial SEQIDNO.5 AGAAAATGGCAA DNA ffh-E.coli Artificial SEQIDNO.6 GACAATGTTTGA DNA ffh-K.pneumoniae Artificial SEQIDNO.7 GACAATGTTTGAT DNA ffh-S.enterica Artificial SEQIDNO.8 GACAATGTTTGA DNA lexA-E.coli Artificial SEQIDNO.9 CGGAATGAAAGC DNA lexA-K.pneumoniae Artificial SEQIDNO.10 CGGAATGAAAGC DNA lexA-S.enterica Artificial SEQIDNO.11 CGGAATGAAAGC DNA gyrB-E.coli Artificial SEQIDNO.12 GTTGATGTCGAA DNA gyrB-K.pneumoniae Artificial SEQIDNO.13 GTTGATGTCGAA DNA gyrB-S.enterica Artificial SEQIDNO.14 CGTTGATGTCGAA PeptideNucleicAcid -folC Artificial SEQIDNO.15 ATACCATGATTA PeptideNucleicAcid -ffh Artificial SEQIDNO.16 GACAATGTTTGA PeptideNucleicAcid -lexA Artificial SEQIDNO.17 CGGAATGAAAGC PeptideNucleicAcid -gyrB Artificial SEQIDNO.18 GTTGATGTCGAA PeptideNucleicAcid -rspD Artificial SEQIDNO.19 AGAAAATGGCAA DNA Antisenseoligomerfor-rpsD Artificial SEQIDNO.20 ATTTAGGTGACACTATAGAAGTGGAGAAAGAAAATGGCAAGATATTTGGG TCCTAAGCTC DNA Antisenseoligomerfor-lexA Artificial SEQIDNO.21 ATTTAGGTGACACTATAGAAGCAGGGGGCGGAATGAAAGCGTTAACGGCC AGGCAACAAG DNA Nonsenseoligomer Artificial SEQIDNO.22 GAATTCGAATTCGGTCAGTGCGTCCTGCTGATGTGCTCAGTATCTCTATC ACTGATAGGG AminoAcid cellpenetratingpeptide Artificial SEQIDNO.23 KFFKFFKFFK DNA gyrBforwardprimer Artificial SEQIDNO.24 CGGGTCCATAGTGGTTTCCC DNA gyrBreverseprimer Artificial SEQIDNO.25 GTGAGAAACTGCGTGGCTTG DNA folCforwardprimer Artificial SEQIDNO.26 GCTCAAGCAGTTGTTCTGCC DNA folCreverseprimer Artificial SEQIDNO.27 TCTCACCGGGCGTATGAAAG DNA ffhforwardprimer Artificial SEQIDNO.28 TTCCATACGCACCAGCACTT DNA ffhreverseprimer Artificial SEQIDNO.29 CGCGCAGGCAGAGAAATTAG DNA rpsDforwardprimer Artificial SEQIDNO.30 CAGCCAGGTTGGCTTTTCAC DNA rpsDreverseprimer Artificial SEQIDNO.31 AGAAGCACGTCAGCTGGTTA DNA lexAforwardprimer Artificial SEQIDNO.32 GTTAACGGCCAGGCAACAAG DNA lexAreverseprimer Artificial SEQIDNO.33 TCAATAACGCCTTTGCGTGC AminoAcid holin-endolysinconstruct Bacteriophagelambda SEQIDNO.34 MKMPEKHDLLAAILAAKEQGIGAILAFAMAYLRGRYNGGAFTKTVIDATM CAIIAWFIRDLLDFAGLSSNLAYITSVFIGYIGTDSIGSLIKRFAAKKAG VEDGRNQSTGVPRYAGVVGGNRTSENQKSWLRHCRRRAIYLLRSPSQTCH AKPKTQINRRRTLPASFPLVGCLPQAAWPERLLSEKSGRCGIAADGAWRF TYDSWYPSGNRPLQQYLGFTAGRWLWSVRAGQPDCKIQRSGRNGQRDCMS RVTAIISALVICIIVCLSWAVNHYRDNAITYKAQRDKNARELKLANAAIT DMQMRQRDVAALDAKYTKELADAKAENDALRDDVAAGRRRLHIKAVCQSV REATTASGVDNAASPRLADTAERDYFTLRERLITMQKQLEGTQKYINEQC R AminoAcid Virulenceregulontranscriptional activatorVirBShigellaflexneri SEQIDNO.35 MVDLCNDLLSIKEGQKKEFTLHSGNKVSFIKAKIPHKRIQDLTFVNQKTN VRDQESLTEESLADIIKTIKLQQFFPVIGREIDGRIEILDGTRRRASAIY AGADLEVLYSKEYISTLDARKLANDIQTAKEHSIRELGIGLNFLKVSGMS YKDIAKKENLSRAKVTRAFQAASVPQEIISLFPIASELNFNDYKILFNYY KGLEKANESLSSTLPILKEEIKDLDTNLPPDIYKKEILNIIKKSKNRKQN PSLKVDSLFISKDKRTYIKRKENKTNRTLIFTLSKINKTVQREIDEAIRD IISRHLSSS