CHIMERIC ANTIGEN RECEPTORS TARGETING THE TUMOR MICROENVIRONMENT
20210038646 ยท 2021-02-11
Assignee
Inventors
Cpc classification
C07K16/2863
CHEMISTRY; METALLURGY
A61K2039/64
HUMAN NECESSITIES
C07K16/2866
CHEMISTRY; METALLURGY
A61K35/17
HUMAN NECESSITIES
A61K39/39
HUMAN NECESSITIES
C07K2319/33
CHEMISTRY; METALLURGY
C07K16/2809
CHEMISTRY; METALLURGY
C07K16/22
CHEMISTRY; METALLURGY
C07K14/70578
CHEMISTRY; METALLURGY
C12N15/86
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
A61K35/17
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
C07K14/705
CHEMISTRY; METALLURGY
C07K16/28
CHEMISTRY; METALLURGY
Abstract
The invention provides methods and compositions for use in treating cancer, which advantageously may be achieved by targeting of a tumor microenvironment. The invention provides chimeric antigen receptors (CARs) that target a tumor microenvironment. In one aspect, the invention features an immune cell engineered to express: (a) a chimeric antigen receptor (CAR) polypeptide including an extracellular domain including a first antigen binding domain that binds to a first antigen and a second antigen-binding domain that binds to a second antigen; and (b) a bispecific T cell engager (BiTE), wherein the BiTE binds to a target antigen and a T cell antigen. In another aspect, the invention features a pharmaceutical composition including the immune cell. In another aspect, the invention features a method of treating a cancer in a subject in need thereof, the method comprising administering the immune cell.
Claims
1. An immune cell engineered to express: (a) a chimeric antigen receptor (CAR) polypeptide comprising an extracellular domain comprising a first antigen-binding domain that binds to a first antigen and a second antigen-binding domain that binds to a second antigen; and (b) a bispecific T cell engager (BiTE), wherein the BiTE binds to a target antigen and a T cell antigen.
2. The immune cell of claim 1, wherein the CAR polypeptide comprises a transmembrane domain and an intracellular signaling domain.
3. The immune cell of claim 1, wherein the CAR polypeptide further comprises one or more co-stimulatory domains.
4. The immune cell of claim 1, wherein the first and second antigens are glioblastoma antigens.
5. The immune cell of claim 1, wherein the first and second antigens are independently selected from epidermal growth factor receptor (EGFR), epidermal growth factor receptor variant III (EGFRvIII), CD19, CD79b, CD37, prostate-specific membrane antigen (PSMA), prostate stem cell antigen (PSCA), interleukin-13 receptor alpha 2 (IL-13R2), ephrin type-A receptor 1 (EphA1), human epidermal growth factor receptor 2 (HER2), mesothelin, mucin 1, cell surface associated (MUC1), or mucin 16, cell surface associated (MUC16).
6. The immune cell of claim 1, wherein the first antigen-binding domain and/or the second antigen-binding domain comprises an antigen-binding fragment of an antibody.
7. The immune cell of claim 6, wherein the antigen-binding fragment of the antibody comprises a single domain antibody or a single chain variable fragment (scFv).
8. The immune cell of claim 1, wherein the first antigen-binding domain and/or the second antigen-binding domain comprises a ligand of the first and/or second antigen.
9. The immune cell of claim 1, wherein the extracellular domain does not comprise a linker between the first antigen-binding domain and the second antigen-binding domain.
10. The immune cell of claim 1, wherein the first antigen-binding domain is connected to the second antigen-binding domain by a linker.
11. The immune cell of claim 10, wherein the linker comprises an amino acid having at least 90% sequence identity to the linker of SEQ ID NO: 102, 107, 108, 109, or 110.
12. The immune cell of claim 2, wherein the transmembrane domain comprises a hinge/transmembrane domain.
13. The immune cell of claim 12, wherein the hinge/transmembrane domain comprises the hinge/transmembrane domain of an immunoglobulin-like protein, CD28, CD8, or 4-1 BB.
14. The immune cell of claim 12, wherein the transmembrane domain comprises the hinge/transmembrane domain of CD8, optionally comprising the amino acid sequence of SEQ ID NO: 4, 10, 16, 22, 28, 37, 46, 58, 66, 72, 78, or 104, or an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 4, 10, 16, 22, 28, 37, 46, 58, 66, 72, 78, or 104.
15. The immune cell of claim 2, wherein the intracellular signaling domain comprises the intracellular signaling domain of TCR, FcR, FcR, CD3, CD3, CD3, CD3, CD3, CD22, CD79a, CD79b, or CD66d.
16. The immune cell of claim 15, wherein the intracellular signaling domain comprises the intracellular signaling domain of CD3, optionally comprising the amino acid sequence of SEQ ID NO: 6, 12, 18, 24, 30, 39, 48, 60, 68, 74, 80, or 106, or an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 6, 12, 18, 24, 30, 39, 48, 60, 68, 74, 80, or 106.
17. The immune cell of claim 3, wherein the co-stimulatory domain comprises the co-stimulatory domain of 4-1 BB, CD27, CD28, or OX-40.
18. The immune cell of claim 17, wherein the co-stimulatory domain comprises the co-stimulatory domain of 4-1 BB, optionally comprising the amino acid sequence of SEQ ID NO: 5, 11, 17, 23, 29, 38, 47, 59, 67, 73, 79, or 105, or an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 5, 11, 17, 23, 29, 38, 47, 59, 67, 73, 79, or 105.
19. The immune cell of claim 1, wherein the first antigen-binding domain comprises an IL-13R2-binding domain.
20. The immune cell of claim 1, wherein the second antigen-binding domain comprises an EGFRvIII-binding domain.
21. The immune cell of claim 19, wherein the IL-13R2-binding domain comprises an anti-IL-13R2 scFv or a ligand of IL-13R2.
22. The immune cell of claim 21, wherein the ligand of IL-13R2 comprises IL-13 or IL-13 zetakine, or an antigen-binding fragment thereof.
23. The immune cell of claim 19, wherein the IL-13R2-binding domain comprises an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 101.
24. The immune cell of claim 23, wherein the IL-13R2-binding domain comprises the amino acid sequence of SEQ ID NO: 101.
25. The immune cell of claim 20, wherein the EGFRvIII-binding domain comprises an antigen-binding fragment of an antibody.
26. The immune cell of claim 20, wherein the EGFRvIII-binding domain comprises an anti-EGFRvIII scFv.
27. The immune cell of claim 26, wherein the anti-EGFRvIII scFv comprises a heavy chain variable domain (VH) comprising an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 111 or 113 and/or a light chain variable domain (VL) comprising an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 112 or 114.
28. The immune cell of claim 27, wherein the VH comprises the amino acid sequence of SEQ ID NO: 111 or 113 and/or the VL comprises the amino acid sequence of SEQ ID NO: 112 or 114.
29. The immune cell of claim 20, wherein the EGFRvIII-binding domain comprises an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 103.
30. The immune cell of claim 29, wherein the EGFRvIII-binding domain comprises the amino acid sequence of SEQ ID NO: 103.
31. The immune cell of claim 1, wherein the CAR polypeptide comprises an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 100.
32. The immune cell of claim 31, wherein the CAR polypeptide comprises the amino acid sequence of SEQ ID NO: 100.
33. An immune cell engineered to express: (i) a CAR polypeptide comprising an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 100; and (ii) a BiTE, wherein the BiTE binds to a target antigen and a T cell antigen.
34. An immune cell engineered to express: (i) a CAR polypeptide comprising the amino acid sequence of SEQ ID NO: 100; and (ii) a BiTE, wherein the BiTE binds to a target antigen and a T cell antigen.
35. The immune cell of claim 1, 33, or 34, wherein the target antigen is a glioblastoma-associated antigen selected from one of EGFR, EGFRvIII, CD19, CD79b, CD37, PSMA, PSCA, IL-13R2, EphA1, HER2, mesothelin, MUC1, or MUC16.
36. The immune cell of claim 1, 33, or 34, wherein the T cell antigen is CD3.
37. The immune cell of claim 1, 33, or 34, wherein the target antigen is EGFR and the T cell antigen is CD3.
38. The immune cell of claim 1, 33, or 34, wherein the BiTE comprises an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 98 or 99.
39. The immune cell of claim 38, wherein the BiTE comprises the amino acid sequence of SEQ ID NO: 98 or 99.
40. The immune cell of claim 1, 33, or 34, wherein the immune cell is a T or natural killer (NK) cell.
41. The immune cell of claim 1, 33, or 34, wherein the immune cell is a human cell.
42. A polynucleotide encoding the CAR polypeptide and the BiTE of claim 1, 33, or 34.
43. The polynucleotide of claim 42, wherein the polynucleotide comprises a CAR polypeptide encoding sequence and a BiTE encoding sequence, and wherein the CAR polypeptide encoding sequence and the BiTE encoding sequence are separated by a ribosome skipping moiety.
44. The polynucleotide of claim 42, wherein the CAR polypeptide and/or the BiTE is expressed under a constitutive promoter.
45. The polynucleotide of claim 44, wherein the constitutive promoter comprises an elongation factor-1 alpha (EF1) promoter.
46. The polynucleotide of claim 42, wherein the CAR polypeptide and/or the BiTE is expressed under an inducible promoter.
47. The polynucleotide of claim 46, wherein the inducible promoter is inducible by T cell receptor (TCR) or CAR signaling.
48. The polynucleotide of claim 47, wherein the inducible promoter comprises a nuclear factor of activated T cells (NFAT) response element.
49. The polynucleotide of claim 42, wherein the CAR polypeptide and the BiTE are each expressed under a constitutive promoter.
50. The polynucleotide of claim 42, wherein the CAR polypeptide is expressed under a constitutive promoter and the BiTE is expressed under an inducible promoter.
51. The polynucleotide of claim 42, further comprising a suicide gene.
52. The polynucleotide of claim 42, further comprising a sequence encoding one or more signal sequences.
53. A vector comprising the polynucleotide of claim 42.
54. The vector of claim 53, wherein the vector is a lentiviral vector.
55. A pharmaceutical composition comprising the immune cell of claim 1, 33, or 34.
56. A method of treating a cancer in a subject in need thereof, the method comprising administering the immune cell of claim 1, 33, or 34, a pharmaceutical composition thereof, to the subject.
57. The method of claim 56, wherein the cancer is glioblastoma, lung cancer, pancreatic cancer, lymphoma, or myeloma, optionally wherein the cancer comprises expressing one or more of the group consisting of EGFR, EGFRvIII, CD19, CD79b, CD37, PSMA, PSCA, IL-13R2, EphA1, HER2, mesothelin, MUC1, and MUC16.
58. The method of claim 57, wherein the glioblastoma comprises cells expressing one or more of the group consisting of IL-13R2, EGFRvIII, EGFR, HER2, mesothelin, and EphA1.
59. The method of claim 57, wherein the glioblastoma comprises cells with reduced EGFRvIII expression.
60. An immune cell engineered to express: (i) a CAR polypeptide comprising an EGFR-binding domain, wherein the CAR polypeptide comprises an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 117; and (ii) an anti-GARP camelid comprising an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 25.
61. An immune cell engineered to express: (i) a CAR polypeptide comprising an EGFRvIII-binding domain, wherein the CAR polypeptide comprises an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 115 or 116; and (ii) a BiTE, wherein the BiTE binds to EGFR and CD3, comprising an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 98 or 99.
62. A polynucleotide encoding the CAR polypeptide and the anti-GARP camelid of claim 60.
63. A polynucleotide encoding the CAR polypeptide and the BiTE of claim 61.
64. The polynucleotide of claim 62 or 63, further comprising a suicide gene.
65. The polynucleotide of claim 62 or 63, further comprising a sequence encoding one or more signal sequences.
66. A vector comprising the polynucleotide of claim 62 or 63.
67. The vector of claim 66, wherein the vector is a lentiviral vector.
68. A pharmaceutical composition comprising the immune cell of claim 60 or 61.
69. A method of treating glioblastoma having reduced EGFRvIII expression in a subject comprising administering to the subject an immune cell engineered to express: (i) a CAR polypeptide comprising an extracellular EGFRvIII-binding domain; and (ii) a BiTE, wherein the immune cell is optionally selected from the immune cell of any one of claims 1, 33, 34, 60, and 61.
70. A method of preventing or reducing immunosuppression in the tumor microenvironment in a subject comprising administering to the subject an immune cell comprising (i) a CAR comprising an extracellular target binding domain; and (ii) a BiTE, wherein the immune cell is optionally selected from the immune cell of any one of claims 1, 33, 34, 60, and 61.
71. A method of preventing or reducing T cell exhaustion in the tumor microenvironment in a subject, the method comprising administering to the subject an immune cell comprising (i) a CAR comprising an extracellular target binding domain; and (ii) a BiTE, wherein the immune cell is optionally selected from the immune cell of any one of claims 1, 33, 34, 60, and 61.
72. A method of treating a cancer having heterogeneous antigen expression in a subject, the method comprising administering to the subject an immune cell comprising (i) a CAR comprising an extracellular target binding domain; and (ii) a BiTE, wherein the immune cell is optionally selected from the immune cell of any one of claims 1, 33, 34, 60, and 61.
73. The method of claim 72, wherein the cancer is glioblastoma, prostate cancer, lung cancer, pancreatic cancer, lymphoma, or myeloma.
74. The method of claim 72, wherein the cancer comprises cells expressing one or more of the group consisting of EGFR, EGFRvIII, CD19, PSMA, PSCA, IL-13R2, EphA1, Her2, mesothelin, MUC1, and MUC16.
75. A CAR T cell comprising a heterologous nucleic acid molecule, wherein the heterologous nucleic acid molecule comprises: (a) a first polynucleotide encoding a CAR comprising an extracellular antigen-binding domain, a transmembrane domain, and an intracellular signaling domain; and (b) a second polynucleotide encoding a therapeutic agent.
76. The CAR T cell of claim 75, wherein the therapeutic agent comprises an antibody reagent.
77. The CAR T cell of claim 76, wherein the antibody reagent comprises a single chain antibody or a single domain antibody.
78. The CAR T cell of claim 76, wherein the antibody reagent comprises a bispecific antibody reagent.
79. The CAR T cell of claim 78, wherein the bispecific antibody reagent comprises a BiTE.
80. The CAR T cell of claim 77, wherein the single domain antibody comprises a camelid antibody.
81. The CAR T cell of claim 75, wherein the therapeutic agent comprises a cytokine.
82. The CAR T cell of claim 75, wherein the CAR and the therapeutic agent are produced as separate CAR and therapeutic agent molecules.
83. The CAR T cell of claim 82, wherein the CAR T cell comprises a ribosome skipping moiety between the first polynucleotide encoding the CAR and the second polynucleotide encoding the therapeutic agent.
84. The CAR T cell of claim 83, wherein the ribosome skipping moiety comprises a 2A peptide.
85. The CAR T cell of claim 84, wherein the 2A peptide comprises P2A or T2A.
86. The CAR T cell of claim 75, wherein the CAR and the therapeutic agent are each constitutively expressed.
87. The CAR T cell of claim 75, wherein expression of the CAR and the therapeutic agent is driven by an EF1 promoter.
88. The CAR T cell of claim 75, wherein the therapeutic agent is expressed under the control of an inducible promoter, which is optionally inducible by T cell receptor or CAR signaling.
89. The CAR T cell of claim 88, wherein the inducible promoter comprises the NFAT promoter.
90. The CAR T cell of claim 75, wherein the CAR is expressed under the control of a constitutive promoter and the therapeutic agent is expressed under the control of an inducible promoter, which is optionally inducible by T cell receptor or CAR signaling.
91. The CAR T cell of claim 75, wherein the CAR further comprises one or more co-stimulatory domains.
92. The CAR T cell of claim 75, wherein the antigen-binding domain of the CAR comprises an antibody, a single chain antibody, a single domain antibody, or a ligand.
93. The CAR T cell of claim 75, wherein the transmembrane domain comprises a hinge/transmembrane domain.
94. The CAR T cell of claim 93, wherein the hinge/transmembrane domain comprises the hinge/transmembrane domain of an immunoglobulin-like protein, CD28, CD8, or 4-1 BB.
95. The CAR T cell of claim 75, wherein the transmembrane domain of the CAR comprises a CD8 hinge/transmembrane domain, which optionally comprises the sequence of any one of SEQ ID NOs: 4, 10, 16, 22, 28, 37, 46, 58, 66, 72, 78, and 104, or a variant thereof.
96. The CAR T cell of claim 75, wherein the intracellular signaling domain comprises the intracellular signaling domain of TCR, FcR, FcR, CD3, CD3, CD3, CD3, CD3, CD22, CD79a, CD79b, or CD66d.
97. The CAR T cell of claim 75, wherein the intracellular signaling domain comprises a CD3 intracellular signaling domain, which optionally comprises the sequence of any one of SEQ ID NOs: 6, 12, 18, 24, 30, 39, 48, 60, 68, 74, 80, and 106, or a variant thereof.
98. The CAR T cell of claim 91, wherein the co-stimulatory domain comprises the co-stimulatory domain of 4-1 BB, CD27, CD28, or OX-40.
99. The CAR T cell claim 91, wherein the co-stimulatory domain comprises a 4-1 BB co-stimulatory domain, which optionally comprises the sequence of any one of SEQ ID NOs: 5, 11, 17, 23, 29, 38, 47, 59, 67, 73, 79, and 105, or a variant thereof.
100. The CAR T cell of claim 75, wherein the CAR antigen-binding domain binds to a tumor-associated antigen or a Treg-associated antigen.
101. The CAR T cell of claim 80, wherein the camelid antibody binds to a tumor-associated antigen or a Treg-associated antigen.
102. The CAR T cell of claim 79, wherein the BiTE binds to (i) a tumor-associated antigen or a Treg-associated antigen, and (ii) a T cell antigen.
103. The CAR T cell of any one of claims 100-102, wherein the tumor-associated antigen is a solid tumor-associated antigen.
104. The CAR T cell of claim 103, wherein the tumor-associated antigen comprises EGFRvIII, EGFR, CD19, PSMA, PSCA, IL-13R2, EphA1, Her2, mesothelin, MUC1, or MUC16, and optionally the CAR antigen-binding domain or the therapeutic agent comprises a sequence selected from the group consisting of SEQ ID NO: 21, 27, 33, 36, 42, 45, 51, 55, 57, 63, 65, 103, and variants thereof.
105. The CAR T cell of any one of claims 100-102, wherein the Treg-associated antigen is selected from the group consisting of glycoprotein A repetitions predominant (GARP), latency-associated peptide (LAP), CD25, and cytotoxic T lymphocyte-associated antigen-4 (CTLA-4), and optionally the CAR antigen-binding domain or the therapeutic agent comprises a sequence selected from the group consisting of SEQ ID NO: 3, 9, 15, 25, 71, 77, and variants thereof.
106. A CAR polypeptide comprising an extracellular antigen-binding domain, a transmembrane domain, and an intracellular signaling domain; and the antigen-binding domain binds to a Treg-associated antigen.
107. The CAR polypeptide of claim 106, wherein the Treg-associated antigen is selected from the group consisting of GARP, LAP, CD25, and CTLA-4.
108. The CAR polypeptide of claim 106, wherein the CAR further comprises one or more co-stimulatory domains.
109. The CAR polypeptide of claim 106, wherein the Treg-associated antigen is GARP or LAP.
110. The CAR polypeptide of claim 106, wherein the antigen-binding domain of the CAR comprises: (a) a heavy chain variable domain (VH) comprising three complementarity determining regions CDR-H1, CDR-H2, and CDR-H3, wherein the CDR-H1 comprises an amino acid sequence of SEQ ID NO: 81, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 81; the CDR-H2 comprises an amino acid sequence of SEQ ID NO: 82, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 82; and the CDR-H3 comprises an amino acid sequence of SEQ ID NO: 83, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 83, and/or (b) a light chain variable domain (VL) comprising three complementarity determining regions CDR-L1, CDR-L2, and CDR-L3, wherein the CDR-L1 comprises an amino acid sequence of SEQ ID NO: 84, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 84; the CDR-L2 comprises an amino acid sequence of SEQ ID NO: 85, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 85; and the CDR-L3 comprises an amino acid sequence of SEQ ID NO: 86, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 86.
111. The CAR polypeptide of claim 110, wherein the VH comprises an amino acid sequence of SEQ ID NO: 87, or an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 87, and/or the VL comprises an amino acid sequence of SEQ ID NO: 88, or an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 88.
112. The CAR polypeptide of claim 106, wherein the antigen-binding domain of the CAR comprises: (a) a heavy chain variable domain (VH) comprising three complementarity determining regions CDR-H1, CDR-H2, and CDR-H3, wherein the CDR-H1 comprises an amino acid sequence of SEQ ID NO: 89, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 89; the CDR-H2 comprises an amino acid sequence of SEQ ID NO: 90, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 90; and the CDR-H3 comprises an amino acid sequence of SEQ ID NO: 91, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 91, and/or (b) a light chain variable domain (VL) comprising three complementarity determining regions CDR-L1, CDR-L2, and CDR-L3, wherein the CDR-L1 comprises an amino acid sequence of SEQ ID NO: 92, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 92; the CDR-L2 comprises an amino acid sequence of SEQ ID NO: 93, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 93; and the CDR-L3 comprises an amino acid sequence of SEQ ID NO: 94, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 94.
113. The CAR polypeptide of claim 112, wherein the VH comprises an amino acid sequence of SEQ ID NO: 95, or an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 95, and/or the VL comprises an amino acid sequence of SEQ ID NO: 96, or an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 96.
114. The CAR polypeptide of claim 110 or 112, wherein the VH is N-terminal to the VL.
115. The CAR polypeptide of claim 110 or 112, wherein the VL is N-terminal to the VH.
116. The CAR polypeptide of claim 106, wherein the antigen-binding domain of the CAR comprises a scFv or a single domain antibody, which optionally comprises a sequence selected from the group consisting of SEQ ID NO: 3, 9, 15, 25, 71, 77, and variants thereof.
117. The CAR polypeptide of claim 106, wherein the transmembrane domain comprises a hinge/transmembrane domain.
118. The CAR polypeptide of claim 117, wherein the hinge/transmembrane domain comprises the hinge/transmembrane domain of an immunoglobulin-like protein, CD28, CD8, or 4-1 BB.
119. The CAR polypeptide of claim 106, wherein the transmembrane domain of the CAR comprises a CD8 hinge/transmembrane domain, which optionally comprises the sequence of any one of SEQ ID NOs: 4, 10, 16, 22, 28, 37, 46, 58, 66, 72, 78, and 104, or a variant thereof.
120. The CAR polypeptide of claim 106, wherein the intracellular signaling domain comprises the intracellular signaling domain of TCF, FcR, FcR, CD3, CD3, CD3, CD3, CD3, CD22, CD79a, CD79b, or CD66d.
121. The CAR polypeptide of claim 106, wherein the intracellular signaling domain comprises a CD3 intracellular signaling domain, which optionally comprises the sequence of any one of SEQ ID NOs: 6, 12, 18, 24, 30, 39, 48, 60, 68, 74, 80, and 106, or a variant thereof.
122. The CAR polypeptide of claim 108, wherein the co-stimulatory domain comprises the co-stimulatory domain of 4-1 BB, CD27, CD28, or OX-40.
123. The CAR polypeptide of claim 108, wherein the co-stimulatory domain comprises a 4-1 BB co-stimulatory domain, which optionally comprises the sequence of any one of SEQ ID NOs: 5, 11, 17, 23, 29, 38, 47, 59, 67, 73, 79, and 105, or a variant thereof.
124. A CAR polypeptide comprising an amino acid sequence having at least 90% sequence identity to the amino acid sequence of any one of SEQ ID NO: 26, SEQ ID NO: 35, SEQ ID NO: 44, SEQ ID NO: 53, SEQ ID NO: 61, SEQ ID NO: 19, SEQ ID NO: 1, SEQ ID NO: 7, SEQ ID NO: 13, SEQ ID NO: 69, SEQ ID NO: 75, and SEQ ID NO: 100.
125. The CAR polypeptide of claim 124, comprising the amino acid sequence of any one of SEQ ID NO: 26, SEQ ID NO: 35, SEQ ID NO: 44, SEQ ID NO: 53, SEQ ID NO: 61, SEQ ID NO: 19, SEQ ID NO: 1, SEQ ID NO: 7, SEQ ID NO: 13, SEQ ID NO: 69, SEQ ID NO: 75, and SEQ ID NO: 100.
126. A nucleic acid molecule encoding (i) the CAR polypeptide, or (ii) a polyprotein comprising the CAR polypeptide and the therapeutic agent, of claim 75 or 106.
127. The nucleic acid molecule of claim 126, further comprising a suicide gene.
128. The nucleic acid molecule of claim 126, further comprising a sequence encoding a signal sequence.
129. A vector comprising the nucleic acid molecule of claim 126.
130. The vector of claim 129, wherein the vector is a lentiviral vector.
131. A polypeptide comprising the CAR polypeptide, or a polyprotein comprising the CAR polypeptide and the therapeutic agent, of claim 75 or 106.
132. An immune cell comprising the CAR polypeptide of claim 106.
133. The immune cell of claim 132, wherein the immune cell is a T or NK cell.
134. The immune cell of claim 132, wherein the immune cell is a human cell.
135. A pharmaceutical composition comprising one or more CAR T cells, nucleic acid molecules, CAR polypeptides, polyproteins, or immune cells of claim 75 or 106.
136. A method of treating a patient having cancer, the method comprising administering to the patient the pharmaceutical composition of claim 135.
137. The method of claim 136, wherein by targeting the tumor microenvironment, systemic toxicity is reduced.
138. The method of claim 136, wherein the cancer is characterized by the presence of one or more solid tumors.
139. The method of claim 136, wherein the cancer is characterized by tumor-infiltrating Tregs.
140. The method of claim 136, wherein the cancer is a glioblastoma.
141. A method of treating a patient having cancer, the method comprising administering to the patient a CAR T cell product, genetically modified to secrete a tumor-toxic antibody or cytokine, wherein by directing the cancer toxicity locally to the tumor microenvironment, systemic toxicity is reduced.
142. The method of claim 141, wherein the CAR T cell is genetically modified to deliver an antibody against CTLA4, CD25, GARP, LAP, IL-15, CSF1R, or EGFR, EGFRvIII, CD19, CD79b, CD37, PSMA, PSCA, IL-13R2, EphA1, Her2, mesothelin, MUC1, or MUC16, or a bispecific antibody to the tumor microenvironment.
143. The method of claim 142, wherein the bispecific antibody is a BiTE directed against EGFR and CD3.
144. A method of delivering a therapeutic agent to a tissue or organ in a patient to treat a disease or pathology, the method comprising administering to said patient a CAR T cell, genetically modified to secrete a therapeutic antibody, toxin, or agent, wherein the therapeutic antibody, toxin, or agent would, by itself, be unable to enter or penetrate the tissue or organ.
145. The method of claim 144, wherein the tissue or organ is in the nervous system.
146. The method of claim 145, wherein the nervous system is the central nervous system.
147. The method of claim 146, wherein the central nervous system is the brain.
148. The method of claim 144, wherein the disease or pathology is a cancer.
149. The method of claim 148, wherein the cancer is glioblastoma, prostate cancer, lung cancer, pancreatic cancer, lymphoma, or myeloma.
150. The method of claim 144, wherein the therapeutic antibody is anti-EGFR or anti-EGFRvIII.
151. A method of treating glioblastoma having reduced EGFRvIII expression in a subject comprising administering to the subject a CAR T cell engineered to express: (i) a CAR polypeptide comprising an extracellular EGFRvIII-binding domain; and (ii) a BiTE, wherein the CAR T cell is optionally the CAR T cell of claim 75.
152. A method of preventing or reducing immunosuppression in the tumor microenvironment in a subject comprising administering to the subject a CAR T cell engineered to express: (i) a CAR polypeptide comprising an extracellular target binding domain; and (ii) a BiTE, wherein the CAR T cell is optionally the CAR T cell of claim 75.
153. A method of preventing or reducing T cell exhaustion in the tumor microenvironment in a subject, the method comprising administering to the subject a CAR T cell engineered to express: (i) a CAR polypeptide comprising an extracellular target binding domain; and (ii) a BiTE, wherein the CAR T cell is optionally the CAR T cell of claim 75.
154. A method of treating a cancer having heterogeneous antigen expression in a subject, the method comprising administering to the subject a CAR T cell engineered to express: (i) a CAR polypeptide comprising an extracellular target binding domain; and (ii) a BiTE, wherein the CAR T cell is optionally the CAR T cell of claim 75.
155. The method of claim 154, wherein the cancer is glioblastoma, prostate cancer, lung cancer, pancreatic cancer, lymphoma, or myeloma.
156. The method of claim 154, wherein the cancer comprises cells expressing one or more of EGFR, EGFRvIII, CD19, PSMA, PSCA, IL-13R2, EphA1, Her2, mesothelin, MUC1, and MUC16.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0124]
[0125]
[0126]
[0127]
[0128]
[0129]
[0130]
[0131]
[0132]
[0133]
[0134]
[0135]
[0136]
[0137]
[0138]
[0139]
[0140]
[0141]
[0142]
[0143]
[0144]
[0145]
[0146]
[0147]
[0148]
[0149]
[0150]
[0151]
[0152]
[0153]
[0154]
[0155]
[0156]
[0157]
[0158]
[0159]
[0160]
[0161]
[0162]
[0163]
[0164]
[0165]
[0166]
[0167]
[0168]
[0169]
[0170]
[0171]
[0172]
[0173]
[0174]
[0175]
[0176]
[0177]
[0178]
[0179]
[0180]
[0181]
[0182]
[0183]
[0184]
[0185]
[0186]
[0187]
[0188]
[0189]
[0190]
[0191]
[0192]
[0193]
[0194]
[0195]
[0196]
[0197]
[0198]
[0199]
[0200]
[0201]
[0202]
[0203]
[0204]
[0205]
[0206]
[0207]
[0208]
[0209]
[0210]
[0211]
[0212]
[0213]
[0214]
[0215]
[0216]
DETAILED DESCRIPTION
[0217] The invention provides improved approaches to chimeric antigen receptor T cell (CAR T cell)-based therapy. In general, the improvements relate to different aspects of targeting in antitumor therapy, for example, targeting of the tumor microenvironment.
[0218] For example, described herein are immune cells, e.g., T cells engineered to express a CAR as well as to secrete a therapeutic agent, such as a bispecific T cell engager (BiTE). CAR T cells engineered to secrete BiTEs are referred to herein as CART.BiTE. The CART.BiTE strategy allows for locoregional delivery of therapeutics for tumors in, e.g., the central nervous system (CNS) while reducing the risk of undesired activity in systemic tissues. Such CART.BiTE constructs are useful for treating cancers such as glioblastoma, prostate cancer, lung cancer, pancreatic cancer, lymphoma, or myeloma, among others as described herein.
[0219] Additionally, as is explained further below, we have demonstrated that regulatory T cells (also referred to herein as Tregs), which play a role in the suppression of a subject's immune response against tumors (e.g., in the tumor microenvironment), can be targeted with CAR T cells. The invention thus provides CAR T cells, in which the CAR is directed against a Treg antigen or marker (e.g., GARP, LAP, CTLA4, or CD25; also see below). In other examples, the invention provides CAR T cells that secrete antibodies (e.g., single chain antibodies, single domain antibodies (e.g., camelid antibodies), or bispecific antibodies (e.g., bispecific T cell engagers)) against one or more Treg antigens or markers (e.g., GARP, LAP, CTLA4 and CD25; also see below). In addition to targeting Tregs, the invention provides CAR T cells and related methods for delivering other therapeutic agents (e.g., antibodies and related molecules) to tumors. In one example, a CAR T cell having a CAR specific for EGFRvIII is used to target brain tumors (e.g., glioblastomas). Such CAR T cells may also be used to deliver therapeutic agents, such as antibody reagents (e.g., single chain antibodies, single domain antibodies (e.g., camelid antibodies), or bispecific antibodies (e.g., bispecific T cell engagers)) to these tumors. These methods are particularly advantageous, as they, in effect, facilitate antibody administration to the brain, despite the blood brain barrier through which antibodies do not normally pass. These approaches, as well as related methods and compositions, are described further, as follows.
Chimeric Antigen Receptors (CARs)
[0220] The technology described herein provides improved chimeric antigen receptors (CARs) for use in immunotherapy. The following discusses CARs and the various improvements.
[0221] The terms chimeric antigen receptor or CAR or CARs as used herein refer to engineered T cell receptors, which graft a ligand or antigen specificity onto T cells (for example, nave T cells, central memory T cells, effector memory T cells or combinations thereof). CARs are also known as artificial T-cell receptors, chimeric T-cell receptors or chimeric immunoreceptors.
[0222] A CAR places a chimeric extracellular target-binding domain that specifically binds a target, e.g., a polypeptide, expressed on the surface of a cell to be targeted for a T cell response onto a construct including a transmembrane domain and intracellular domain(s) of a T cell receptor molecule. In one embodiment, the chimeric extracellular target-binding domain includes the antigen-binding domain(s) of an antibody that specifically binds an antigen expressed on a cell to be targeted for a T cell response. The properties of the intracellular signaling domain(s) of the CAR can vary as known in the art and as disclosed herein, but the chimeric target/antigen-binding domains(s) render the receptor sensitive to signaling activation when the chimeric target/antigen binding domain binds the target/antigen on the surface of a targeted cell.
[0223] With respect to intracellular signaling domains, so-called first-generation CARs include those that solely provide CD3zeta (CD3) signals upon antigen binding. So-called second-generation CARs include those that provide both co-stimulation (e.g., CD28 or CD137) and activation (CD3) domains, and so-called third-generation CARs include those that provide multiple costimulatory (e.g., CD28 and CD137) domains and activation domains (e.g., CD3). In various embodiments, the CAR is selected to have high affinity or avidity for the target/antigenfor example, antibody-derived target or antigen binding domains will generally have higher affinity and/or avidity for the target antigen than would a naturally-occurring T cell receptor. This property, combined with the high specificity one can select for an antibody provides highly specific T cell targeting by CAR T cells.
[0224] As used herein, a CAR T cell or CAR-T refers to a T cell that expresses a CAR. When expressed in a T cell, CARs have the ability to redirect T-cell specificity and reactivity toward a selected target in a non-MHC-restricted manner, exploiting the antigen-binding properties of monoclonal antibodies. The non-MHC-restricted antigen recognition gives T-cells expressing CARs the ability to recognize an antigen independent of antigen processing, thus bypassing a major mechanism of tumor escape.
[0225] As used herein, the term extracellular target binding domain refers to a polypeptide found on the outside of the cell that is sufficient to facilitate binding to a target. The extracellular target binding domain will specifically bind to its binding partner, i.e., the target. As non-limiting examples, the extracellular target-binding domain can include an antigen-binding domain of an antibody or antibody reagent, or a ligand, which recognizes and binds with a cognate binding partner protein. In this context, a ligand is a molecule that binds specifically to a portion of a protein and/or receptor. The cognate binding partner of a ligand useful in the methods and compositions described herein can generally be found on the surface of a cell. Ligand:cognate partner binding can result in the alteration of the ligand-bearing receptor, or activate a physiological response, for example, the activation of a signaling pathway. In one embodiment, the ligand can be non-native to the genome. Optionally, the ligand has a conserved function across at least two species.
[0226] Antibody Reagents
[0227] In various embodiments, the CARs described herein include an antibody reagent or an antigen-binding domain thereof as an extracellular target-binding domain.
[0228] As used herein, the term antibody reagent refers to a polypeptide that includes at least one immunoglobulin variable domain or immunoglobulin variable domain sequence and which specifically binds a given antigen. An antibody reagent can include an antibody or a polypeptide including an antigen-binding domain of an antibody. In some embodiments of any of the aspects, an antibody reagent can include a monoclonal antibody or a polypeptide including an antigen-binding domain of a monoclonal antibody. For example, an antibody can include a heavy (H) chain variable region (abbreviated herein as VH), and a light (L) chain variable region (abbreviated herein as VL). In another example, an antibody includes two heavy (H) chain variable regions and two light (L) chain variable regions. The term antibody reagent encompasses antigen-binding fragments of antibodies (e.g., single chain antibodies, Fab and sFab fragments, F(ab)2, Fd fragments, Fv fragments, scFv, CDRs, and domain antibody (dAb) fragments (see, e.g., de Wildt et al., Eur. J. Immunol. 26(3):629-639, 1996; which is incorporated by reference herein in its entirety)) as well as complete antibodies. An antibody can have the structural features of IgA, IgG, IgE, IgD, or IgM (as well as subtypes and combinations thereof). Antibodies can be from any source, including mouse, rabbit, pig, rat, and primate (human and non-human primate) and primatized antibodies. Antibodies also include midibodies, humanized antibodies, chimeric antibodies, and the like.
[0229] Fully human antibody binding domains can be selected, for example, from phage display libraries using methods known to those of ordinary skill in the art. Furthermore, antibody reagents include single domain antibodies, such as camelid antibodies.
[0230] The VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR). The extent of the framework region and CDRs has been precisely defined (see, Kabat, E. A. et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242, and Chothia et al., J. Mol. Biol. 196:901-917, 1987; each of which is incorporated by reference herein in its entirety). Each VH and VL is typically composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
[0231] In one embodiment, the antibody or antibody reagent is not a human antibody or antibody reagent (i.e., the antibody or antibody reagent is mouse), but has been humanized. A humanized antibody or antibody reagent refers to a non-human antibody or antibody reagent that has been modified at the protein sequence level to increase its similarity to antibody or antibody reagent variants produced naturally in humans. One approach to humanizing antibodies employs the grafting of murine or other non-human CDRs onto human antibody frameworks.
[0232] In one embodiment, the extracellular target binding domain of a CAR includes or consists essentially of a single-chain Fv (scFv) fragment created by fusing the VH and VL domains of an antibody, generally a monoclonal antibody, via a flexible linker peptide. In various embodiments, the scFv is fused to a transmembrane domain and to a T cell receptor intracellular signaling domain, e.g., an engineered intracellular signaling domain as described herein. In another embodiment, the extracellular target binding domain of a CAR includes a camelid antibody.
[0233] Antibody binding domains and ways to select and clone them are well-known to those of ordinary skill in the art. In some embodiments, the antibody reagent is an anti-GARP antibody reagent and includes the sequence of SEQ ID NO: 3 or 25, or includes a sequence with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the sequence of SEQ ID NO: 3 or 25. In further embodiments, the antibody reagent is an anti-GARP antibody reagent and includes the complementarity determining regions (CDRs) of SEQ ID NOs: 81, 82, 83, 84, 85, and/or 86, or includes CDR sequences with at least 1, 2, or 3 amino acid substitutions of SEQ ID NOs: 81, 82, 83, 84, 85, and/or 86. In further embodiments, the anti-GARP antibody reagent includes the variable heavy (VH) and/or variable light (VL) of SEQ ID NOs: 87 and 88, or includes VH and/or VL sequences with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the sequences of SEQ ID NOs: 87 and 88. The VH may be positioned N-terminal to the VL, or the VL may be positioned N-terminal to the VH. In further embodiments, the anti-GARP antibody reagent includes the sequence of SEQ ID NO: 71 or 77, or includes a sequence with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the sequence of SEQ ID NO: 71 or 77.
[0234] In other embodiments, the antibody reagent is an anti-LAP antibody reagent and includes the complementarity determining regions (CDRs) of SEQ ID NOs: 89, 90, 91, 92, 93, and/or 94, or includes CDR sequences with at least 1, 2, or 3 amino acid substitutions of SEQ ID NOs: 89, 90, 91, 92, 93, and/or 94. In further embodiments, the anti-LAP antibody reagent includes the VH and/or VL of SEQ ID NOs: 95 and 96, or includes VH and/or VL sequences with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the sequences of SEQ ID NOs: 87 and 88. The VH may be positioned N-terminal to the VL, or the VL may be positioned N-terminal to the VH. In further embodiments, the antibody reagent is an anti-LAP antibody reagent and includes the sequence of SEQ ID NO: 9 or 15, or includes a sequence with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the sequence of SEQ ID NO: 9 or 15. In other embodiments, the antibody reagent is an anti-EGFR or anti-EGFRvIII antibody reagent and includes the sequence of SEQ ID NO: 21, 27, 33, 36, 42, 45, 55, 57, 65, or 103, or includes a sequence with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the sequence of SEQ ID NO: 21, 27, 33, 36, 42, 45, 55, 57, 65, or 103.
[0235] In particular embodiments, the antibody reagent is an anti-EGFRvIII scFv. For example, the anti-EGFRvIII scFv includes a VH corresponding to the amino acid sequence of SEQ ID NO: 111 or 113; including the amino acid sequence of SEQ ID NO: 111 or 113; or including an amino acid sequence having at least at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the amino acid sequence of SEQ ID NO: 111 or 113. In further embodiments, the anti-EGFRvIII scFV includes a VL corresponding to the amino acid sequence of SEQ ID NO: 112 or 114; including the amino acid sequence of SEQ ID NO: 112 or 114; or including an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the amino acid sequence of SEQ ID NO: 112 or 114. In some embodiments, the anti-EGFRvIII scFv corresponds to the sequence of SEQ ID NO: 27, 36, 45, 57, 65, or 103; includes the sequence of SEQ ID NO: 27, 36, 45, 57, 65, or 103, or includes a sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the sequence of SEQ ID NO: 27, 36, 45, 57, 65, or 103. An immune cell including a CAR polypeptide including an extracellular target binding domain including an anti-EGFRvIII scFv may secrete an anti-EGFR BiTE as described below.
[0236] In other embodiments, the antibody reagent is an anti-CD19 antibody reagent and includes the sequence of SEQ ID NO: 51 or 63, or includes a sequence with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the sequence of SEQ ID NO: 51 or 63.
[0237] In yet other embodiments, the antibody reagent is an anti-CD3 antibody reagent and includes the sequence of SEQ ID NO: 34, 43, 52, 56, or 64, or includes a sequence with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the sequence of SEQ ID NO: 34, 43, 52, 56, or 64. In various examples, the antibody reagent can be selected from C225, 3C10, Cetuximab, and 2173. Any antibody reagent described herein can be useful as an antigen-binding domain of a CAR, or as a therapeutic agent.
[0238] In one embodiment, the CARs useful in the technology described herein include at least two antigen-specific targeting regions, an extracellular domain, a transmembrane domain, and an intracellular signaling domain. In such embodiments, the two or more antigen-specific targeting regions target at least two different antigens and may be arranged in tandem and separated by linker sequences. In another embodiment, the CAR is a bispecific CAR. A bispecific CAR is specific to two different antigens.
[0239] For example, a bispecific CAR can be a tandem CAR that targets IL-13R2 and EGFRvIII. In some embodiments, the IL-13R2 binding sequence includes an anti-IL-13R2 antibody reagent, e.g., an scFv or a single domain antibody (e.g., a camelid). In some embodiments, the IL-13R2 binding sequence may include an IL-13R2 ligand or an antigen-binding fragment thereof, e.g., IL-13 or IL-13 zetakine. In some embodiments, the IL-13 zetakine corresponds to the sequence of SEQ ID NO: 101, or includes the sequence of SEQ ID NO: 101, or includes a sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the sequence of SEQ ID NO: 101. In some embodiments, the EGFRvIII binding site may include an anti-EGFRvIII scFv. In some embodiments, the anti-EGFRvIII scFv includes a VH corresponding to the sequence of SEQ ID NO: 111 or 113, including the amino acid sequence of SEQ ID NO: 111 or 113, or including an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the amino acid sequence of SEQ ID NO: 111 or 113. In some embodiments, the anti-EGFRvIII scFv includes a VL corresponding to the amino acid sequence of SEQ ID NO: 112 or 114, including the amino acid sequence of SEQ ID NO: 112 or 114, or including an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the amino acid sequence of SEQ ID NO: 112 or 114. The VH may be positioned N-terminal to the VL, or the VL may be positioned N-terminal to the VH. In some embodiments, the anti-EGFRvIII scFv corresponds to the sequence of SEQ ID NO: 27, 36, 45, 57, 65, or 103, or includes the sequence of SEQ ID NO: 27, 36, 45, 57, 65, or 103, or includes a sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the sequence of SEQ ID NO: 27, 36, 45, 57, 65, or 103. The IL-13R2 binding sequence may be positioned N-terminal to the EGFRvIII binding sequence, or the EGFRvIII binding sequence may be positioned N-terminal to the IL-13R2. The IL-13R2 binding sequence and EGFRvIII binding sequence may optionally be connected via a linker, e.g., of SEQ ID NO: 102, as well as any other linker described herein or known in the art.
[0240] Target/Antigen Any cell-surface moiety can be targeted by a CAR. Often, the target will be a cell-surface polypeptide that may be differentially or preferentially expressed on a cell that one wishes to target for a T cell response. To target Tregs, antibody reagents can be targeted against, e.g., Glycoprotein A Repetitions Predominant (GARP), latency-associated peptide (LAP), CD25, CTLA-4, ICOS, TNFR2, GITR, OX40, 4-1 BB, and LAG-3. To target tumors or cancer cells, antibody domains can be targeted against, e.g., EGFR or EGFRvIII, as described herein. Targeting tumor antigens or tumor-associated antigens that are specific to the tumors can provide a means to target tumor cells while avoiding or at least limiting collateral damage to non-tumor cells or tissues. Non-limiting examples of additional tumor antigens, tumor-associated antigens, or other antigen of interest include CD19, CD37, BCMA (tumor necrosis factor receptor superfamily member 17 (TNFRSF17); NCBI Gene ID: 608; NCBI Ref Seq: NP_001183.2 and mRNA (e.g., NCBI Ref Seq: NM_001192.2)), CEA, immature laminin receptor, TAG-72, HPV E6 and E7, BING-4, calcium-activated chloride channel 2, cyclin B1, 9D7, Ep-CAM, EphA3, her2/neu, telomerase, mesotheliun, SAP-1, survivin, BAGE family, CAGE family, GAGE family, MAGE family, SAGE family, XAGE family, NY-ESO-1/LAGE-1, PRAME, SSX-2, Melan-A/MART-1, gp100/pme117, tyrosinase, TRP-1/-2, MC1R, BRCA1/2, CDK4, MART-2, p53, Ras, MUC1, TGF-61:111, IL-15, IL13R2, and CSF1R.
[0241] In some embodiments, the target/antigen of the CAR is EGFR, EGFRvIII, CD19, CD79b, CD37, prostate-specific membrane antigen (PSMA), prostate stem cell antigen (PSCA), IL-13R2, EphA1, Her2, mesothelin, MUC1, or MUC16. In other embodiments, the target/antigen of the CAR is LAP or GARP. In further embodiments, the CAR is a bispecific CAR that binds to two of EGFR, EGFRvIII, CD19, CD79b, CD37, PSMA, PSCA, IL-13R2, EphA1, Her2, mesothelin, MUC1, and MUC16.
[0242] Hinge and Transmembrane Domains
[0243] Each CAR as described herein includes a transmembrane domain, e.g., a hinge/transmembrane domain, which joins the extracellular target-binding domain to the intracellular signaling domain.
[0244] The binding domain of the CAR is optionally followed by one or more hinge domains, which plays a role in positioning the antigen binding domain away from the effector cell surface to enable proper cell/cell contact, antigen binding and activation. A CAR optionally includes one or more hinge domains between the binding domain and the transmembrane domain (TM). The hinge domain may be derived either from a natural, synthetic, semi-synthetic, or recombinant source. The hinge domain can include the amino acid sequence of a naturally occurring immunoglobulin hinge region or an altered immunoglobulin hinge region. Illustrative hinge domains suitable for use in the CARs described herein include the hinge region derived from the extracellular regions of type 1 membrane proteins such as CD8 (e.g., CD8), CD4, CD28, 4-1 BB, and CD7, which may be wild-type hinge regions from these molecules or may be altered. In some embodiments, the hinge region is derived from the hinge region of an immunoglobulin-like protein (e.g., IgA, IgD, IgE, IgG, or IgM), CD28, or CD8. In one embodiment, the hinge domain includes a CD8 hinge region.
[0245] As used herein, transmembrane domain (TM domain) refers to the portion of the CAR that fuses the extracellular binding portion, optionally via a hinge domain, to the intracellular portion (e.g., the co-stimulatory domain and intracellular signaling domain) and anchors the CAR to the plasma membrane of the immune effector cell. The transmembrane domain is a generally hydrophobic region of the CAR which crosses the plasma membrane of a cell. The TM domain can be the transmembrane region or fragment thereof of a transmembrane protein (for example a Type I transmembrane protein or other transmembrane protein), an artificial hydrophobic sequence, or a combination thereof. While specific examples are provided herein and used in the Examples, other transmembrane domains will be apparent to those of skill in the art and can be used in connection with alternate embodiments of the technology. A selected transmembrane region or fragment thereof would preferably not interfere with the intended function of the CAR. As used in relation to a transmembrane domain of a protein or polypeptide, fragment thereof refers to a portion of a transmembrane domain that is sufficient to anchor or attach a protein to a cell surface.
[0246] In some examples, the transmembrane domain or fragment thereof of the CAR described herein includes a transmembrane domain selected from the transmembrane domain of an alpha, beta or zeta chain of a T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, KIRDS2, OX40, CD2, CD27, LFA-1 (CD11 a, CD18), ICOS (CD278), 4-1BB (CD137), 4-1BBL, GITR, CD40, BAFFR, HVEM (LIGHTR), SLAMF7, NKp80 (KLRFI), CD160, CD19, IL2R beta, IL2R gamma, IL7R a, ITGA1, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD11d, ITGAE, CD103, ITGAL, CD11 a, LFA-1, ITGAM, CD11 b, ITGAX, CD11 c, ITGB1, CD29, ITGB2, CD18, LFA-1, ITGB7, TNFR2, DNAM1(CD226), SLAMF4 (CD244, 2B4), CD84, CD96 (Tactile), CEACAM1, CRT AM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), SLAMF6 (NTB-A, Lyl08), SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, PAG/Cbp, NKp44, NKp30, NKp46, NKG2D, and/or NKG2C.
[0247] As used herein, a hinge/transmembrane domain refers to a domain including both a hinge domain and a transmembrane domain. For example, a hinge/transmembrane domain can be derived from the hinge/transmembrane domain of CD8, CD28, CD7, or 4-1 BB. In one embodiment, the hinge/transmembrane domain of a CAR or fragment thereof is derived from or includes the hinge/transmembrane domain of CD8 (e.g., any one of SEQ ID NOs: 4, 10, 16, 22, 28, 37, 46, 58, 66, 72, 78, 104, or variants thereof).
[0248] CD8 is an antigen preferentially found on the cell surface of cytotoxic T lymphocytes. CD8 mediates cell-cell interactions within the immune system, and acts as a T cell co-receptor. CD8 consists of an alpha (CD8 or CD8a) and beta (CD8 or CD8b) chain. CD8a sequences are known for a number of species, e.g., human CD8a, (NCBI Gene ID: 925) polypeptide (e.g., NCBI Ref Seq NP_001139345.1) and mRNA (e.g., NCBI Ref Seq NM_000002.12). CD8 can refer to human CD8, including naturally occurring variants, molecules, and alleles thereof. In some embodiments of any of the aspects, e.g., in veterinary applications, CD8 can refer to the CD8 of, e.g., dog, cat, cow, horse, pig, and the like. Homologs and/or orthologs of human CD8 are readily identified for such species by one of skill in the art, e.g., using the NCBI ortholog search function or searching available sequence data for a given species for sequence similar to a reference CD8 sequence.
[0249] In some embodiments, the CD8 hinge and transmembrane sequence corresponds to the amino acid sequence of SEQ ID NO: 4, 10, 16, 22, 28, 37, 46, 58, 66, 72, 78, or 104; or includes the sequence of SEQ ID NO: 4, 10, 16, 22, 28, 37, 46, 58, 66, 72, 78, or 104; or includes a sequence with at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 100% sequence identity to the sequence of SEQ ID NO: 4, 10, 16, 22, 28, 37, 46, 58, 66, 72, 78, or 104.
[0250] Co-Stimulatory Domains
[0251] Each CAR described herein optionally includes the intracellular domain of one or more co-stimulatory molecule or co-stimulatory domain. As used herein, the term co-stimulatory domain refers to an intracellular signaling domain of a co-stimulatory molecule. Co-stimulatory molecules are cell surface molecules other than antigen receptors or Fc receptors that provide a second signal required for efficient activation and function of T lymphocytes upon binding to antigen. The co-stimulatory domain can be, for example, the co-stimulatory domain of 4-1 BB, CD27, CD28, or OX40. In one example, a 4-1 BB intracellular domain (ICD) can be used (see, e.g., below and SEQ ID NOs: 5, 11, 17, 23, 29, 38, 47, 59, 67, 73, 79, 105, or variants thereof). Additional illustrative examples of such co-stimulatory molecules include CARD11, CD2, CD7, CD27, CD28, CD30, CD40, CD54 (ICAM), CD83, CD134 (OX40), CD137 (4-1BB), CD150 (SLAMF1), CD152 (CTLA4), CD223 (LAGS), CD270 (HVEM), CD273 (PD-L2), CD274 (PD-L1), CD278 (ICOS), DAP10, LAT, NKD2C SLP76, TRIM, and ZAP70. In one embodiment, the intracellular domain is the intracellular domain of 4-1 BB. 4-1 BB (CD137; TNFRS9) is an activation-induced costimulatory molecule, and is an important regulator of immune responses.
[0252] 4-1 BB is a membrane receptor protein, also known as CD137, which is a member of the tumor necrosis factor (TNF) receptor superfamily. 4-1 BB is expressed on activated T lymphocytes. 4-1 BB sequences are known for a number of species, e.g., human 4-1 BB, also known as TNFRSF9 (NCBI Gene ID: 3604) and mRNA (NCBI Reference Sequence: NM_001561.5). 4-1 BB can refer to human 4-1 BB, including naturally occurring variants, molecules, and alleles thereof. In some embodiments of any of the aspects, e.g., in veterinary applications, 4-1 BB can refer to the 4-1 BB of, e.g., dog, cat, cow, horse, pig, and the like. Homologs and/or orthologs of human 4-1 BB are readily identified for such species by one of skill in the art, e.g., using the NCBI ortholog search function or searching available sequence data for a given species for sequence similar to a reference 4-1 BB sequence.
[0253] In some embodiments, the intracellular domain is the intracellular domain of a 4-1 BB. In one embodiment, the 4-1 BB intracellular domain corresponds to an amino acid sequence selected from SEQ ID NO: 5, 11, 17, 23, 29, 38, 47, 59, 67, 73, 79, or 105; or includes a sequence selected from SEQ ID NO: 5, 11, 17, 23, 29, 38, 47, 59, 67, 73, 79, or 105; or includes at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 100% sequence identity to a sequence selected from SEQ ID NO: 5, 11, 17, 23, 29, 38, 47, 59, 67, 73, 79, or 105.
[0254] Intracellular Signaling Domains
[0255] CARs as described herein include an intracellular signaling domain. An intracellular signaling domain, refers to the part of a CAR polypeptide that participates in transducing the message of effective CAR binding to a target antigen into the interior of the immune effector cell to elicit effector cell function, e.g., activation, cytokine production, proliferation and cytotoxic activity, including the release of cytotoxic factors to the CAR-bound target cell, or other cellular responses elicited following antigen binding to the extracellular CAR domain. In various examples, the intracellular signaling domain is from CD3 (see, e.g., below). Additional non-limiting examples of immunoreceptor tyrosine-based activation motif (ITAM)-containing intracellular signaling domains that are of particular use in the technology include those derived from TCR, FcR, FcR, CD3, CD3, CD3, CD3, CD3, CD3, CD22, CD79a, CD79b, and CD66d.
[0256] CD3 is a T cell co-receptor that facilitates T lymphocyte activation when simultaneously engaged with the appropriate co-stimulation (e.g., binding of a co-stimulatory molecule). A CD3 complex consists of 4 distinct chains; mammalian CD3 consists of a CD3 chain, a CD3chain, and two CD3 chains. These chains associate with a molecule known as the T cell receptor (TCR) and the CD3 to generate an activation signal in T lymphocytes. A complete TCR complex includes a TCR, CD3, and the complete CD3 complex.
[0257] In some embodiments of any aspect, a CAR polypeptide described herein includes an intracellular signaling domain that includes an Immunoreceptor Tyrosine-based Activation Motif or ITAM from CD3 zeta (CD3), including variants of CD3 such as ITAM-mutated CD3, CD3, or CD3. In some embodiments of any aspect, the ITAM includes three motifs of ITAM of CD3 (ITAM3). In some embodiments of any aspect, the three motifs of ITAM of CD3 are not mutated and, therefore, include native or wild-type sequences. In some embodiments, the CD3 sequence includes the sequence of a CD3 as set forth in the sequences provided herein, e.g., a CD3 sequence of one of SEQ ID NOs: 6, 12, 18, 24, 30, 39, 48, 60, 68, 74, 80, 106, or variants thereof.
[0258] For example, a CAR polypeptide described herein includes the intracellular signaling domain of CD3. In one embodiment, the CD3 intracellular signaling domain corresponds to an amino acid sequence selected from SEQ ID NO: 6, 12, 18, 24, 30, 39, 48, 60, 68, 74, 80, or 106; or includes a sequence selected from SEQ ID NO: 6, 12, 18, 24, 30, 39, 48, 60, 68, 74, 80, or 106; or includes a sequence with at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 100% sequence identity to a sequence selected from SEQ ID NO: 6, 12, 18, 24, 30, 39, 48, 60, 68, 74, 80, or 106.
[0259] Individual CAR and other construct components as described herein can be used with one another and swapped in and out of various constructs described herein, as can be determined by those of skill in the art. Each of these components can include or consist of any of the corresponding sequences set forth herein, or variants thereof.
[0260] A more detailed description of CARs and CAR T cells can be found in Maus et al., Blood 123:2624-2635, 2014; Reardon et al., Neuro-Oncology 16:1441-1458, 2014; Hoyos et al., Haematologica 97:1622, 2012; Byrd et al., J. Clin. Oncol. 32:3039-3047, 2014; Maher et al., Cancer Res 69:4559-4562, 2009; and Tamada et al., Clin. Cancer Res. 18:6436-6445, 2012; each of which is incorporated by reference herein in its entirety.
[0261] In some embodiments, a CAR polypeptide as described herein includes a signal peptide. Signal peptides can be derived from any protein that has an extracellular domain or is secreted. A CAR polypeptide as described herein may include any signal peptides known in the art. In some embodiments, the CAR polypeptide includes a CD8 signal peptide, e.g., a CD8 signal peptide corresponding to the amino acid sequence of SEQ ID NO: 2, 8, 14, 20, 70, or 76, or including the amino acid sequence of SEQ ID NO: 2, 8, 14, 20, 70, or 76, or including an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 100% sequence identity to the sequence of SEQ ID NO: 2, 8, 14, 20, 70, or 76.
[0262] In further embodiments, a CAR polypeptide described herein may optionally exclude one of the signal peptides described herein, e.g., a CD8 signal peptide of SEQ ID NO: 2, 8, 14, 20, 70, or 76 or an Ig signal peptide of SEQ ID NO: 32, 41, 50, 54, or 62.
[0263] In one embodiment, the CAR further includes a linker domain. As used herein, linker domain refers to an oligo- or polypeptide region from about 2 to 100 amino acids in length, which links together any of the domains/regions of the CAR as described herein. In some embodiment, linkers can include or be composed of flexible residues such as glycine and serine so that the adjacent protein domains are free to move relative to one another. Linker sequences useful for the invention can be from 2 to 100 amino acids, 5 to 50 amino acids, 10 to 15 amino acids, 15 to 20 amino acids, or 18 to 20 amino acids in length, and include any suitable linkers known in the art. For instance, linker sequences useful for the invention include, but are not limited to, glycine/serine linkers, e.g., GGGSGGGSGGGS (SEQ ID NO: 107) and Gly4Ser (G4S) linkers such as (G4S)3 (GGGGSGGGGSGGGGS (SEQ ID NO: 108)) and (G4S)4 (GGGGSGGGGSGGGGSGGGGS (SEQ ID NO: 102)); the linker sequence of GSTSGSGKPGSGEGSTKG (SEQ ID NO: 109) as described by Whitlow et al., Protein Eng. 6(8):989-95, 1993, the contents of which are incorporated herein by reference in its entirety; the linker sequence of GGSSRSSSSGGGGSGGGG (SEQ ID NO: 110) as described by Andris-Widhopf et al., Cold Spring Harb. Protoc. 2011(9), 2011, the contents of which are incorporated herein by reference in its entirety; as well as linker sequences with added functionalities, e.g., an epitope tag or an encoding sequence containing Cre-Lox recombination site as described by Sblattero et al., Nat. Biotechnol. 18(1):75-80, 2000, the contents of which are incorporated herein by reference in its entirety. Longer linkers may be used when it is desirable to ensure that two adjacent domains do not sterically interfere with one another.
[0264] Furthermore, linkers may be cleavable or non-cleavable. Examples of cleavable linkers include 2A linkers (e.g., P2A and T2A), 2A-like linkers or functional equivalents thereof and combinations thereof. For example, a P2A linker sequence can correspond to the amino acid sequence of SEQ ID NO: 31, 40, or 49. In various examples, linkers having sequences as set forth herein, or variants thereof, are used. It is to be understood that the indication of a particular linker in a construct in a particular location does not mean that only that linker can be used there. Rather, different linker sequences (e.g., P2A and T2A) can be swapped with one another (e.g., in the context of the constructs of the present invention), as can be determined by those of skill in the art. In one embodiment, the linker region is T2A derived from Thosea asigna virus. Non-limiting examples of linkers that can be used in this technology include T2A, P2A, E2A, BmCPV2A, and BmIFV2A. Linkers such as these can be used in the context of polyproteins, such as those described below. For example, they can be used to separate a CAR component of a polyprotein from a therapeutic agent (e.g., an antibody, such as a scFv, single domain antibody (e.g., a camelid antibody), or a bispecific antibody (e.g., a BiTE)) component of a polyprotein (see below).
[0265] In some embodiments, a CAR as described herein optionally further includes a reporter molecule, e.g., to permit for non-invasive imaging (e.g., positron-emission tomography PET scan). In a bispecific CAR that includes a reporter molecule, the first extracellular binding domain and the second extracellular binding domain can include different or the same reporter molecule. In a bispecific CAR T cell, the first CAR and the second CAR can express different or the same reporter molecule. In another embodiment, a CAR as described herein further includes a reporter molecule (for example hygromycin phosphotransferase (hph)) that can be imaged alone or in combination with a substrate or chemical (for example 9-[4-[.sup.18F]fluoro-3-(hydroxymethyl)butyl]guanine ([.sup.18F]FHBG)). In another embodiment, a CAR as described herein further includes nanoparticles at can be readily imaged using non-invasive techniques (e.g., gold nanoparticles (GNP) functionalized with .sup.64Cu.sup.2+). Labeling of CAR T cells for non-invasive imaging is reviewed, for example in Bhatnagar et al., Integr. Biol. (Camb). 5(1):231-238, 2013, and Keu et al., Sci. Transl. Med. 18; 9(373), 2017, which are incorporated herein by reference in their entireties.
[0266] GFP and mCherry are demonstrated herein as fluorescent tags useful for imaging a CAR expressed on a T cell (e.g., a CAR T cell). It is expected that essentially any fluorescent protein known in the art can be used as a fluorescent tag for this purpose. For clinical applications, the CAR need not include a fluorescent tag or fluorescent protein. In each instance of particular constructs provided herein, therefore, any markers present in the constructs can be removed. The invention includes the constructs with or without the markers. Accordingly, when a specific construct is referenced herein, it can be considered with or without any markers or tags (including, e.g., histidine tags, such as the histidine tag of HHHHHH (SEQ ID NO: 97)) as being included within the invention.
[0267] In some embodiments, the CAR polypeptide sequence corresponds to, includes, or includes a sequence with at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or greater sequence identity of a sequence selected from SEQ ID NOs: 1, 7, 13, 69, 75, 100, 115, 116, or 117, optionally excluding a CD8 signal peptide as described herein, or the combination of SEQ ID NOs: 21-24, 27-30, 36-39, 45-48, 57-60, 65-68, 71-74, 77-80, or 101-106. As can be determined by those of skill in the art, various functionally similar or equivalent components of these CARs can be swapped or substituted with one another, as well as other similar or functionally equivalent components known in the art or listed herein.
Therapeutic Agents Delivered by CAR T Cells
[0268] As noted above, the CAR T cells of the invention can optionally be used to deliver therapeutic agents, e.g., antibody reagents or other therapeutic molecules, such as cytokines, to tumors (i.e., to the tumor microenvironment). In various embodiments, the therapeutic agent is encoded by the same nucleic acid molecule as the CAR, thus facilitating transduction of cells (e.g., T cells) to express both a CAR and a therapeutic agent, e.g., an antibody reagent or cytokine. In such examples, the therapeutic agent (e.g., an antibody reagent or cytokine) can be expressed, e.g., such that it is separated from the CAR (and optionally other proteins, e.g., markers) by cleavable linker sequences (e.g., a 2A linker, such as, e.g., P2A or T2A; see above). The therapeutic agent (e.g., an antibody reagent or cytokine) can be expressed under the control of the same promoter as the CAR (e.g., by an EF1 promoter), and can be constitutively expressed. In other examples, the therapeutic agent (e.g., an antibody reagent or cytokine) is expressed under the control of an inducible promoter, e.g., a promoter that is expressed upon T cell activation (e.g., an NFAT promoter). Such an inducible promoter can be used, e.g., to ensure that the antibody is expressed only upon T cell activation, and thus only, e.g., when the CAR T cell is within the tumor microenvironment, to which locale it may be advantageous to have antibody production limited. As is understood in the art, the CAR coding sequences can be 5 or 3 to the therapeutic agent (e.g., an antibody reagent or cytokine) coding sequences in various vector designs within the invention. In some embodiments, the therapeutic agent includes an Ig signal peptide, e.g., an Ig signal peptide corresponding to the amino acid sequence of SEQ ID NO: 32, 41, 50, 54, or 62, or including the amino acid sequence of SEQ ID NO: 32, 41, 50, 54, or 62, or including an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 100% sequence identity to the sequence of SEQ ID NO: 32, 41, 50, 54, or 62.
[0269] In various examples, the therapeutic agent is an antibody reagent. The antibody reagent expressed within a CAR T cell (e.g., from the same nucleic acid molecule as the CAR) can be a single chain antibody (e.g., an scFv) or a single domain antibody (e.g., a camelid) as described herein. In the case of single chain antibodies, the light (L) and heavy (H) chains may be in the order (N-terminal to C-terminal) L-H or H-L, and optionally may be separated from one another by a linker (e.g., a glycine-based linker). In further examples, the antibody reagent is a bispecific antibody including, e.g., bispecific T cell engagers (BiTEs), described below.
[0270] Antibody reagents can be targeted against, e.g., tumor antigens, such as EGFR, EGFRvIII, CD19, IL-15, IL13R2, CSF1R. For example, the antibody reagent is an anti-EGFR or anti-EGFRvIII antibody reagent and includes the sequence of SEQ ID NO: 21, 27, 33, 36, 42, 45, 55, 57, or 65, or includes a sequence with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the sequence of SEQ ID NO: 21, 27, 33, 36, 42, 45, 55, 57, or 65. In another example, the antibody reagent is an anti-CD19 antibody reagent and includes the sequence of SEQ ID NO: 51 or 63, or includes a sequence with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the sequence of SEQ ID NO: 51 or 63. In another example, the antibody reagent is an anti-CD3 antibody reagent and includes the sequence of SEQ ID NO: 34, 43, 52, 56, or 64, or includes a sequence with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the sequence of SEQ ID NO: 34, 43, 52, 56, or 64. In various other examples, the antibody reagent can include C225, 3C10, Cetuximab, or 2173, or an antigen-binding fragment thereof.
[0271] In other examples, antibody reagents can be targeted against, e.g., Treg antigens, such as CTLA-4, CD25, GARP, LAP. For example, the antibody reagent is an anti-GARP antibody reagent and includes the sequence of SEQ ID NO: 3 or 25, or includes a sequence with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the sequence of SEQ ID NO: 3 or 25. In further embodiments, the antibody reagent is an anti-GARP antibody reagent and includes the complementarity determining regions (CDRs) of SEQ ID NOs: 81, 82, 83, 84, 85, and/or 86, or includes CDR sequences with at least 1, 2, or 3 amino acid substitutions of SEQ ID NOs: 81, 82, 83, 84, 85, and/or 86. In further embodiments, the anti-GARP antibody reagent includes the VH and/or VL of SEQ ID NOs: 87 and 88, or includes VH and/or VL sequences with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the sequences of SEQ ID NOs: 87 and 88. The VH may be positioned N-terminal to the VL, or the VL may be positioned N-terminal to the VH. In further embodiments, the anti-GARP antibody reagent includes the sequence of SEQ ID NO: 71 or 77, or includes a sequence with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the sequence of SEQ ID NO: 71 or 77. In another example, the antibody reagent is an anti-LAP antibody reagent and includes the complementarity determining regions (CDRs) of SEQ ID NOs: 89, 90, 91, 92, 93, and/or 94, or includes CDR sequences with at least 1, 2, or 3 amino acid substitutions of SEQ ID NOs: 89, 90, 91, 92, 93, and/or 94. In some embodiments, the anti-LAP antibody reagent includes the VH and/or VL of SEQ ID NOs: 95 and 96, or includes VH and/or VL sequences with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the sequences of SEQ ID NOs: 87 and 88. The VH may be positioned N-terminal to the VL, or the VL may be positioned N-terminal to the VH. In further embodiments, the antibody reagent is an anti-LAP antibody reagent and includes the sequence of SEQ ID NO: 9 or 15, or includes a sequence with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the sequence of SEQ ID NO: 9 or 15. In a further example, the antibody reagent can include daclizumab or an antigen-binding fragment thereof.
[0272] Antibody reagents can also be targeted against any other antigens described herein or known in the art. In addition to optionally delivering antibody reagents, as described herein, the CAR T cells of the invention can be used to deliver other therapeutic agents including, but not limited to, cytokines and toxins.
[0273] Bispecific T Cell Engagers (BiTEs)
[0274] In some embodiments, the therapeutic agent delivered by a CAR T cell as described herein is a bispecific T cell engager (BiTE). Such molecules can target T cells by binding to a T cell antigen (e.g., by binding CD3) as well as a target antigen, e.g., a tumor antigen. Exemplary tumor antigens include EGFR, EGFRvIII, CD19, CD79b, CD37, PSMA, PSCA, IL-13R2, EphA1, Her2, mesothelin, MUC1, or MUC16 (also see above). The BiTEs can be used to augment the T cell response in, e.g., the tumor microenvironment. The two components of a BiTE can optionally be separated from one another by a linker as described herein (e.g., a glycine-based linker), and may also be connected in either orientation, e.g., with the anti-CD3 component N-terminal to the anti-target antigen component, or vice versa. The anti-CD3 component or the anti-target antigen component of the BiTE may include any of the antibody reagents described herein.
[0275] The CAR T cell secreted BiTEs may, e.g., stimulate the CAR T cell itself, or operate in a paracrine fashion by redirecting nonspecific bystander T cells against tumors and therefore enhance the anti-tumor effects of CAR T cell immunotherapy. CAR T cell-mediated BiTE secretion may allow for the reduction of risk of undesired BiTE activity in systemic tissues by directing BiTE secretion to the tumor microenvironment. Exemplary BiTE constructs are provided below; however, BiTEs other than those described herein may also be useful for the invention.
[0276] An exemplary BiTE useful for the invention described herein includes, e.g., an anti-EGFR BiTE including an anti-EGFR scFv and an anti-CD3 scFv (also referred to herein as BiTE-EGFR). The anti-EGFR scFv may be arranged in the VH-VL orientation, or in the VL-VH orientation. In particular embodiments, the anti-EGFR scFv corresponds to the amino acid sequence of SEQ ID NO: 33, 42, or 55, or includes the amino acid sequence of SEQ ID NO: 33, 42, or 55, or includes an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the amino acid sequence of SEQ ID NO: 33, 42, or 55.
[0277] Another exemplary BiTE is an anti-CD19 BiTE including an anti-CD19 scFv and an anti-CD3 scFv (also referred to herein as BiTE-CD19). The anti-CD19 scFv may be arranged in the VH-VL orientation, or in the VL-VH orientation. In certain embodiments, the anti-CD19 scFv corresponds to the amino acid sequence of SEQ ID NO: 51 or 63, or includes the amino acid sequence of SEQ ID NO: 51 or 63, or includes an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the amino acid sequence of SEQ ID NO: 51 or 63.
[0278] In some embodiments, the anti-CD3 scFv of any of the BiTEs described herein may be arranged in the VH-VL orientation, or in the VL-VH orientation, and may optionally corresponds to the amino acid sequence of SEQ ID NO: 34, 43, 52, 56, or 64, or include the amino acid sequence of SEQ ID NO: 34, 43, 52, 56, or 64, or include an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the amino acid sequence of SEQ ID NO: 34, 43, 52, 56, or 64.
[0279] An anti-EGFR BiTE as described herein can correspond to the amino acid sequence of SEQ ID NO: 98, or include the amino acid sequence of SEQ ID NO: 98, or include an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the amino acid sequence of SEQ ID NO: 98. An anti-CD19 BiTE as described herein can correspond to the amino acid sequence of SEQ ID NO: 99, or include the amino acid sequence of SEQ ID NO: 99, or include an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the amino acid sequence of SEQ ID NO: 99.
[0280] Optionally, the BiTE may include a signal peptide described herein, such as an IgK signal peptide, e.g., an IgK signal peptide corresponding to the amino acid sequence of SEQ ID NO: 32, 41, 50, 54, or 62, or including the amino acid sequence of SEQ ID NO: 32, 41, 50, 54, or 62, or including an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 100% sequence identity to the sequence of SEQ ID NO: 32, 41, 50, 54, or 62.
[0281] In some embodiments, the CAR T cell includes a polyprotein including a CAR and a therapeutic agent and/or a nucleic acid encoding the polyprotein. In certain embodiments, the polyprotein sequence, including a CAR and a therapeutic agent, corresponds to, includes, or includes a sequence with at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or greater sequence identity of a sequence selected from SEQ ID NOs: 19, 26, 35, 44, 53, and 61.
[0282] Other components of CARs and related constructs (or variants thereof), as described herein, such as an Ig signal sequence (e.g., SEQ ID NO: 32, 41, 50, 54, 62, or variants thereof), a CD8 signal sequence (e.g., SEQ ID NO: 2, 8, 14, 20, 70, 76, or variants thereof), and related sequences, can be selected for use in making constructs of the invention, as will be apparent to those of skill in the art.
Nucleic Acids Encoding CARs
[0283] Also provided are nucleic acid constructs and vectors encoding (i) a CAR polypeptide (e.g., of SEQ ID NO: 1, 7, 13, 69, 75, or 100) or (ii) a polyprotein including a CAR polypeptide and a therapeutic agent (e.g., of SEQ ID NO: 19, 26, 35, 44, 53, or 61) described herein for use in generating CAR T cells. In various examples, the invention provides constructs that each include separate coding sequences for multiple proteins to be expressed in a CAR T cell of the invention. These separate coding sequences can be separated from one another by a cleavable linker sequence as described herein. For example, sequences encoding viral 2A proteins (e.g., T2A and P2A) can be placed between the separate genes and, when transcribed, can direct cleavage of the generated polyprotein. As noted above, constructs and vectors of the invention can include any of a number of different combinations of sequences. For example, a construct or vector of the invention can include sequences encoding one a CAR as described herein, optionally in combination with a therapeutic agent (e.g., an antibody reagent (e.g., a single chain antibody, a single domain antibody (e.g., a camelid), or a bispecific antibody (e.g., a BiTE)) or a cytokine) as described herein.
[0284] Efficient expression of proteins in CAR T cells as described herein can be assessed using standard assays that detect the mRNA, DNA, or gene product of the nucleic acid encoding the proteins. For example, RT-PCR, FACS, northern blotting, western blotting, ELISA, or immunohistochemistry can be used. The proteins described herein can be constitutively expressed or inducibly expressed. In some examples, the proteins are encoded by a recombinant nucleic acid sequence. For example, the invention provides a vector that includes a first polynucleotide sequence encoding a CAR, wherein the CAR includes an extracellular domain including an antigen-binding sequence that binds to, e.g., a tumor antigen or a Treg-associated antigen, and, optionally, a second polynucleotide sequence encoding a therapeutic agent (e.g., an antibody reagent (e.g., a single chain antibody, a single domain antibody (e.g., a camelid), or a bispecific antibody (e.g., a BiTE)) or a cytokine).
[0285] In some embodiments, the first polynucleotide sequence and the second polynucleotide sequence are each operably linked to a promoter. In some embodiments, the first polynucleotide sequence is operably linked to a first promoter and the second polynucleotide sequence is operably linked to a second promoter. The promoter can be a constitutively expressed promoter (e.g., an EF1 promoter) or an inducibly expressed promoter (e.g., a NFAT promoter).
[0286] In some embodiments, expression of the CAR and therapeutic agent are driven by the same promoter, e.g., a constitutively expressed promoter (e.g., an EF1 promoter). In other embodiments, expression of the CAR and therapeutic agent are driven by different promoters. For instance, expression of the CAR can be driven by a constitutively expressed promoter (e.g., an EF1 promoter) while expression of the therapeutic agent can be driven by an inducibly expressed promoter (e.g., a NFAT promoter). The polynucleotide sequence encoding the CAR can be located upstream of the polynucleotide sequence encoding the therapeutic agent, or the polynucleotide sequence encoding the therapeutic agent can be located upstream the polynucleotide sequence encoding the CAR.
[0287] Furthermore, the polynucleotides of the invention can include the expression of a suicide gene. This can be done to facilitate external, drug-mediated control of administered cells. For example, by use of a suicide gene, modified cells can be depleted from the patient in case of, e.g., an adverse event. In one example, the FK506 binding domain is fused to the caspase9 pro-apoptotic molecule. T cells engineered in this manner are rendered sensitive to the immunosuppressive drug tacrolimus. Other examples of suicide genes are thymidine kinase (TK), CD20, thymidylate kinase, truncated prostate-specific membrane antigen (PSMA), truncated low affinity nerve growth factor receptor (LNGFR), truncated CD19, and modified Fas, which can be triggered for conditional ablation by the administration of specific molecules (e.g., ganciclovir to TK+ cells) or antibodies or antibody-drug conjugates.
[0288] Constructs including sequences encoding proteins for expression in the CAR T cells of the invention can be included within vectors. In various examples, the vectors are retroviral vectors. Retroviruses, such as lentiviruses, provide a convenient platform for delivery of nucleic acid sequences encoding a gene, or chimeric gene of interest. A selected nucleic acid sequence can be inserted into a vector and packaged in retroviral particles using techniques known in the art. The recombinant virus can then be isolated and delivered to cells, e.g., in vitro or ex vivo. Retroviral systems are well known in the art and are described in, for example, U.S. Pat. No. 5,219,740; Kurth and Bannert (2010) Retroviruses: Molecular Biology, Genomics and Pathogenesis Calster Academic Press (ISBN:978-1-90455-55-4); and Hu and Pathak Pharmacological Reviews 2000 52:493-512; which are incorporated by reference herein in their entirety. Lentiviral system for efficient DNA delivery can be purchased from OriGene; Rockville, Md. In various embodiments, the protein is expressed in the T cell by transfection or electroporation of an expression vector including nucleic acid encoding the protein using vectors and methods that are known in the art. In some embodiments, the vector is a viral vector or a non-viral vector. In some embodiments, the viral vector is a retroviral vector (e.g., a lentiviral vector), an adenovirus vector, or an adeno-associated virus vector.
[0289] The invention also provides a composition that includes a vector that includes a first polynucleotide sequence encoding a CAR, wherein the CAR includes an extracellular domain including a sequence that specifically binds to a tumor antigen or a Treg-associated antigen, and, optionally, a second polynucleotide sequence encoding a therapeutic agent. In certain embodiments, when the therapeutic agent is an antibody reagent (e.g., a single chain antibody, a single domain antibody (e.g., a camelid), or a bispecific antibody (e.g., a BiTE)), the antibody reagent specifically binds to a tumor antigen or a Treg-associated antigen.
Cells and Therapy
[0290] One aspect of the technology described herein relates to a mammalian cell including any of the CAR polypeptides described herein (optionally together with another therapeutic agent (e.g., an antibody reagent (e.g., a scFv, a camelid antibody, or a BiTE) or a cytokine)); or a nucleic acid encoding any of the CAR polypeptides described herein (optionally together with another therapeutic agent (e.g., an antibody reagent (e.g., a scFv, a camelid antibody, or a cytokine)). In one embodiment, the mammalian cell includes an antibody, antibody reagent, antigen-binding portion thereof, any of the CARs described herein, or a cytokine, or a nucleic acid encoding such an antibody, antibody reagent, antigen-binding portion thereof, any of the CARs described herein, or a cytokine. The mammalian cell or tissue can be of human, primate, hamster, rabbit, rodent, cow, pig, sheep, horse, goat, dog or cat origin, but any other mammalian cell may be used. In a preferred embodiment of any aspect, the mammalian cell is human.
[0291] In some embodiments of any aspect, the mammalian cell is an immune cell. As used herein, immune cell refers to a cell that plays a role in the immune response. Immune cells are of hematopoietic origin, and include lymphocytes, such as B cells and T cells; natural killer cells; myeloid cells, such as monocytes, macrophages, eosinophils, mast cells, basophils, and granulocytes. In some embodiments, the immune cell is a T cell; a NK cell; a NKT cell; lymphocytes, such as B cells and T cells; and myeloid cells, such as monocytes, macrophages, eosinophils, mast cells, basophils, and granulocytes. In one embodiment, the immune cell is a T cell.
[0292] In other embodiments, the immune cell is obtained from an individual having or diagnosed as having cancer, a plasma cell disorder, or autoimmune disease.
[0293] Cluster of differentiation (CD) molecules are cell surface markers present on leukocytes. As a leukocyte differentiates and matures its CD profile changes. In the case that a leukocytes turns into a cancer cell (i.e., a lymphoma), its CD profile is important in diagnosing the disease. The treatment and prognosis of certain types of cancers is reliant on determining the CD profile of the cancer cell. CDX+, wherein X is a CD marker, indicates the CD marker is present in the cancer cell, while CDX indicates the marker is not present. One skilled in the art will be capable of assessing the CD molecules present on a cancer cell using standard techniques, for example, using immunofluorescence to detect commercially available antibodies bound to the CD molecules.
[0294] In some embodiments, the immune cells (e.g., T cells) including a CAR, such as a CART.BiTE described herein, can be used to treat cancer, e.g., lymphoma, myeloma, or a solid tumor, e.g., glioblastoma, prostate cancer, lung cancer, or pancreatic cancer. In some embodiments, the CART.BiTEs described herein, e.g., a CART-EGFRvIII.BiTE-EGFR, can be used to treat a glioblastoma having reduced EGFRvIII expression.
[0295] In further embodiments, the immune cells (e.g., T cells) including a CAR, such as a CART.BiTE described herein, can be used to prevent or reduce immunosuppression due to, e.g., Tregs, in the tumor microenvironment. Furthermore, such CART.BiTEs are useful for preventing or reducing T cell exhaustion in the tumor microenvironment.
[0296] The immune cells (e.g., T cells) including a CAR, such as a CART.BiTE described herein, can also be used to treat a cancer having heterogeneous antigen expression. For instance, the CAR component of the CART.BiTE construct can include an extracellular target binding domain that binds to one antigen expressed by the cancer, while the BiTE component of the CART.BiTE construct can bind a second antigen expressed by the cancer in addition to a T cell antigen (e.g., CD3).
[0297] Cancer as used herein can refer to a hyperproliferation of cells whose unique trait, loss of normal cellular control, results in unregulated growth, lack of differentiation, local tissue invasion, and metastasis. Exemplary cancers include, but are not limited to, glioblastoma, prostate cancer, glioma, leukemia, lymphoma, multiple myeloma, or a solid tumor, e.g., lung cancer and pancreatic cancer. Non-limiting examples of leukemia include acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL), and chronic lymphocytic leukemia (CLL). In one embodiment, the cancer is ALL or CLL. Non-limiting examples of lymphoma include diffuse large B-cell lymphoma (DLBCL), follicular lymphoma, small lymphocytic lymphoma (SLL), mantle cell lymphoma (MCL), marginal zone lymphomas, Burkitt's lymphoma, hairy cell leukemia (HCL), and T cell lymphoma (e.g., peripheral T cell lymphoma (PTCL), including cutaneous T cell lymphoma (CTCL) and anaplastic large cell lymphoma (ALCL)). In one embodiment, the cancer is DLBCL or follicular lymphoma. Non-limiting examples of solid tumors include adrenocortical tumor, alveolar soft part sarcoma, carcinoma, chondrosarcoma, colorectal carcinoma, desmoid tumors, desmoplastic small round cell tumor, endocrine tumors, endodermal sinus tumor, epithelioid hemangioendothelioma, Ewing sarcoma, germ cell tumors (solid tumor), giant cell tumor of bone and soft tissue, hepatoblastoma, hepatocellular carcinoma, melanoma, nephroma, neuroblastoma, non-rhabdomyosarcoma soft tissue sarcoma (NRSTS), osteosarcoma, paraspinal sarcoma, renal cell carcinoma, retinoblastoma, rhabdomyosarcoma, synovial sarcoma, and Wilms tumor. Solid tumors can be found in bones, muscles, or organs, and can be sarcomas or carcinomas. It is contemplated that any aspect of the technology described herein can be used to treat all types of cancers, including cancers not listed in the instant application. As used herein, the term tumor refers to an abnormal growth of cells or tissues, e.g., of malignant type or benign type.
[0298] As used herein, an autoimmune disease or disorder is characterized by the inability of one's immune system to distinguish between a foreign cell and a healthy cell. This results in one's immune system targeting one's healthy cells for programmed cell death. Non-limiting examples of an autoimmune disease or disorder include inflammatory arthritis, type 1 diabetes mellitus, multiples sclerosis, psoriasis, inflammatory bowel diseases, SLE, and vasculitis, allergic inflammation, such as allergic asthma, atopic dermatitis, and contact hypersensitivity. Other examples of auto-immune-related disease or disorder, but should not be construed to be limited to, include rheumatoid arthritis, multiple sclerosis (MS), systemic lupus erythematosus, Graves' disease (overactive thyroid), Hashimoto's thyroiditis (underactive thyroid), celiac disease, Crohn's disease and ulcerative colitis, Guillain-Barre syndrome, primary biliary sclerosis/cirrhosis, sclerosing cholangitis, autoimmune hepatitis, Raynaud's phenomenon, scleroderma, Sjogren's syndrome, Goodpasture's syndrome, Wegener's granulomatosis, polymyalgia rheumatica, temporal arteritis/giant cell arteritis, chronic fatigue syndrome CFS), psoriasis, autoimmune Addison's Disease, ankylosing spondylitis, acute disseminated encephalomyelitis, antiphospholipid antibody syndrome, aplastic anemia, idiopathic thrombocytopenic purpura, myasthenia gravis, opsoclonus myoclonus syndrome, optic neuritis, Ord's thyroiditis, pemphigus, pernicious anaemia, polyarthritis in dogs, Reiter's syndrome, Takayasu's arteritis, warm autoimmune hemolytic anemia, Wegener's granulomatosis and fibromyalgia (FM).
[0299] In one embodiment, the mammalian cell is obtained for a patient having an immune system disorder that results in abnormally low activity of the immune system, or immune deficiency disorders, which hinders one's ability to fight a foreign agent (e.g., a virus or bacterial cell).
[0300] A plasma cell is a white blood cell produces from B lymphocytes which function to generate and release antibodies needed to fight infections. As used herein, a plasma cell disorder or disease is characterized by abnormal multiplication of a plasma cell. Abnormal plasma cells are capable of crowding out healthy plasma cells, which results in a decreased capacity to fight a foreign object, such as a virus or bacterial cell. Non-limiting examples of plasma cell disorders include amyloidosis, Waldenstrom's macroglobulinemia, osteosclerotic myeloma (POEMS syndrome), monoclonal gammopathy of unknown significance (MGUS), and plasma cell myeloma.
[0301] A mammalian cell, e.g., a T cell, can be engineered to include any of the CAR polypeptides described herein (including CAR polypeptides that are cleavably linked to antibody reagents or cytokines, as described herein); or a nucleic acid encoding any of the CAR polypeptides (and optionally also a genetically encoded antibody reagent or cytokine) described herein. T cells can be obtained from a subject using standard techniques known in the field. For example, T cells can be isolated from peripheral blood taken from a donor or patient. T cells can be isolated from a mammal. Preferably, T cells are isolated from a human.
[0302] In some embodiments of any aspect, any of the CAR polypeptides (optionally together with an antibody reagent as described herein or a cytokine) described herein are expressed from a lentiviral vector. The lentiviral vector is used to express the CAR polypeptide (and optionally also the antibody reagent or cytokine) in a cell using infection standard techniques.
[0303] Retroviruses, such as lentiviruses, provide a convenient platform for delivery of nucleic acid sequences encoding a gene or chimeric gene of interest. A selected nucleic acid sequence can be inserted into a vector and packaged in retroviral particles using techniques known in the art. The recombinant virus can then be isolated and delivered to cells, e.g., in vitro or ex vivo. Retroviral systems are well known in the art and are described in, for example, U.S. Pat. No. 5,219,740; Kurth and Bannert (2010) Retroviruses: Molecular Biology, Genomics and Pathogenesis Calster Academic Press (ISBN:978-1-90455-55-4); and Hu et al., Pharmacological Reviews 52:493-512, 2000; which are each incorporated by reference herein in their entirety. Lentiviral system for efficient DNA delivery can be purchased from OriGene; Rockville, Md. In some embodiments, the CAR polypeptide (and optionally the antibody reagent or cytokine) of any of the CARs described herein is expressed in a mammalian cell via transfection or electroporation of an expression vector including a nucleic acid encoding the CAR. Transfection or electroporation methods are known in the art.
[0304] Efficient expression of the CAR polypeptide (and optionally the antibody reagent or cytokine) of any of the polypeptides described herein can be assessed using standard assays that detect the mRNA, DNA, or gene product of the nucleic acid encoding the CAR (and optional antibody reagent or cytokine), such as RT-PCR, FACS, northern blotting, western blotting, ELISA, or immunohistochemistry.
[0305] In some embodiments, the CAR polypeptide (and optional antibody reagent or cytokine) described herein is constitutively expressed. In other embodiments, the CAR polypeptide is constitutively expressed and the optional antibody reagent or cytokine is inducibly expressed. In some embodiments, the CAR polypeptide (and optional antibody reagent or cytokine) described herein is encoded by recombinant nucleic acid sequence.
[0306] One aspect of the technology described herein relates to a method of treating cancer, a plasma cell disorder, or an autoimmune disease in a subject in need thereof, the method including: engineering a T cell to include any of the CAR polypeptides (and optional antibody reagents or cytokines) described herein on the T cell surface; and administering the engineered T cell to the subject. In the case of cancer, the method can be for treating diagnosed cancer, preventing recurrence of cancer, or for use in an adjuvant or neoadjuvant setting.
[0307] One aspect of the technology described herein relates to a method of treating cancer, a plasma cell disorder, or an autoimmune disease in a subject in need thereof, the method including: administering the cell of any of the mammalian cells including the any of the CAR polypeptides (and optional antibody reagents or cytokines) described herein.
[0308] In some embodiments of any of aspect, the engineered CAR-T cell is stimulated and/or activated prior to administration to the subject.
Administration
[0309] In some embodiments, the methods described herein relate to treating a subject having or diagnosed as having cancer, a plasma cell disease or disorder, or an autoimmune disease or disorder with a mammalian cell including any of the CAR polypeptides (and optional antibody reagents or cytokines) described herein, or a nucleic acid encoding any of the CAR polypeptides (and optional antibody reagents or cytokines) described herein. The CAR T cells described herein include mammalian cells including any of the CAR polypeptides (and optional antibody reagents or cytokines) described herein, or a nucleic acid encoding any of the CAR polypeptides (and optional antibody reagents or cytokines) described herein. As used herein, a condition refers to a cancer, a plasma cell disease or disorder, or an autoimmune disease or disorder. Subjects having a condition can be identified by a physician using current methods of diagnosing the condition. Symptoms and/or complications of the condition, which characterize these conditions and aid in diagnosis are well known in the art and include but are not limited to, fatigue, persistent infections, and persistent bleeding. Tests that may aid in a diagnosis of, e.g., the condition, but are not limited to, blood screening and bone marrow testing, and are known in the art for a given condition. A family history for a condition, or exposure to risk factors for a condition can also aid in determining if a subject is likely to have the condition or in making a diagnosis of the condition.
[0310] The compositions described herein can be administered to a subject having or diagnosed as having a condition. In some embodiments, the methods described herein include administering an effective amount of activated CAR T cells described herein to a subject in order to alleviate a symptom of the condition. As used herein, alleviating a symptom of the condition is ameliorating any condition or symptom associated with the condition. As compared with an equivalent untreated control, such reduction is by at least 5%, 10%, 20%, 40%, 50%, 60%, 80%, 90%, 95%, 99% or more as measured by any standard technique. A variety of means for administering the compositions described herein to subjects are known to those of skill in the art. In one embodiment, the compositions described herein are administered systemically or locally. In a preferred embodiment, the compositions described herein are administered intravenously. In another embodiment, the compositions described herein are administered at the site of a tumor.
[0311] The term effective amount as used herein refers to the amount of activated CAR T cells needed to alleviate at least one or more symptom of the disease or disorder, and relates to a sufficient amount of the cell preparation or composition to provide the desired effect. The term therapeutically effective amount therefore refers to an amount of activated CAR T cells that is sufficient to provide a particular anti-condition effect when administered to a typical subject. An effective amount as used herein, in various contexts, would also include an amount sufficient to delay the development of a symptom of the disease, alter the course of a symptom disease (for example but not limited to, slowing the progression of a condition), or reverse a symptom of the condition. Thus, it is not generally practicable to specify an exact effective amount. However, for any given case, an appropriate effective amount can be determined by one of ordinary skill in the art using only routine experimentation.
[0312] Effective amounts, toxicity, and therapeutic efficacy can be evaluated by standard pharmaceutical procedures in cell cultures or experimental animals. The dosage can vary depending upon the dosage form employed and the route of administration utilized. The dose ratio between toxic and therapeutic effects is the therapeutic index and can be expressed as the ratio LD50/ED50. Compositions and methods that exhibit large therapeutic indices are preferred. A therapeutically effective dose can be estimated initially from cell culture assays. Also, a dose can be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 (i.e., the concentration of activated CAR T cells, which achieves a half-maximal inhibition of symptoms) as determined in cell culture, or in an appropriate animal model. Levels in plasma can be measured, for example, by high performance liquid chromatography. The effects of any particular dosage can be monitored by a suitable bioassay, e.g., assay for bone marrow testing, among others. The dosage can be determined by a physician and adjusted, as necessary, to suit observed effects of the treatment.
[0313] In one aspect of the technology, the technology described herein relates to a pharmaceutical composition including activated CAR T cells as described herein, and optionally a pharmaceutically acceptable carrier. The active ingredients of the pharmaceutical composition at a minimum include activated CAR T cells as described herein. In some embodiments, the active ingredients of the pharmaceutical composition consist essentially of activated CAR T cells as described herein. In some embodiments, the active ingredients of the pharmaceutical composition consist of activated CAR T cells as described herein. Pharmaceutically acceptable carriers for cell-based therapeutic formulation include saline and aqueous buffer solutions, Ringer's solution, and serum component, such as serum albumin, HDL and LDL. The terms such as excipient, carrier, pharmaceutically acceptable carrier or the like are used interchangeably herein.
[0314] In some embodiments, the pharmaceutical composition including activated CAR T cells as described herein can be a parenteral dose form. Since administration of parenteral dosage forms typically bypasses the patient's natural defenses against contaminants, the components apart from the CAR T cells themselves are preferably sterile or capable of being sterilized prior to administration to a patient. Examples of parenteral dosage forms include, but are not limited to, solutions ready for injection, dry products ready to be dissolved or suspended in a pharmaceutically acceptable vehicle for injection, suspensions ready for injection, and emulsions. Any of these can be added to the activated CAR T cells preparation prior to administration.
[0315] Suitable vehicles that can be used to provide parenteral dosage forms of activated CAR T cells as disclosed within are well known to those skilled in the art. Examples include, without limitation: saline solution; glucose solution; aqueous vehicles including but not limited to, sodium chloride injection, Ringer's injection, dextrose injection, dextrose and sodium chloride injection, and lactated Ringer's injection; water-miscible vehicles such as, but not limited to, ethyl alcohol, polyethylene glycol, and propylene glycol; and non-aqueous vehicles such as, but not limited to, corn oil, cottonseed oil, peanut oil, sesame oil, ethyl oleate, isopropyl myristate, and benzyl benzoate.
Dosage
[0316] Unit dosage form as the term is used herein refers to a dosage for suitable one administration. By way of example, a unit dosage form can be an amount of therapeutic disposed in a delivery device, e.g., a syringe or intravenous drip bag. In one embodiment, a unit dosage form is administered in a single administration. In another, embodiment more than one unit dosage form can be administered simultaneously.
[0317] In some embodiments, the activated CAR T cells described herein are administered as a monotherapy, i.e., another treatment for the condition is not concurrently administered to the subject. A pharmaceutical composition including the T cells described herein can generally be administered at a dosage of 10.sup.4 to 10.sup.9 cells/kg body weight, in some instances 10.sup.5 to 10.sup.6 cells/kg body weight, including all integer values within those ranges. If necessary, T cell compositions can also be administered multiple times at these dosages. The cells can be administered by using infusion techniques that are commonly known in immunotherapy (see, e.g., Rosenberg et al., New Eng. J. Med. 319:1676, 1988).
[0318] In certain aspects, it may be desired to administer activated CAR T cells to a subject and then subsequently redraw blood (or have an apheresis performed), activate T cells therefrom as described herein, and reinfuse the patient with these activated and expanded T cells. This process can be carried out multiple times every few weeks. In certain aspects, T cells can be activated from blood draws of from 10 cc to 400 cc. In certain aspects, T cells are activated from blood draws of 20 cc, 30 cc, 40 cc, 50 cc, 60 cc, 70 cc, 80 cc, 90 cc, or 100 cc.
[0319] Modes of administration can include, for example intravenous (i.v.) injection or infusion. The compositions described herein can be administered to a patient transarterially, intratumorally, intranodally, or intramedullary. In some embodiments, the compositions of T cells may be injected directly into a tumor, lymph node, or site of infection. In one embodiment, the compositions described herein are administered into a body cavity or body fluid (e.g., ascites, pleural fluid, peritoneal fluid, or cerebrospinal fluid).
[0320] In a particular exemplary aspect, subjects may undergo leukapheresis, wherein leukocytes are collected, enriched, or depleted ex vivo to select and/or isolate the cells of interest, e.g., T cells. These T cell isolates can be expanded by contact with an artificial APC, e.g., an aAPC expressing anti-CD28 and anti-CD3 CDRs, and treated such that one or more CAR constructs of the technology may be introduced, thereby creating a CAR T cell. Subjects in need thereof can subsequently undergo standard treatment with high dose chemotherapy followed by peripheral blood stem cell transplantation. Following or concurrent with the transplant, subjects can receive an infusion of the expanded CAR T cells. In one embodiment, expanded cells are administered before or following surgery.
[0321] In some embodiments, lymphodepletion is performed on a subject prior to administering one or more CAR T cell as described herein. In such embodiments, the lymphodepletion can include administering one or more of melphalan, cytoxan, cyclophosphamide, and fludarabine.
[0322] The dosage of the above treatments to be administered to a patient will vary with the precise nature of the condition being treated and the recipient of the treatment. The scaling of dosages for human administration can be performed according to art-accepted practices.
[0323] In some embodiments, a single treatment regimen is required. In others, administration of one or more subsequent doses or treatment regimens can be performed. For example, after treatment biweekly for three months, treatment can be repeated once per month, for six months or a year or longer. In some embodiments, no additional treatments are administered following the initial treatment.
[0324] The dosage of a composition as described herein can be determined by a physician and adjusted, as necessary, to suit observed effects of the treatment. With respect to duration and frequency of treatment, it is typical for skilled clinicians to monitor subjects in order to determine when the treatment is providing therapeutic benefit, and to determine whether to administer further cells, discontinue treatment, resume treatment, or make other alterations to the treatment regimen. The dosage should not be so large as to cause adverse side effects, such as cytokine release syndrome. Generally, the dosage will vary with the age, condition, and sex of the patient and can be determined by one of skill in the art. The dosage can also be adjusted by the individual physician in the event of any complication.
Combination Therapy
[0325] The activated CAR T cells described herein can optionally be used in combination with each other and with other known agents and therapies, as can determined to be appropriate by those of skill in the art. In one example, two or more CAR T cells targeting different Treg markers (e.g., GARP, LAP, etc.) can be administered in combination. In another example, two or more CAR T cells targeting different cancer antigens are administered in combination. In a further example, one or more CAR T cell targeting a Treg marker (e.g., GARP, LAP, etc.) and one or more CAR T cell targeting one or more tumor antigens are administered in combination.
[0326] Administered in combination, as used herein, means that two (or more) different treatments are delivered to the subject during the course of the subject's affliction with the disorder, e.g., the two or more treatments are delivered after the subject has been diagnosed with the disorder and before the disorder has been cured or eliminated or treatment has ceased for other reasons. In some embodiments, the delivery of one treatment is still occurring when the delivery of the second begins, so that there is overlap in terms of administration. This is sometimes referred to herein as simultaneous or concurrent delivery. In other embodiments, the delivery of one treatment ends before the delivery of the other treatment begins. In some embodiments of either case, the treatment is more effective because of combined administration. For example, the second treatment is more effective, e.g., an equivalent effect is seen with less of the second treatment, or the second treatment reduces symptoms to a greater extent, than would be seen if the second treatment were administered in the absence of the first treatment, or the analogous situation is seen with the first treatment. In some embodiments, delivery is such that the reduction in a symptom, or other parameter related to the disorder is greater than what would be observed with one treatment delivered in the absence of the other. The effect of the two treatments can be partially additive, wholly additive, or greater than additive. The delivery can be such that an effect of the first treatment delivered is still detectable when the second is delivered. The activated CAR T cells described herein and the at least one additional therapeutic agent can be administered simultaneously, in the same or in separate compositions, or sequentially. For sequential administration, the CAR-expressing cell described herein can be administered first, and the additional agent can be administered second, or the order of administration can be reversed. The CAR T therapy and/or other therapeutic agents, procedures or modalities can be administered during periods of active disorder, or during a period of remission or less active disease. The CAR T therapy can be administered before another treatment, concurrently with the treatment, post-treatment, or during remission of the disorder.
[0327] When administered in combination, the activated CAR T cells and the additional agent (e.g., second or third agent), or all, can be administered in an amount or dose that is higher, lower or the same as the amount or dosage of each agent used individually, e.g., as a monotherapy. In certain embodiments, the administered amount or dosage of the activated CAR T cells, the additional agent (e.g., second or third agent), or all, is lower (e.g., at least 20%, at least 30%, at least 40%, or at least 50%) than the amount or dosage of each agent used individually. In other embodiments, the amount or dosage of the activated CAR T cells, the additional agent (e.g., second or third agent), or all, that results in a desired effect (e.g., treatment of cancer) is lower (e.g., at least 20%, at least 30%, at least 40%, or at least 50% lower) than the amount or dosage of each agent individually required to achieve the same therapeutic effect. In further embodiments, the activated CAR T cells described herein can be used in a treatment regimen in combination with surgery, chemotherapy, radiation, an mTOR pathway inhibitor, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other immunoablative agents such as CAMPATH, anti-CD3 antibodies or other antibody therapies, cytoxin, fludarabine, rapamycin, mycophenolic acid, steroids, FR901228, cytokines, or a peptide vaccine, such as that described in Izumoto et al., J. Neurosurg. 108:963-971, 2008.
[0328] In one embodiment, the activated CAR T cells described herein can be used in combination with a checkpoint inhibitor. Exemplary checkpoint inhibitors include anti-PD-1 inhibitors (Nivolumab, MK-3475, Pembrolizumab, Pidilizumab, AMP-224, AMP-514), anti-CTLA4 inhibitors (Ipilimumab and Tremelimumab), anti-PDL1 inhibitors (Atezolizumab, Avelomab, MSB0010718C, MED14736, and MPDL3280A), and anti-TIM3 inhibitors.
[0329] In one embodiment, the activated CAR T cells described herein can be used in combination with a chemotherapeutic agent. Exemplary chemotherapeutic agents include an anthracycline (e.g., doxorubicin (e.g., liposomal doxorubicin)), a vinca alkaloid (e.g., vinblastine, vincristine, vindesine, vinorelbine), an alkylating agent (e.g., cyclophosphamide, decarbazine, melphalan, ifosfamide, temozolomide), an immune cell antibody (e.g., alemtuzamab, gemtuzumab, rituximab, tositumomab), an antimetabolite (including, e.g., folic acid antagonists, pyrimidine analogs, purine analogs and adenosine deaminase inhibitors (e.g., fludarabine)), an mTOR inhibitor, a TNFR glucocorticoid induced TNFR related protein (GITR) agonist, a proteasome inhibitor (e.g., aclacinomycin A, gliotoxin or bortezomib), an immunomodulator such as thalidomide or a thalidomide derivative (e.g., lenalidomide). General chemotherapeutic agents considered for use in combination therapies include anastrozole (Arimidex), bicalutamide (Casodex), bleomycin sulfate (Blenoxane), busulfan (Myleran), busulfan injection (Busulfex), capecitabine (Xeloda), N4-pentoxycarbonyl-5-deoxy-5-fluorocytidine, carboplatin (Paraplatin), carmustine (BiCNU), chlorambucil (Leukeran), cisplatin (Platinol), cladribine (Leustatin), cyclophosphamide (Cytoxan or Neosar), cytarabine, cytosine arabinoside (Cytosar-U), cytarabine liposome injection (DepoCyt), dacarbazine (DTIC-Dome), dactinomycin (Actinomycin D, Cosmegan), daunorubicin hydrochloride (Cerubidine), daunorubicin citrate liposome injection (DaunoXome), dexamethasone, docetaxel (Taxotere), doxorubicin hydrochloride (Adriamycin, Rubex), etoposide (Vepesid), fludarabine phosphate (Fludara), 5-fluorouracil (Adrucil, Efudex), flutamide (Eulexin), tezacitibine, Gemcitabine (difluorodeoxycitidine), hydroxyurea (Hydrea), Idarubicin (Idamycin), ifosfamide (IFEX), irinotecan (Camptosar), L-asparaginase (ELSPAR), leucovorin calcium, melphalan (Alkeran), 6-mercaptopurine (Purinethol), methotrexate (Folex), mitoxantrone (Novantrone), mylotarg, paclitaxel (Taxol), phoenix (Yttrium90/MX-DTPA), pentostatin, polifeprosan 20 with carmustine implant (Gliadel), tamoxifen citrate (Nolvadex), teniposide (Vumon), 6-thioguanine, thiotepa, tirapazamine (Tirazone), topotecan hydrochloride for injection (Hycamptin), vinblastine (Velban), vincristine (Oncovin), and vinorelbine (Navelbine). Exemplary alkylating agents include, without limitation, nitrogen mustards, ethylenimine derivatives, alkyl sulfonates, nitrosoureas and triazenes): uracil mustard (Aminouracil Mustard, Chlorethaminacil, Demethyldopan, Desmethyldopan, Haemanthamine, Nordopan, Uracil nitrogen mustard, Uracillost, Uracilmostaza, Uramustin, Uramustine), chlormethine (Mustargen), cyclophosphamide (Cytoxan, Neosar, Clafen, Endoxan, Procytox, Revimmune), ifosfamide (Mitoxana), melphalan (Alkeran), Chlorambucil (Leukeran), pipobroman (Amedel, Vercyte), triethylenemelamine (Hemel, Hexalen, Hexastat), triethylenethiophosphoramine, Temozolomide (Temodar), thiotepa (Thioplex), busulfan (Busilvex, Myleran), carmustine (BiCNU), lomustine (CeeNU), streptozocin (Zanosar), and Dacarbazine (DTIC-Dome). Additional exemplary alkylating agents include, without limitation, Oxaliplatin (Eloxatin); Temozolomide (Temodar and Temodal); Dactinomycin (also known as actinomycin-D, Cosmegen); Melphalan (also known as L-PAM, L-sarcolysin, and phenylalanine mustard, Alkeran); Altretamine (also known as hexamethylmelamine (HMM), Hexalen); Carmustine (BiCNU); Bendamustine (Treanda); Busulfan (Busulfex and Myleran); Carboplatin (Paraplatin); Lomustine (also known as CCNU, CeeNU); Cisplatin (also known as CDDP, Platinol and Platinol-AQ); Chlorambucil (Leukeran); Cyclophosphamide (Cytoxan and Neosar); Dacarbazine (also known as DTIC, DIC and imidazole carboxamide, DTIC-Dome); Altretamine (also known as hexamethylmelamine (HMM), Hexalen); Ifosfamide (Ifex); Prednumustine; Procarbazine (Matulane); Mechlorethamine (also known as nitrogen mustard, mustine and mechloroethamine hydrochloride, Mustargen); Streptozocin (Zanosar); Thiotepa (also known as thiophosphoamide, TESPA and TSPA, Thioplex); Cyclophosphamide (Endoxan, Cytoxan, Neosar, Procytox, Revimmune); and Bendamustine HC1 (Treanda). Exemplary mTOR inhibitors include, e.g., temsirolimus; ridaforolimus (formally known as deferolimus, (IR,2R,45)-4-[(2R)-2 [1R,95,125,15R,16E,18R,19R,21R,235,24E,26E,28Z,305,325,35R)-I,18-dihydroxy-19,30-dimethoxy-15,17,21,23, 29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.049] hexatriaconta-16,24,26,28-tetraen-12-yl]propyl]-2-methoxycyclohexyl dimethylphosphinate, also known as AP23573 and MK8669, and described in PCT Publication No. WO 03/064383); everolimus (Afinitor or RADOOI); rapamycin (AY22989, Sirolimus); simapimod (CAS 164301-51-3); emsirolimus, (5-{2,4-Bis[(35,)-3-methylmorpholin-4-yl]pyrido[2,3-(i]pyrimidin-7-yl}-2-methoxyphenyl)methanol (AZD8055); 2-Amino-8-[iraw5,-4-(2-hydroxyethoxy)cyclohexyl]-6-(6-methoxy-3-pyridinyl)-4-methyl-pyrido[2,3-JJpyrimidin-7(8H)-one (PF04691502, CAS 1013101-36-4); and N2-[1,4-dioxo-4-[[4-(4-oxo-8-phenyl-4H-I-benzopyran-2-yl)morpholinium-4-yl]methoxy]butyl]L-arginylglycyl-L-a-aspartylL-serine-, inner salt (SF1126, CAS 936487-67-1), and XL765. Exemplary immunomodulators include, e.g., afutuzumab (available from Roche); pegfilgrastim (Neulasta); lenalidomide (CC-5013, Revlimid); thalidomide (Thalomid), actimid (CC4047); and IRX-2 (mixture of human cytokines including interleukin 1, interleukin 2, and interferon , CAS 951209-71-5, available from IRX Therapeutics). Exemplary anthracyclines include, e.g., doxorubicin (Adriamycin and Rubex); bleomycin (Ienoxane); daunorubicin (dauorubicin hydrochloride, daunomycin, and rubidomycin hydrochloride, Cerubidine); daunorubicin liposomal (daunorubicin citrate liposome, DaunoXome); mitoxantrone (DHAD, Novantrone); epirubicin (Ellence); idarubicin (Idamycin, Idamycin PFS); mitomycin C (Mutamycin); geldanamycin; herbimycin; ravidomycin; and desacetylravidomycin. Exemplary vinca alkaloids include, e.g., vinorelbine tartrate (Navelbine), Vincristine (Oncovin), and Vindesine (Eldisine)); vinblastine (also known as vinblastine sulfate, vincaleukoblastine and VLB, Alkaban-AQ and Velban); and vinorelbine (Navelbine). Exemplary proteosome inhibitors include bortezomib (Velcade); carfilzomib (PX-171-007, (5)-4-Methyl-N-((5)-1-(((5)-4-methyl-1-((R)-2-methyloxiran-2-yl)-1-oxopentan-2-yl)amino)-I-oxo-3-phenylpropan-2-yl)-2-((5,)-2-(2-morpholinoacetamido)-4-phenylbutanamido)-pentanamide); marizomib (NPT0052); ixazomib citrate (MLN-9708); delanzomib (CEP-18770); and O-Methyl-N-[(2-methyl-5-thiazolyl)carbonyl]-L-seryl-O-methyl-N-[(IIS)-2-[(2R)-2-methyl-2-oxiranyl]-2-oxo-1-(phenylmethyl)ethyl]-L-serinamide (ONX-0912).
[0330] One of skill in the art can readily identify a chemotherapeutic agent of use (e.g., see Physicians' Cancer Chemotherapy Drug Manual 2014, Edward Chu, Vincent T. DeVita Jr., Jones & Bartlett Learning; Principles of Cancer Therapy, Chapter 85 in Harrison's Principles of Internal Medicine, 18th edition; Therapeutic Targeting of Cancer Cells: Era of Molecularly Targeted Agents and Cancer Pharmacology, Chapters 28-29 in Abeloff's Clinical Oncology, 2013 Elsevier; and Fischer D. S. (ed.): The Cancer Chemotherapy Handbook, 4th ed. St. Louis, Mosby-Year Book, 2003).
[0331] In an embodiment, activated CAR T cells described herein are administered to a subject in combination with a molecule that decreases the level and/or activity of a molecule targeting GITR and/or modulating GITR functions, a molecule that decreases the Treg cell population, an mTOR inhibitor, a GITR agonist, a kinase inhibitor, a non-receptor tyrosine kinase inhibitor, a CDK4 inhibitor, and/or a BTK inhibitor.
Efficacy
[0332] The efficacy of activated CAR T cells in, e.g., the treatment of a condition described herein, or to induce a response as described herein (e.g., a reduction in cancer cells) can be determined by the skilled clinician. However, a treatment is considered effective treatment, as the term is used herein, if one or more of the signs or symptoms of a condition described herein is altered in a beneficial manner, other clinically accepted symptoms are improved, or even ameliorated, or a desired response is induced, e.g., by at least 10% following treatment according to the methods described herein. Efficacy can be assessed, for example, by measuring a marker, indicator, symptom, and/or the incidence of a condition treated according to the methods described herein or any other measurable parameter appropriate. Treatment according to the methods described herein can reduce levels of a marker or symptom of a condition, e.g. by at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80% or at least 90% or more.
Efficacy can also be measured by a failure of an individual to worsen as assessed by hospitalization, or need for medical interventions (i.e., progression of the disease is halted). Methods of measuring these indicators are known to those of skill in the art and/or are described herein.
Treatment includes any treatment of a disease in an individual or an animal (some non-limiting examples include a human or an animal) and includes: (1) inhibiting the disease, e.g., preventing a worsening of symptoms (e.g., pain or inflammation); or (2) relieving the severity of the disease, e.g., causing regression of symptoms. An effective amount for the treatment of a disease means that amount which, when administered to a subject in need thereof, is sufficient to result in effective treatment as that term is defined herein, for that disease. Efficacy of an agent can be determined by assessing physical indicators of a condition or desired response. It is well within the ability of one skilled in the art to monitor efficacy of administration and/or treatment by measuring any one of such parameters, or any combination of parameters. Efficacy of a given approach can be assessed in animal models of a condition described herein. When using an experimental animal model, efficacy of treatment is evidenced when a statistically significant change in a marker is observed.
[0333] All patents and other publications; including literature references, issued patents, published patent applications, and co-pending patent applications; cited throughout this application are expressly incorporated herein by reference for the purpose of describing and disclosing, for example, the methodologies described in such publications that might be used in connection with the technology described herein. These publications are provided solely for their disclosure prior to the filing date of the present application. Nothing in this regard should be construed as an admission that the inventors are not entitled to antedate such disclosure by virtue of prior technology or for any other reason. All statements as to the date or representation as to the contents of these documents is based on the information available to the applicants and does not constitute any admission as to the correctness of the dates or contents of these documents.
[0334] The description of embodiments of the disclosure is not intended to be exhaustive or to limit the disclosure to the precise form disclosed. While specific embodiments of, and examples for, the disclosure are described herein for illustrative purposes, various equivalent modifications are possible within the scope of the disclosure, as those skilled in the relevant art will recognize. For example, while method steps or functions are presented in a given order, alternative embodiments may perform functions in a different order, or functions may be performed substantially concurrently. The teachings of the disclosure provided herein can be applied to other procedures or methods as appropriate. The various embodiments described herein can be combined to provide further embodiments. Aspects of the disclosure can be modified, if necessary, to employ the compositions, functions and concepts of the above references and application to provide yet further embodiments of the disclosure. Moreover, due to biological functional equivalency considerations, some changes can be made in protein structure without affecting the biological or chemical action in kind or amount. These and other changes can be made to the disclosure in light of the detailed description. All such modifications are intended to be included within the scope of the appended claims.
[0335] Specific elements of any of the foregoing embodiments can be combined or substituted for elements in other embodiments. Furthermore, while advantages associated with certain embodiments of the disclosure have been described in the context of these embodiments, other embodiments may also exhibit such advantages, and not all embodiments need necessarily exhibit such advantages to fall within the scope of the disclosure.
[0336] The technology described herein is further illustrated by the following examples, which in no way should be construed as being further limiting.
EXAMPLES
[0337] The following are examples of the methods and compositions of the invention. It is understood that various other embodiments may be practiced, given the general description provided above.
Example 1. CAR T Cell Mediated Secretion of Toxic Drugs to Modify the Tumor Microenvironment and Enhance CAR T Cell Potency
[0338] CAR-modified T cells can be used to deliver otherwise toxic antibodies to the tumor microenvironment. In this example, T cells are genetically modified to secrete an antibody or cytokine with the goal of modifying the inhibitory immune cell milieu of the tumor microenvironment.
[0339] Specifically, CAR T cells directed to an antigen that is heterogeneously expressed can have their potency enhanced by enabling activation of surrounding tumor infiltrating lymphocytes in the tumor microenvironment. Specific, non-limiting examples, include:
[0340] (1) genetically-encoded anti-CTLA4 CAR-T cell mediated secretion. Anti-CTLA4 checkpoint blockade can cause toxicity when delivered systemically. However, localized secretion of anti-CTLA4 is expected to provide checkpoint blockade and deplete regulatory T cells in the tumor microenvironment.
[0341] (2) genetically-encoded anti-CD25 (e.g., daclizumab) to deplete Tregs in the local tumor microenvironment. CAR T cells have been shown to traffic to tumors despite hostile environment and the blood brain barrier. New T cell immigrants also infiltrate tumors, but these are hypothesized to be inhibited by checkpoints and activation of Tregs. Localized secretion of anti-CD25 is expected to deplete Tregs. However, daclizumab given pharmacologically is toxic when administered systemically.
[0342] (3) genetically-encoded anti-EGFR (e.g., cetuximab). CAR T cells directed to a safe but heterogeneously expressed antigen (e.g., EGFRvIII) do not completely eliminate tumor if the antigen is heterogeneously expressed. However, other antigens may be expressed at high levels in the tumor microenvironment (e.g., EGFR). EGFR is expressed only in brain tumors within the brain, but it is expressed in many other epithelial tissues, which makes it an unsafe target for CAR T cells. However, CAR T cells directed to EGFRvIII could be engineered to secrete anti-EGFR such that only tissues in the tumor microenvironment where CAR T cells traffic to are exposed to high levels of anti-EGFR. In the case of anti-EGFR, the antibody is not expected to be severely toxic, given that it is used systemically in other cancers, such as head and neck cancer and colon cancer. However, it does not penetrate the CNS, and so is not efficacious in brain tumors. Genetically-encoded anti-EGFR in the form of a CAR T cell directed to the CNS has the capacity to use the T cells as the vehicle for localized delivery of anti-EGFR to the CNS and brain tumors, such as glioblastoma.
[0343] Thus, provided is genetically-encoded Treg depletion in the tumor microenvironment with two different formats. In addition, genetically-encoded delivery of antibodies that cannot get into certain tissues, and could enhance the potency of T cell therapies by broadening the specificity of the anti-tumor target. Accordingly, described is gene-modified T cell therapy for cancer.
Example 2. Engineered CAR T Cells Overcome Tumor Heterogeneity and Immunosuppression in Glioblastoma
Materials and Methods
[0344] T cells from leukapheresis products obtained from deidentified healthy donors were stimulated with Dynabeads Human T-Activator CD3/CD28 at a bead to cell ratio of 3:1 and cultured in complete RPMI 1640 medium. 10 days following stimulation and lentivirus transduction, cells were frozen and stored for use in functional assays. The ability of CAR T cells to kill target cells was tested in a 20-hour luciferase-based assay. Treg suppression was visualized by IncuCyte live cell analysis.
[0345] For in vivo experiments, tumor cells were collected in logarithmic growth phase, washed and loaded into a 50 microliter Hamilton syringe. The needle was positioned using a stereotactic frame at 2 mm to the right of the bregma and 4 mm below the surface of the skull at the coronal suture. For treatment, mice were infused once with CAR T cells (110.sup.6 CAR-transduced T cells per mouse) via tail vein.
Results
[0346] EGFRvIII CAR T Cells Mediate Antitumor Activity In Vitro.
[0347] An EGFRvIII CAR was designed and synthesized, which was used with initial tests in vitro. In vitro characterization of this CAR demonstrates that the EGFRvIII CAR mediates significant and specific cytotoxicity against the human glioma U87vIII cell line (
[0348] EGFRvIII CAR T cells mediate antitumor activity against EGFRvIII expressing tumors in the brain.
[0349] In a murine model of intracranial human glioma, EGFRvIII CART cells slowed the growth of tumors and led to prolonged survival (
[0350] CAR T Cell Activity is Suppressed by Regulatory T Cells.
[0351] In coculture experiments with CAR T cells and target glioma cell lines, the presence of regulatory T cells was noted to abrogate antitumor activity of CAR T cells in vitro.
[0352] Anti-LAP CAR T Cells Kill Regulatory T Cells In Vitro.
[0353] As shown in
[0354] Based on these data, novel CAR constructs targeting surface markers found on Tregs were developed. The overall design of these CAR T cells is depicted in
[0355] Conclusion
[0356] The ultimate goal is to design, test, and improve CAR T cell therapy in preclinical murine models of human GBM. It has been demonstrated herein that CAR T cells can indeed mediate specific and potent effects against even bulky, established tumors in vivo. Additionally, it is shown that regulatory T cells may play a critical role in the suppression of these immune responses. New techniques that target Tregs may offer a way to modulate the local immune environment in order to enhance antitumor efficacy.
Example 3. EGFRvIII-Targeted CAR T Cells
[0357] CAR T cells having an EGFRvIII antigen-binding moiety (e.g., CART-EGFRvIII cells) represent a promising cellular therapy for specific targeting of cytolytic cells to the tumor microenvironment, in part because EGFRvIII is specifically expressed on tumor tissue while generally absent from healthy tissue. In this example, CART-EGFRvIII cells were tested in vitro and in vivo in two animal models.
[0358] T cells from leukapheresis products obtained from deidentified healthy donors were stimulated with Dynabeads (Human T-Activator CD3/CD28) at a bead to cell ratio of 3:1 and cultured in complete RPMI 1640 medium. Ten days following stimulation and lentivirus transduction, cells were frozen and stored for use in functional assays.
[0359] Initial tests were performed in vitro to characterize the ability of CAR-EGFRvIII cells to preferentially kill tumor cells relative to untransduced control cells in a twenty-hour luciferase-based assay, shown in
[0360] For in vivo experiments, U87vIII tumor cells were collected in logarithmic growth phase, washed, and administered to mice subcutaneously in a xenograft model of human glioblastoma (
[0361] The potent antitumor effect observed in vitro was mirrored in the in vivo subcutaneous xenograft model of human glioblastoma (
[0362] The presence of regulatory T cells (Tregs) was observed in human patient tumor tissues after treatment with CART-EGFRvIII cells (
Example 4. Design and Characterization of CAR T Cells Targeted to Treg-Associated Antigens
[0363]
[0364] Next, CAR constructs encoding CARs targeting LAP and GARP were designed. Schematic illustrations of these constructs are shown in
TABLE-US-00001 TABLE 1 Transduction efficiencies of Treg-targeted CAR constructs CAR construct ND47 ND48 ND50 Construct 1 CAR-GARP 68.0% 81.0% 72.8% (SEQ ID NO: 1) Construct 2 CAR-LAP-H-L 57.1% 79.5% 80.4% (SEQ ID NO: 7) Construct 3 CAR-LAP-L-H 72.2% 88.2% 90.1% (SEQ ID NO: 13) Construct 4 CAR-EGFR-GARP N/A N/A 51.2% (SEQ ID NO: 19)
[0365] To test anti-LAP CART cells, CAR T cells were co-cultured with isolated Tregs expanded from the same donor and transduced to express GFP as a Treg marker. Tregs were activated overnight with anti-CD3 and anti-CD28 (
[0366] To further characterize the effect of antigen expression on function of LAP- and GARP-targeted CAR T cells, immortalized cell lines were screened for LAP and GARP antigen-expression, and the cytotoxic effect by each CAR T cell was assessed. First, HUT78 cells, a cutaneous human CD4 T cell lymphocyte-derived cell line that expresses IL-2, was stained for GARP and LAP (
[0367] Next, secretion of anti-GARP camelid antibodies by CART-EGFR-GARP cells was characterized by western blot (
Example 5. Design and Characterization of BiTE-Secreting CAR T Cells
[0368] Another mechanism provided herein to enhance efficacy of CAR T cell activity within tumor microenvironments (e.g., to overcome immune regulation by Tregs) is through a CAR T cell that secretes an immune-modulating antibody, such as a BiTE. Without wishing to be bound by theory, the present inventors have discovered that expression of an immune-modulating antibody (e.g., a BiTE) from a construct that also encodes a CAR can further amplify antitumor effects.
[0369] One exemplary nucleic acid construct, CAR-EGFR-BiTE-(EGFR-CD3), shown schematically in
[0370] BiTE secretion by CART-EGFR-BiTE-(EGFR-CD3) cells was confirmed by isolating supernatant from cultures containing SupT1 cells transduced with CAR-EGFR-BiTE-(EGFR-CD3), calculating the concentration of BiTE in the supernatant based on OD450, and performing western blot analysis. The concentration of BiTE in the supernatant was 0.604 ng/mL. Results of a western blot experiment are shown in
[0371] Next, binding of BiTE molecules was assessed by flow cytometry. HEK293T cells were transduced with CAR-EGFR-BiTE-(EGFR-CD3), and supernatants containing secreted BiTEs were collected and incubated with K562 cells (
[0372] A similar experiment was conducted using SupT1 cells as transduction hosts for CAR-EGFR-BiTE-(EGFR-CD3).
[0373] Next, the ability of BiTEs secreted from transduced CAR T cells was characterized in vitro. Supernatants containing BiTEs secreted from HEK293T cells transduced with CAR-EGFR-BiTE-(EGFR-CD3) were incubated with a coculture of untransduced ND4 cells and U87vIII target cells at varying ratios. As shown in
[0374] To enable inducible expression of BiTE upon T cell activation, a construct containing an NFAT promoter was designed and synthesized. As shown in
Example 6. CAR T Cells for Glioblastoma
[0375] Using confocal microscopy, it was demonstrated that EGFR-targeted BiTEs are released into the supernatant and bind to both transduced (mcherry+) and bystander untransduced (mcherry) T cells via CD3 (effector arm). In this experiment, CART-EGFR transduced cells (mcherry+) effectively bound biotinylated target antigen (green,
[0376] Next, cytokine production in response to antigen stimulation was analyzed. The pattern of IFN- and TNF- production by different CAR constructs was compared after in vitro stimulation with U87, a human malignant glioma cell line that expresses EGFR but not EGFRvIII. This demonstrated EGFR-specific cytokine production mediated by BiTE-redirected T cells (
[0377] In this experiment, CAR T cells that secrete engineered BiTEs which have biological, antitumor effects were successfully generated. This is the first time to our knowledge that this has been demonstrated.
Example 7. Materials and Methods
Study Design
[0378] The overall purpose of this study was to provide proof-of-concept of a novel therapy seeking to combine both CAR and BiTE T-cell redirecting technologies. Both CAR designs and integrated CART.BiTE constructs were tested using several tumor models, techniques, and approaches. These employed five different xenogeneic models, including three orthotopic brain tumors as well as engrafted human skin to assist in toxicity assessments. Tumor growth was measured by calipers and bioluminescent imaging, and three different in vitro assays of cytotoxicity were used. Each experiment was performed multiple times with T cells derived from a variety of normal human donors.
Mice and Cell Lines
[0379] NSG mice were purchased from Jackson Laboratory and bred under pathogen-free conditions at the MGH Center for Cancer Research. All experiments were performed according to protocols approved by the Institutional Animal Care and Use Committee. The human glioma cell lines U87 and U251, as well as wild-type parental K562 were obtained from American Type Culture Collection (ATCC) and maintained under conditions as outlined by the supplier. In some cases, cells were engineered to express EGFR, EGFRvIII, or CD19 by lentiviral transduction. Where indicated, cell lines were transduced to express click beetle green (CBG) luciferase or enhanced GFP (eGFP) and sorted on a BD FACSAria to obtain a clonal population of transduced cells. The patient-derived neurosphere culture, BT74, was a kind gift from Dr. Santosh Kesari, and was maintained in serum-free EF20 medium as previously described (Pandita et al., Genes Chromosomes Cancer. 39:29-36, 2004).
Construction of CARs
[0380] Two anti-EGFRvIII CART.BiTE constructs and three additional CAR constructs (anti-EGFR, anti-EGFRvIII, and anti-CD19) were synthesized and cloned into a third-generation lentiviral plasmid backbone under the regulation of a human EF-1 promoter. All CAR and CART.BiTE constructs contained a CD8 transmembrane domain in tandem with an intracellular 4-1 BB costimulatory and CD3 signaling domain. BiTEs were designed against wild-type EGFR and CD19 with both sequences flanked by an Ig signal peptide and a polyhistidine-tag (His-tag) element. Ribosomal skip sites were incorporated at appropriate locations. All constructs also contained a transgene coding for the fluorescent reporter, mCherry, to aid in the evaluation of transduction efficiency.
CAR T-Cell Production
[0381] Human T cells were purified from anonymous human healthy donor leukapheresis product (Stem Cell Technologies) purchased from the MGH blood bank under an IND-exempt protocol. Cells were transduced with lentivirus corresponding to various second-generation CAR T-cell constructs. In brief, bulk human T cells were activated on day 0 using CD3/CD28 Dynabeads (Life Technologies) and cultured in RPMI 1640 medium with GlutaMAX and HEPES supplemented with 10% FBS and 20 IU/mL of recombinant human IL-2. Lentiviral transduction of cells was performed on day 1 and unless otherwise indicated, cells were permitted to expand until day 10 and subsequently transferred to storage in liquid nitrogen prior to functional assays. For all functional assays, CAR T cells and CART.BiTE cells were normalized for transduction efficiency using untransduced but cultured and activated T cells from the same donor and expansion. In certain experiments CAR T cells were sorted on a BD FACSAria to obtain a pure population of transduced, mCherry-positive T cells on day 10.
T-Cell Activation and Functional Assays
[0382] Jurkat (NFAT-Luciferase) reporter cells (Signosis) were transduced with different CAR constructs prior to coculture with tumor targets at an E:T ratio of 1:1 for 24 hours. Bystander Jurkat activation was similarly assessed with coculture of untransduced Jurkat reporter cells (J) as well as accompanying primary human T cells and tumor targets at a J:E:T ratio of 1:1:1 for 24 hours. Luciferase activity was then assessed using a Synergy Neo2 luminescence microplate reader (Biotek). Cell-free supernatants from responder cells cocultured with tumor targets were also analyzed for cytokine expression using a Luminex array (Luminex Corp, FLEXMAP 3D) according to manufacturer instructions. In experiments where activation markers CD25 and CD69 were assessed, CAR T cells and CART.BiTE cells were incubated with irradiated U87 at an E:T of 1:1. Cells were cocultured for 72 hours and then subjected to flow cytometric analysis. For proliferation assays of sorted transduced cells, effectors were expanded for 10 days and then sorted on mCherry-positive events. Cells were then stimulated using irradiated U87, U87vIII, or U87-CD19. UTDs, sorted CART-EGFRvIII cells and sorted CART.BiTE cells were then stimulated through CAR alone (CART-EGFRvIII.BiTE-CD19 and U87vIII), BiTE alone (CART-EGFRvIII.BiTE-CD19 and U87-CD19), or CAR and BiTE (CART-EGFRvIII.BiTE-EGFR and U87vIII). Effector and target cells were plated at an E:T of 1:1. Cells were counted every 7 days and plated again with stimulation at 7 day intervals.
Cytotoxicity Assays
[0383] For single time-point cytotoxicity assays, CAR T cells were incubated with luciferase-expressing tumor targets at indicated E:T ratios for 18 hours. Remaining luciferase activity was subsequently measured with a Synergy Neo2 luminescence microplate reader (Biotek). Percent specific lysis was calculated by the following equation: %=((target cells alone RLUtotal RLU)/(target cells only RLU))100. For real-time cytotoxicity assays against adherent cell lines, cell index was recorded as a measure of cell impedance using the xCELLigence RTCA SP instrument (ACEA Biosciences, Inc.). Percent specific lysis was calculated using the following equation: %=((cell index of UTDscell index of CAR T cells)/cell index of UTDs)100. In transwell cytotoxicity assays using the ACEA instrument, Jurkat reporter cells transduced with CAR constructs were cultured in the top well of 0.4 m transwell inserts (ACEA Biosciences). Untransduced T cells were cocultured in the bottom well with tumor targets at the indicated E:T ratios. Occasionally, spurious readings from certain wells due to ACEA machine malfunction were censored but did not affect interpretation of the data. In tests against neurospheres, cytotoxicity was measured by total average green area as recorded by IncuCyte Live Cell Analysis. Neurospheres were plated 3 days prior to adding effectors to encourage neurosphere formation. Effector cells were added at an E:T of 3:1 and monitored over time, with 4 images per well obtained every 10 minutes.
BiTE Purification and Quantification
[0384] HEK293T cells were transduced with respective CAR constructs and cultured until confluence. Supernatants from cells were collected and incubated with HisPur Ni-NTA Resin (Thermo Fisher Scientific) for 24-48 hours at 4 C. under gentle agitation. The supernatant-resin mixture was then washed with Ni-NTA wash buffer (50 mM Tris pH 8.0, 500 mM NaCl, 5% glycerol, 25 mM imidazole). His-tag proteins were then eluted in Ni-NTA elution buffer (50 mM Tris pH 8.0, 500 mM NaCl, 5% glycerol, 250 mM imidazole). After elution, proteins were buffer exchanged into PBS using Slide-A-Lyzer Cassette Float Buoys (Thermo Fisher Scientific) according to manufacturer instructions. When indicated, further concentration of proteins was performed using Amicon Ultra-15 Centrifugal Filter Units (EMD Millipore). Protein concentrations of cell-free, BiTE-containing solutions were determined using the His Tag ELISA Detection Kit (GenScript). Briefly, BiTE-producing cells were seeded at 210.sup.5 cells/mL. Cells were allowed to grow for 2 weeks and supernatant was collected and analyzed intermittently. Where indicated samples were normalized to average values obtained from wells containing UTDs only.
Western Blotting
[0385] Protein samples were separated by SDS-PAGE and transferred onto nitrocellulose membranes using Novex iBlot 2 Nitrocellulose Transfer Stacks (Invitrogen) and iBlot 2 Gel Transfer Device (Invitrogen) according to manufacturer protocols. Briefly, membranes were incubated in blocking buffer consisting of 5% nonfat dry milk (Bio-Rad) in TBST (Santa Cruz Biotechnology) for 1 hour. The membrane was washed once in TBST and probed with anti-His-tag antibody (1:2500, Clone 3D5, Invitrogen) overnight at 4 C. Membranes were washed three times for 5 minutes with TBST and incubated with horseradish peroxidase-conjugated sheep anti-mouse IgG antibody (1:5000, GE Healthcare) for 1 hour. Membranes were then washed three times for 5 minutes each with TBST and developed with Amersham ECL Prime Western Blotting Detection Reagent (GE Healthcare).
Flow Cytometry and Immunohistochemistry
[0386] The following antibody clones targeting their respective antigens were used for flow cytometric analysis where indicated: EGFR (AY13, BioLegend), EGFRvIII (L8A4, Absolute Antibody), His-tag (4E3D10H2/E3, Thermo Fischer), CD25 (2A3, BD Biosciences), CD69 (FN50, BioLegend), CCR7 (3D12, BD Bioscience), CD45RO (UCHL1, BD Biosciences), PD-1 (EH12287, Biolegend), TIM-3 (F38-2E2, Biolegend), LAG-3 (3DS223H, Biolegend). In certain experiments purified BiTE, or supernatant with soluble BiTE was incubated with target cells prior to secondary staining with anti-His-tag antibody. Generally, cells were stained for 15 minutes in the dark at room temperature and washed twice in PBS with 2% FBS prior to analysis. DAPI was added to establish live versus dead separation. Antibody clones for immunohistochemistry included the following: EGFRvIII (D6T2Q, Cell Signaling) and EGFR (D38B1, Cell Signaling), diluted 1:200 and 1:50, respectively, following EDTA-based antigen retrieval. Formalin-fixed, paraffin-embedded specimens were either isolated from experiments or purchased in the form of commercially available tissue microarrays (GL805c, US Biomax; BNC17011a, US Biomax).
Microscopic Imaging
[0387] Confocal microscopy of T cells was performed on a Zeiss LSM710 inverted confocal microscope in the MGH Cancer Center Molecular Pathology Confocal Core and analyzed on Fiji Is Just ImageJ software. In brief, transduced T cells that had been activated and expanded for 10 days were stained with biotinylated human EGFR (Acro Biosystems) at a concentration of 1 g/mL for 40 minutes and then incubated with streptavidin (eBioscience) at 1 g/mL for 15 minutes on ice prior to microscopic analysis. Otherwise, cell cultures were also visualized using an EVOS Cell Imaging System (Thermo Fisher Scientific). In experiments assessing proliferation, CAR T cells and CART.BiTE cells were cocultured for one week with irradiated U87 expressing eGFP at an E:T of 1:1.
Animal Models
[0388] Tumor cells were harvested in logarithmic growth phase and washed twice with PBS prior to being loaded in a 50 L syringe with an attached 25-gauge needle. With the assistance of a stereotactic frame, tumor cells were implanted at 2 mm to the right of bregma and a depth of 4 mm from the surface of the skull at the coronal suture. The number of tumor cells varied depending on the cell culture. In mouse models of flank tumor or human skin toxicity, effector cells were infused systemically by tail vein infusion in a volume of 100 L. When delivered intraventricularly, cells were infused at 2 mm to the left of and 0.3 mm anterior to bregma at a depth of 3 mm. Effector cell populations were normalized to contain 110.sup.6 cells per infusion for all experiments. Tumor progression was then longitudinally evaluated by bioluminescence emission using an Ami HT optical imaging system (Spectral Instruments) following intraperitoneal substrate injection. For toxicity studies, deidentified, excess human skin was obtained from healthy donors during abdominoplasty surgeries under informed consent and approval by the Institutional Review Board. An approximately 1 cm1 cm skin sample was sutured to the dorsa of NSG mice and allowed to heal for at least 6 weeks. Engrafted skin was monitored daily for up to 2 weeks prior to excision and histological analysis.
Statistical Methods
[0389] All analyses were performed with GraphPad Prism 7.0c software. Data was presented as meansstandard deviation (SD) or standard error of mean (SEM) with statistically significant differences determined by tests as indicated in figure legends.
Example 8. CAR T Cells Against EGFRvIII for Glioblastoma (GBM) and Design of CART.BiTE
[0390] Glioblastoma (GBM) is the most common malignant brain tumor and is also the most deadly. Current treatment for GBM includes surgical resection, radiation and temozolomide chemotherapy, which provide only incremental benefit and are limited by systemic toxicity and damage to normal brain (Imperato et al., Annals of Neurology 28:818-822, 1990). In 2017, CART cells targeting CD19 were approved by the U.S. Food and Drug Administration (FDA) for B-cell malignancies and have since revolutionized the treatment of hematological cancers (Mullard et al., Nat. Rev. Drug. Discov. 16:699, 2017). Several different CARs have been described in recent clinical studies for GBM (O'Rourke et al., Sci. Transl. Med. 9, 2017; Ahmed et al., JAMA Oncol. 3:1094-1101, 2017; Brown et al., N. Engl. J. Med. 375:2561-2569, 2016), where peripherally injected CAR-transduced T cells have localized to brain tumors and, in at least one case, intracranially-administered CAR T cells mediated the regression of late-stage, multifocal, bulky disease (Brown et al., supra). However, clinical responses against GBM have not been consistent or durable, in large part due to heterogeneous antigen expression within these tumors and the emergence of antigen escape following treatment with CAR T cells directed at a single target. Approximately 30% of GBMs express EGFRvIII (Wikstrand et al., Cancer Res. 57:4130-4140, 1997), while 80% or more express EGFR (Verhaak et al., Cancer Cell 17:98-110, 2010). When the EGFRvIII mutation is lost in GBM, amplification of wild-type EGFR is maintained (O'Rourke et al., Sci. Transl. Med. 9, 2017; Felsberg et al., Clin. Cancer Res. 23:6846-6855, 2017). Although EGFR expression is also found in normal tissues such as the skin, lungs, and gut, EGFR was not detected in the analysis of 80 core samples from healthy human central nervous system (CNS) tissues (
TABLE-US-00002 TABLE 2 Sample designations for normal CNS and GBM tissue microarrays Position Age Sex Site Location/Diagnosis A1 15 M Cerebrum Frontal lobe tissue A2 15 M Cerebrum Frontal lobe tissue A3 18 F Cerebrum Frontal lobe tissue A4 18 F Cerebrum Frontal lobe tissue A5 38 M Cerebrum Frontal lobe tissue A6 38 M Cerebrum Frontal lobe tissue A7 45 M Cerebrum Apical lobe tissue A8 45 M Cerebrum Apical lobe tissue A9 15 M Cerebrum Apical lobe tissue A10 15 M Cerebrum Apical lobe tissue B1 18 F Cerebrum Apical lobe tissue B2 18 F Cerebrum Apical lobe tissue B3 19 M Cerebrum Occipital lobe tissue B4 19 M Cerebrum Occipital lobe tissue B5 18 F Cerebrum Occipital lobe tissue B6 18 F Cerebrum Occipital lobe tissue B7 2 F Cerebrum Occipital lobe tissue B8 2 F Cerebrum Occipital lobe tissue B9 18 F Cerebrum Temporal lobe tissue B10 18 F Cerebrum Temporal lobe tissue C1 45 M Cerebrum Temporal lobe tissue C2 45 M Cerebrum Temporal lobe tissue C3 42 F Cerebrum Temporal lobe tissue C4 42 F Cerebrum Temporal lobe tissue C5 21 F Cerebrum Midbrain tissue C6 21 F Cerebrum Midbrain tissue C7 38 M Cerebrum Midbrain tissue C8 38 M Cerebrum Midbrain tissue C9 21 F Cerebrum Midbrain tissue C10 21 F Cerebrum Midbrain tissue D1 45 M Cerebrum Pons tissue D2 45 M Cerebrum Pons tissue D3 47 M Cerebrum Pons tissue D4 47 M Cerebrum Pons tissue D5 35 M Cerebrum Pons tissue D6 35 M Cerebrum Pons tissue D7 Cerebrum Medulla oblongata tissue D8 Cerebrum Medulla oblongata tissue D9 27 M Cerebrum Medulla oblongata tissue D10 27 M Cerebrum Medulla oblongata tissue E1 50 F Cerebrum Medulla oblongata tissue E2 50 F Cerebrum Medulla oblongata tissue E3 43 M Cerebrum Thalamus opticus tissue E4 43 M Cerebrum Thalamus opticus tissue E5 15 M Cerebrum Thalamus opticus tissue E6 15 M Cerebrum Thalamus opticus tissue E7 2 F Cerebrum Thalamus opticus tissue E8 2 F Cerebrum Thalamus opticus tissue E9 24 F Cerebellum Cerebellum tissue E10 24 F Cerebellum Cerebellum tissue F1 35 M Cerebellum Cerebellum tissue F2 35 M Cerebellum Cerebellum tissue F3 35 M Cerebellum Cerebellum tissue F4 35 M Cerebellum Cerebellum tissue F5 38 M Cerebrum Hippocampus tissue F6 38 M Cerebrum Hippocampus tissue F7 50 F Cerebrum Hippocampus tissue F8 50 F Cerebrum Hippocampus tissue F9 48 M Cerebrum Hippocampus tissue F10 48 M Cerebrum Hippocampus tissue G1 19 M Cerebrum Callositas tissue G2 19 M Cerebrum Callositas tissue G3 45 M Cerebrum Callositas tissue G4 45 M Cerebrum Callositas tissue G5 21 F Cerebrum Callositas tissue G6 21 F Cerebrum Callositas tissue G7 33 M Cerebrum Optic nerve tissue G8 33 M Cerebrum Optic nerve tissue G9 30 M Cerebrum Optic nerve tissue G10 30 M Cerebrum Optic nerve tissue H1 45 M Cerebrum Optic nerve tissue H2 45 M Cerebrum Optic nerve tissue H3 40 M Cerebrum Spinal cord tissue H4 40 M Cerebrum Spinal cord tissue (sparse) H5 38 M Cerebrum Spinal cord tissue H6 38 M Cerebrum Spinal cord tissue H7 30 M Cerebrum Spinal cord tissue H8 30 M Cerebrum Spinal cord tissue H9 46 M Cerebrum Brain tissue H10 46 M Cerebrum Caudate nucleus tissue I1 59 F Cerebrum GBM I2 59 F Cerebrum GBM I3 80 M Cerebrum GBM I4 80 M Cerebrum GBM I5 59 M Cerebrum GBM I6 59 M Cerebrum GBM I7 48 F Cerebrum GBM I8 48 F Cerebrum GBM I9 63 M Cerebrum GBM I10 63 M Cerebrum GBM
[0391] To recapitulate GBM heterogeneity and the emergence of antigen escape at recurrence in xenograft models, tumors with heterogeneous EGFRvIII expression were implanted into the flanks of NSG (NOD.Cg-Prkdc.sup.scidIl2rg.sup.tm1Wjl/SzJ) mice (
Example 9. Generation of CART.BiTE for Heterogeneous Tumors
[0392] Two CART.BiTE constructs were generated, both based on the second-generation CART-EGFRvIII backbone containing 4-1 BB and CD3 intracellular signaling domains (
[0393] BiTE cDNA was constructed following the general format previously described (Choi et al., Expert Opin. Biol. Ther. 11:843-853, 2011), incorporating two scFvs translated in tandem, bridged by a flexible glycine-serine linker (
[0394] Next, the quantity of BiTE produced by human CART.BiTE cells was approximated using a competitive ELISA-based immunoassay. While UTD cells did not produce a detectable secretory His-tagged protein, soluble BiTE was readily measured in the supernatant of CART.BiTE cells (510.sup.5) and total BiTE concentration increased over time at an approximate rate of 10 pg/d (
[0395] Immune therapies with CAR T cells and BiTEs generate potent antitumor responses in patients with hematologic malignancies, but have had limited success in solid tumors like GBM. In the current study, an approach was developed that strategically combines CARs with BiTEs into a single gene-modified T-cell product. It was demonstrated this platform can be used to address critical barriers to effective immune therapy of solid tumors, including antigen escape, immune suppression, and T-cell exhaustion.
Example 10. CART.BiTE Functions in the Setting of EGFRvIII Antigen Loss
[0396] Having demonstrated that CAR-transduced T cells can be engineered to both translate and secrete BiTEs, the functional capacity of the CART.BiTE cells in mediating antitumor immune responses was next determined. First, Jurkat reporter T cells transduced with the candidate constructs were generated and assessed for selective activation against well-characterized EGFRvIII-negative, EGFR-positive glioma cell lines in vitro (
[0397] Next, the ability of CART.BiTE to elicit antigen-specific cytotoxic responses was tested. Using a standard bioluminescent cytotoxicity assay, we demonstrated that CART-EGFRvIII.BiTE-EGFR cells were highly cytotoxic and specific against EGFR-positive glioma (
[0398] Patient-derived xenografts (PDXs) represent a recent focus of translational research in GBM and are thought to closely reproduce the genetic complexity and hallmark biological characteristics of brain tumors. Importantly, GBM PDXs have specifically been shown to maintain physiologically relevant EGFR copy number and amplification levels. In a study of more than 11 established GBM PDX neurospheres (Pandita et al., Genes Chromosomes Cancer 39:29-36, 2004), only one tumor contained both amplified EGFR and EGFRvIII. Given its natural dual antigen expression, it was reasoned that this model (i.e., BT74, formerly GBM6) would be an ideal platform for CART.BiTE evaluation. It was confirmed that BT74 reliably demonstrated heterogeneous expression of both EGFR and EGFRvIII (
[0399] Because PDX neurospheres are nonadherent and therefore not amenable to viability measures based on impedance, antitumor cytotoxicity was assessed by live-cell, image-based analysis. Using this system, significant antitumor activity of CART-EGFRvIII.BiTE-EGFR cells against BT74 over time was demonstrated (
Example 11. CART.BiTE is Efficacious and Safe Against EGFRvIII-Negative Tumors in Mice
[0400] Given that the expression of EGFRvIII in BT74 proved variable in mice, it was next determined whether the in vivo efficacy of CART-EGFRvIII.BiTE-EGFR was dependent on CAR recognition of its cognate antigen, EGFRvIII, or if secreted BiTEs in the absence of CAR engagement were sufficient to detect measurable antitumor responses in vivo. To test this, human glioma cells (U251) were orthotopically implanted into NSG mice and proceeded with treatment (
[0401] Because secreted BiTE-EGFR was necessary and sufficient to mediate antitumor efficacy against GBM, even in the absence of EGFRvIII, one potential concern could be that CART.BiTE might also result in significant on-target, off-tumor toxicity in normal human tissues that express wild-type EGFR. However, it was hypothesized that, given the very low levels of BiTE secretion from transduced T cells (
[0402] Human skin was transplanted onto the dorsa of NSG mice and allowed to fully heal prior to treatment with CAR T-cell therapy (
Example 12. BiTEs Secreted by CAR T Cells Recruit Bystander Effector Activity
[0403] In patients, GBM tumors are variably infiltrated by endogenous T cells at baseline, and the presence of these cells has been shown to predict favorable clinical outcomes (Lohr et al., Clin. Cancer Res. 17:4296-4308, 2011). Likewise, the clinical study of patients receiving CART-EGFRvIII cells demonstrated robust bystander T-cell infiltrate within the tumor bed (O'Rourke et al., supra). However, it has also been shown that tumor-infiltrating lymphocytes (TILs) often have tumor-agonistic specificities and may recognize a wide range of epitopes completely unrelated to cancer (Simoni et al. Nature 557:575-579, 2018). Thus, these unmodified, endogenous T cells, may represent an untapped resource with the potential to be redirected into tumor-specific cytotoxic killers (
[0404] Mechanistically, it remained unclear whether secreted BiTEs were solely recruiting cells that had been modified to express the transgene, versus primarily redirecting the bystander T-cell compartment, which is incidentally present in all CAR T-cell preparations for both research and clinical use (
[0405] Next, the ability of secreted BiTEs to potentiate paracrine immune responses against tumor cells was evaluated, specifically from the bystander compartment. Using flow cytometric analysis on cocultures of GBM and primary human T cells, it was found that only CART-EGFRvIII.BiTE-EGFR mediated activation of mCherry-negative cells, as indicated by early induction of CD25 and CD69 (
[0406] Also assessed was the degree to which CART.BiTE could elicit bystander T-cell functional activity, which was measured by parameters such as proliferation, cytokine secretion, and antitumor cytotoxicity. It was determined that, whereas mCherry-positive, CART-EGFR cells proliferated indiscriminately upon encountering their target antigen in culture, a significant proportion of proliferation in cultures transduced with CART-EGFRvIII.BiTE-EGFR was observed within the bystander T-cell compartment (
Example 13. Simultaneous Redirection Through CARs and BiTEs Results in Favorable T-Cell Differentiation and Phenotype
[0407] In a model of heterogeneous brain tumors expressing EGFRvIII in only 10% of cells, injection with CART-EGFRvIII.BiTE-EGFR cells resulted in complete and durable responses in all mice (
[0408] To further characterize BiTE activity in the context of CAR-transduced cells, each mode of stimulation was also compared for its ability to initiate and maintain T-cell proliferation. Notably, while BiTEs are limited to activating T cells via CD3 stimulation, CAR T cells are engineered to express both intracellular CD3 as well as potent costimulatory domains such as 4-1 BB, in this case. Thus, by design, it was surmised that CARs might outperform BiTEs in assays measuring certain functional parameters when measured head-to-head. Indeed, following serial antigen stimulation with irradiated target cells, growth of sorted transduced cells undergoing BiTE stimulation plateaued after approximately 12 days, whereas repeated antigen stimulation through CARs maintained logarithmic growth for over one month (
[0409] T cells exist in various states of differentiation, each with unique functional capabilities. In clinical studies, BiTEs have been shown to selectively promote expansion of well-differentiated effector memory cells (T.sub.EM) (Bargou et al., Science 321:974-977, 2008); however, superior outcomes for CARTs have been achieved using less differentiated stem cell memory (T.sub.SCM) or central memory (T.sub.CM) subtypes (Sadelain et al., Nature 545:423-431, 2017). These less differentiated phenotypes are associated with enhanced expansion and persistence, the capacity for self-renewal, and the ability to generate shorter-lived T.sub.EM. Thus, it was hypothesized that the differences observed in proliferation during serial antigen stimulation through each modality (
Example 14. Immune Cells Genetically Modified to Target Multiple Antigens with Combinations of Tandem Chimeric Antigen Receptors (CARs) and Secreted BiTEs
[0410] Heterogeneous target antigen expression and outgrowth of tumors lacking the target antigen can limit responses of cancer to immunotherapy using immune cells (e.g., T cells) engineered to express CARs. For example, glioblastoma (GBM) is a cancer with extremely poor prognosis that is known to express surface antigens that may be targeted for effective antitumor immunity, including EGFRvIII, IL13R2, EGFR, HER2, and ephrins. However, to date, responses of GBM to CART cells directed against single antigens such as EGFRvIII or IL-13R2 have been limited, in part due to antigen escape.
[0411] To address this issue, a second generation CAR was designed comprised of two or more antigen-binding domains (e.g., two or more single chain fragment variable (scFv) regions, two or more ligands, or a combination of one or more scFvs and one or more ligands). Such a CAR has the capacity to be activated by engagement with two or more different antigens, for example, EGFRvIII and IL-13R2. To further increase the breadth of responses achievable through this approach and to protect against tumor progression via antigen escape, additional specificity or targets for the immune cells can be provided by engineering the immune cells to also secrete bispecific antibodies (e.g., BiTEs) targeting an additional antigen, for example, EGFR or HER2.
[0412] A tandem CAR construct directed against IL-13R2 and EGFRvIII was designed along with two control CARs directed against either single antigen (
[0413] An in vitro model for heterogeneous glioblastoma was developed using U87 human glioblastoma cells and U87 cells transduced to express EGFRvIII (U87vIII). Expression of IL13R2 was confirmed in both U87 and U87vIII glioblastoma as assessed by flow cytometry (
[0414] In summary, we have developed tandem CARs targeting two or more distinct antigens, e.g., EGFRvIII and IL-13R2, which can be engineered to secrete bispecific antibodies (e.g., BiTEs) targeting an additional antigen, e.g., EGFR or HER2. This technique can be extended to other tandem CARs or BiTEs targeting other surface tumor antigens, e.g., EGFR, EGFRvIII, CD19, CD79b, CD37, PSMA, PSCA, IL-13R2, EphA1, Her2, mesothelin, MUC1, MUC16, or others. For example, a tandem CAR can be designed to target EGFR and EGFRvIII, PSMA and PSCA; CD19 and CD79b; CD79b and CD37; CD19 and CD37; EphA1 and Her2; EphA1 and mesothelin; Her2 and mesothelin, MUC1 and MUC16; as well as other combinations of the aforementioned tumor antigens.
Example 15. Sequence Information
[0415] Anti-GARP CAR-Construct 1: CD8 signal sequence-anti-GARP-CD8 hinge+TM-4-1BB-CD3 (SEQ ID NO: 1) including CD8 signal sequence (amino acids 1-21 of SEQ ID NO: 1; SEQ ID NO: 2); anti-GARP camelid (amino acids 22-128 of SEQ ID NO: 1; SEQ ID NO: 3); CD8 hinge/TM domain (amino acids 129-197 of SEQ ID NO: 1; SEQ ID NO: 4); 4-1BB ICD (amino acids 198-239 of SEQ ID NO: 1; SEQ ID NO: 5); and CD3 (amino acids 240-351 of SEQ ID NO: 1; SEQ ID NO: 6).
TABLE-US-00003 (SEQIDNO:1) MALPVTALLLPLALLLHAARPDIQMTQSPSSLSASLGDRVTITCQASQSI SSYLAWYQQKPGQAPNILIYGASRLKTGVPSRFSGSGSGTSFTLTISGLE AEDAGTYYCQQYASVPVTFGQGTKVELKTTTPAPRPPTPAPTIASQPLSL RPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRG RKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAP AYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNE LQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPP R
CD8 signal sequence (amino acids 1-21 of SEQ ID NO: 1)
TABLE-US-00004 (SEQIDNO:2) MALPVTALLLPLALLLHAARP
Anti-GARP camelid (amino acids 22-128 of SEQ ID NO: 1)
TABLE-US-00005 (SEQIDNO:3) DIQMTQSPSSLSASLGDRVTITCQASQSISSYLAWYQQKPGQAPNILIY GASRLKTGVPSRFSGSGSGTSFTLTISGLEAEDAGTYYCQQYASVPVTF GQGTKVELK
CD8 hinge/TM domain (amino acids 129-197 of SEQ ID NO: 1)
TABLE-US-00006 (SEQIDNO:4) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIW APLAGTCGVLLLSLVITLYC
4-1 BB ICD (amino acids 198-239 of SEQ ID NO: 1)
TABLE-US-00007 (SEQIDNO:5) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL
CD3 (amino acids 240-351 of SEQ ID NO: 1)
TABLE-US-00008 (SEQIDNO:6) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR
Anti-LAP CAR (H-L)-Construct 2: CD8 signal sequence-anti-LAP-CD8 hinge+TM-4-1BB-CD3 (SEQ ID NO: 7) including CD8 signal sequence (amino acids 1-21 of SEQ ID NO: 7; SEQ ID NO: 8), anti-LAP scFv (H-L) (amino acids 22-307 of SEQ ID NO: 7; SEQ ID NO: 9), CD8 hinge/TM domain (amino acids 308-376 of SEQ ID NO: 7; SEQ ID NO: 10), 4-1 BB ICD (amino acids 377-418 of SEQ ID NO: 7; SEQ ID NO: 11), and CD3 (amino acids 419-530 of SEQ ID NO: 7; SEQ ID NO: 12).
TABLE-US-00009 (SEQIDNO:7) MALPVTALLLPLALLLHAARPMKLWLNWIFLVTLLNDIQCEVKLVESGGG LVQPGGSLSLSCAASGFTFTDYYMSWVRQPPGKALEWLGFIRNKPNGYTT EYSASVKGRFTISRDNSQSILYLQMNVLRAEDSATYYCARYTGGGYFDYV VGQGTTLTVSSGGGGSGGGGSGGGGSGGGGSMMSSAQFLGLLLLCFQGTR CDIQMTQTTSSLSASLGDRLTISCRASQDISNYLNWYQQKPDGTVKLLIY YTSRLHSGVPSRFSGSGSGTDYSLTISNLEQADIATYFCQQGDTLPWTFG GGTKLEIKTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDF ACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQ EEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREE YDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERR RGKGHDGLYQGLSTATKDTYDALHMQALPPR
CD8 signal sequence (amino acids 1-21 of SEQ ID NO: 7)
TABLE-US-00010 (SEQIDNO:8) MALPVTALLLPLALLLHAARP
Anti-LAP scFv (H-L) (amino acids 22-307 of SEQ ID NO: 7)
TABLE-US-00011 (SEQIDNO:9) MKLWLNWIFLVTLLNDIQCEVKLVESGGGLVQPGGSLSLSCAASGFTFTD YYMSWVRQPPGKALEWLGFIRNKPNGYTTEYSASVKGRFTISRDNSQSIL YLQMNVLRAEDSATYYCARYTGGGYFDYWGQGTTLTVSSGGGGSGGGGSG GGGSGGGGSMMSSAQFLGLLLLCFQGTRCDIQMTQTTSSLSASLGDRLTI SCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDY SLTISNLEQADIATYFCQQGDTLPWTFGGGTKLEIK
CD8 hinge/TM domain (amino acids 308-376 of SEQ ID NO: 7)
TABLE-US-00012 (SEQIDNO:10) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWA PLAGTCGVLLLSLVITLYC
4-1 BB ICD (amino acids 377-418 of SEQ ID NO: 7)
TABLE-US-00013 (SEQIDNO:11) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL
CD3 (amino acids 419-530 of SEQ ID NO: 7).
TABLE-US-00014 (SEQIDNO:12) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR
Anti-LAP CAR (L-H)-Construct 3: CD8 signal sequence-anti-LAP CD8 hinge+TM-4-1BB-CD3 (SEQ ID NO: 13) including CD8 signal (amino acids 1-21 of SEQ ID NO: 13; SEQ ID NO: 14), anti-LAP scFv (L-H) (amino acids 22-307 of SEQ ID NO: 13; SEQ ID NO: 15), CD8 hinge/TM (amino acids 308-376 of SEQ ID NO: 13; SEQ ID NO: 16), 4-1BB ICD (amino acids 377-418 of SEQ ID NO: 13; SEQ ID NO: 17), and CD3 (amino acids 419-530 of SEQ ID NO: 13; SEQ ID NO: 18).
TABLE-US-00015 (SEQIDNO:13) MALPVTALLLPLALLLHAARPMMSSAQFLGLLLLCFQGTRCDIQMTQTTS SLSASLGDRLTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLHSGVP SRFSGSGSGTDYSLTISNLEQADIATYFCQQGDTLPWTFGGGTKLEIKGG GGSGGGGSGGGGSGGGGSMKLWLNWIFLVTLLNDIQCEVKLVESGGGLVQ PGGSLSLSCAASGFTFTDYYMSWVRQPPGKALEWLGFIRNKPNGYTTEYS ASVKGRFTISRDNSQSILYLQMNVLRAEDSATYYCARYTGGGYFDYVVGQ GTTLTVSSTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDF ACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQ EEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREE YDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERR RGKGHDGLYQGLSTATKDTYDALHMQALPPR
CD8 signal sequence (amino acids 1-21 of SEQ ID NO: 13)
TABLE-US-00016 (SEQIDNO:14) MALPVTALLLPLALLLHAARP
Anti-LAP scFv (L-H) (amino acids 22-307 of SEQ ID NO: 13)
TABLE-US-00017 (SEQIDNO:15) MMSSAQFLGLLLLCFQGTRCDIQMTQTTSSLSASLGDRLTISCRASQDIS NYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQ ADIATYFCQQGDTLPWTFGGGTKLEIKGGGGSGGGGSGGGGSGGGGSMKL WLNWIFLVTLLNDIQCEVKLVESGGGLVQPGGSLSLSCAASGFTFTDYYM SWVRQPPGKALEWLGFIRNKPNGYTTEYSASVKGRFTISRDNSQSILYLQ MNVLRAEDSATYYCARYTGGGYFDYVVGQGTTLTVSS
CD8 hinge/TM (amino acids 308-376 of SEQ ID NO: 13)
TABLE-US-00018 (SEQIDNO:16) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWA PLAGTCGVLLLSLVITLYC
4-1 BB ICD (amino acids 377-418 of SEQ ID NO: 13)
TABLE-US-00019 (SEQIDNO:17) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL
CD3 (amino acids 419-530 of SEQ ID NO: 13)
TABLE-US-00020 (SEQIDNO:18) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR
Anti-EGFR CAR secreting anti-GARP Camelid-Construct 4: CD8 signal sequence-anti-EGFR-CD8 hinge+TM-4-1 BB-CD3-anti-GARP camelid (SEQ ID NO: 19) including CD8 signal sequence (amino acids 1-21 of SEQ ID NO: 19; SEQ ID NO: 20), anti-EGFR scFv (amino acids 22-267 of SEQ ID NO: 19; SEQ ID NO: 21), CD8 hinge/TM (amino acids 268-336 of SEQ ID NO: 19; SEQ ID NO: 22), 4-1 BB (amino acids 337-378 of SEQ ID NO: 19; SEQ ID NO: 23), CD3 (amino acids 379-490 of SEQ ID NO: 19; SEQ ID NO: 24), 2A cleavage sequence (amino acids 494-515 of SEQ ID NO: 19; SEQ ID NO: 31), Ig leader (amino acids 519-539 of SEQ ID NO: 19; SEQ ID NO: 32), and anti-GARP camelid (amino acids 540-646 of SEQ ID NO: 19; SEQ ID NO: 25).
TABLE-US-00021 (SEQIDNO:19) MALPVTALLLPLALLLHAARPQVQLKQSGPGLVQPSQSLSITCTVSGFSL TNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVF FKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAGGGGSGGGGS GGGGSGGGGSDILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRT NGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQ NNNWPTTFGAGTKLELKTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGG AVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIFKQP FMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQLYN ELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYS EIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRPGSGSGATNF SLLKQAGDVEENPGPRTAMETDTLLLWVLLLWVPGSTGDDIQMTQSPSSL SASLGDRVTITCQASQSISSYLAWYQQKPGQAPNILIYGASRLKTGVPSR FSGSGSGTSFTLTISGLEAEDAGTYYCQQYASVPVTFGQGTKVELKHHHH HHSG
CD8 signal sequence (amino acids 1-21 of SEQ ID NO: 19)
TABLE-US-00022 (SEQIDNO:20) MALPVTALLLPLALLLHAARP
Anti-EGFR scFv (amino acids 22-267 of SEQ ID NO: 19)
TABLE-US-00023 (SEQIDNO:1) QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGV IWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALT YYDYEFAYWGQGTLVTVSAGGGGSGGGGSGGGGSGGGGSDILLTQSPVIL SVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKYASESISGIPSR FSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFGAGTKLELK
CD8 hinge/TM (amino acids 268-336 of SEQ ID NO: 19)
TABLE-US-00024 (SEQIDNO:22) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWA PLAGTCGVLLLSLVITLYC
4-1BB (amino acids 337-378 of SEQ ID NO: 19)
TABLE-US-00025 (SEQIDNO:23) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL
CD3 (amino acids 379-490 of SEQ ID NO: 19)
TABLE-US-00026 (SEQIDNO:24) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR
2A cleavage sequence (amino acids 494-515 of SEQ ID NO: 19; SEQ ID NO: 31)
TABLE-US-00027 (SEQIDNO:31) GSGATNFSLLKQAGDVEENPGP
Ig signal sequence (amino acids 519-539 of SEQ ID NO: 19; SEQ ID NO: 32)
TABLE-US-00028 (SEQIDNO:32) METDTLLLWVLLLWVPGSTGD
Anti-GARP camelid (amino acids 540-646 of SEQ ID NO: 19; SEQ ID NO: 25).
TABLE-US-00029 (SEQIDNO:25) DIQMTQSPSSLSASLGDRVTITCQASQSISSYLAWYQQKPGQAPNILIYG ASRLKTGVPSRFSGSGSGTSFTLTISGLEAEDAGTYYCQQYASVPVTFGQ GTKVELK
Construct 5-3C10 (anti-EGFRvIII) scFv-CD8 Hinge/TM-4-1BB ICD-CD3-P2A-Ig signal sequence-Cetuximab (anti-EGFR) scFv-CD3scFv-His-tag (SEQ ID NO: 26) including 3C10 scFv (amino acids 1-243 of SEQ ID NO: 26; SEQ ID NO: 27), CD8 hinge/TM (amino acids 244-312 of SEQ ID NO: 26; SEQ ID NO: 28), 4-1 BB ICD (amino acids 313-354 of SEQ ID NO: 26; SEQ ID NO: 29), CD3 (amino acids 355-466 of SEQ ID NO: 26; SEQ ID NO: 30), P2A (amino acids 467-488 of SEQ ID NO: 26; SEQ ID NO: 31), Ig signal sequence (amino acids 491-511 of SEQ ID NO: 26; SEQ ID NO: 32), Cetuximab scFv (amino acids 512-752 of SEQ ID NO: 26; SEQ ID NO: 33), CD3 scFv (amino acids 758-1000 of SEQ ID NO: 26; SEQ ID NO: 34).
TABLE-US-00030 (SEQIDNO:26) EIQLQQSGAELVKPGASVKLSCTGSGFNIEDYYIHWVKQRTEQGLEWIGR IDPENDETKYGPIFQGRATITADTSSNTVYLQLSSLTSEDTAVYYCAFRG GVYWGPGTTLTVSSGGGGSGGGGSGGGGSHMDVVMTQSPLTLSVAIGQSA SISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLISLVSKLDSGVPDRFTG SGSGTDFTLRISRVEAEDLGIYYCWQGTHFPGTFGGGTKLEIKTTTPAPR PPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCG VLLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEG GCELRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMG GKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTA TKDTYDALHMQALPPRGSGATNFSLLKQAGDVEENPGPPRMETDTLLLWV LLLWVPGSTGDDILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQR TNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQ QNNNWPTTFGAGTKLELKGGGGSGGGGSGGGGSQVQLKQSGPGLVQPSQS LSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRL SINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTV SAGGGGSDIKLQQSGAELARPGASVKMSCKTSGYTFTRYTMHWVKQRPGQ GLEWIGYINPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAV YYCARYYDDHYCLDYWGQGTTLTVSSVEGGSGGSGGSGGSGGVDDIQLTQ SPAIMSASPGEKVTMTCRASSSVSYMNWYQQKSGTSPKRWIYDTSKVASG VPYRFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSNPLTFGAGTKLELK HHHHHH
3C10 (anti-EGFRvIII) scFv (amino acids 1-243 of SEQ ID NO: 26)
TABLE-US-00031 (SEQIDNO:27) EIQLQQSGAELVKPGASVKLSCTGSGFNIEDYYIHWVKQRTEQGLEWIGR IDPENDETKYGPIFQGRATITADTSSNTVYLQLSSLTSEDTAVYYCAFRG GVYWGPGTTLTVSSGGGGSGGGGSGGGGSHMDVVMTQSPLTLSVAIGQSA SISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLISLVSKLDSGVPDRFTG SGSGTDFTLRISRVEAEDLGIYYCWQGTHFPGTFGGGTKLEIK
CD8 hinge/TM (amino acids 244-312 of SEQ ID NO: 26)
TABLE-US-00032 (SEQIDNO:28) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWA PLAGTCGVLLLSLVITLYC
4-1 BB ICD (amino acids 313-354 of SEQ ID NO: 26)
TABLE-US-00033 (SEQIDNO:29) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL
CD3 ((amino acids 355-466 of SEQ ID NO: 26)
TABLE-US-00034 (SEQIDNO:30) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKP RRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATK DTYDALHMQALPPR
P2A (amino acids 467-488 of SEQ ID NO: 26)
TABLE-US-00035 (SEQIDNO:31) GSGATNFSLLKQAGDVEENPGP
Ig signal sequence (amino acids 491-511 of SEQ ID NO: 26)
TABLE-US-00036 (SEQIDNO:32) METDTLLLWVLLLWVPGSTGD
Cetuximab (anti-EGFR) scFv (amino acids 512-752 of SEQ ID NO: 26)
TABLE-US-00037 (SEQIDNO:33) DILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKY ASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFGA GTKLELKGGGGSGGGGSGGGGSQVQLKQSGPGLVQPSQSLSITCTVSGFS LTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQV FFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSA
Anti-CD3 scFv (amino acids 758-1000 of SEQ ID NO: 26)
TABLE-US-00038 (SEQIDNO:34) DIKLQQSGAELARPGASVKMSCKTSGYTFTRYTMHWVKQRPGQGLEWIGY INPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYYCARYY DDHYCLDYWGQGTTLTVSSVEGGSGGSGGSGGSGGVDDIQLTQSPAIMSA SPGEKVTMTCRASSSVSYMNWYQQKSGTSPKRWIYDTSKVASGVPYRFSG SGSGTSYSLTISSMEAEDAATYYCQQWSSNPLTFGAGTKLELK
Construct 6-2173 (anti-EGFRvIII) scFv-CD8 Hinge/TM-4-1BB ICD-CD3-P2A-Ig signal sequence-Cetuximab (anti-EGFR) scFv-CD3-scFv-His-tag (SEQ ID NO: 35) including 2173 scFv (amino acids 1-246 of SEQ ID NO: 35; SEQ ID NO: 36), CD8 hinge/TM (amino acids 247-315 of SEQ ID NO: 35; SEQ ID NO: 37), 4-1 BB ICD (amino acids 316-357 of SEQ ID NO: 36; SEQ ID NO: 38), CD3(amino acids 358-469 of SEQ ID NO: 35; SEQ ID NO: 39), P2A (amino acids 470-491 of SEQ ID NO: 35; SEQ ID NO: 40), Ig signal sequence (amino acids 494-514 of SEQ ID NO: 35; SEQ ID NO: 41), Cetuximab scFv (amino acids 515-755 of SEQ ID NO: 35; SEQ ID NO: 42), and CD3 scFv (amino acids 761-1003 of SEQ ID NO: 35; SEQ ID NO: 43).
TABLE-US-00039 (SEQIDNO:35) EIQLVQSGAEVKKPGESLRISCKGSGFNIEDYYIHWVRQMPGKGLEWMGR IDPENDETKYGPIFQGHVTISADTSINTVYLQWSSLKASDTAMYYCAFRG GVYWGQGTTVTVSSGGGGSGGGGSGGGGSGGGGSDVVMTQSPDSLAVSLG ERATINCKSSQSLLDSDGKTYLNWLQQKPGQPPKRLISLVSKLDSGVPDR FSGSGSGTDFTLTISSLQAEDVAVYYCWQGTHFPGTFGGGTKVEIKTTTP APRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAG TCGVLLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEE EEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDP EMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGL STATKDTYDALHMQALPPRGSGATNFSLLKQAGDVEENPGPPRMETDTLL LWVLLLWVPGSTGDDILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWY QQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADY YCQQNNNWPTTFGAGTKLELKGGGGSGGGGSGGGGSQVQLKQSGPGLVQP SQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFT SRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTL VTVSAGGGGSDIKLQQSGAELARPGASVKMSCKTSGYTFTRYTMHWVKQR PGQGLEWIGYINPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSSLTSED SAVYYCARYYDDHYCLDYWGQGTTLTVSSVEGGSGGSGGSGGSGGVDDIQ LTQSPAIMSASPGEKVTMTCRASSSVSYMNWYQQKSGTSPKRWIYDTSKV ASGVPYRFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSNPLTFGAGTKL ELKHHHHHH
2173 (anti-EGFRvIII) scFv (amino acids 1-246 of SEQ ID NO: 35)
TABLE-US-00040 (SEQIDNO:36) EIQLVQSGAEVKKPGESLRISCKGSGFNIEDYYIHWVRQMPGKGLEWMGR IDPENDETKYGPIFQGHVTISADTSINTVYLQWSSLKASDTAMYYCAFRG GVYWGQGTTVTVSSGGGGSGGGGSGGGGSGGGGSDVVMTQSPDSLAVSLG ERATINCKSSQSLLDSDGKTYLNWLQQKPGQPPKRLISLVSKLDSGVPDR FSGSGSGTDFTLTISSLQAEDVAVYYCWQGTHFPGTFGGGTKVEIK
CD8 hinge/TM (amino acids 247-315 of SEQ ID NO: 35)
TABLE-US-00041 (SEQIDNO:37) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWA PLAGTCGVLLLSLVITLYC
4-1 BB ICD (amino acids 316-357 of SEQ ID NO: 35)
TABLE-US-00042 (SEQIDNO:38) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL
CD3 (amino acids 358-469 of SEQ ID NO: 35)
TABLE-US-00043 (SEQIDNO:39) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR
P2A (amino acids 470-491 of SEQ ID NO: 35)
TABLE-US-00044 (SEQIDNO:40) GSGATNFSLLKQAGDVEENPGP
Ig signal sequence (amino acids 494-514 of SEQ ID NO: 35)
TABLE-US-00045 (SEQIDNO:41) METDTLLLWVLLLWVPGSTGD
Cetuximab (anti-EGFR) scFv (amino acids 515-755 of SEQ ID NO: 35)
TABLE-US-00046 (SEQIDNO:42) DILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKY ASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFGA GTKLELKGGGGSGGGGSGGGGSQVQLKQSGPGLVQPSQSLSITCTVSGFS LTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQV FFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSA
Anti-CD3 scFv (amino acids 761-1003 of SEQ ID NO: 35)
TABLE-US-00047 (SEQIDNO:43) DIKLQQSGAELARPGASVKMSCKTSGYTFTRYTMHWVKQRPGQGLEWIGY INPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYYCARYY DDHYCLDYWGQGTTLTVSSVEGGSGGSGGSGGSGGVDDIQLTQSPAIMSA SPGEKVTMTCRASSSVSYMNWYQQKSGTSPKRWIYDTSKVASGVPYRFSG SGSGTSYSLTISSMEAEDAATYYCQQWSSNPLTFGAGTKLELK
Construct 7-2173 (anti-EGFRvIII) scFv-CD8 Hinge/TM-4-1BB ICD-CD3-P2A-IgK signal sequence-CD19 scFvCD3-scFv-His-tag (SEQ ID NO: 44) including 2173 scFv (amino acids 1-246 of SEQ ID NO: 44; SEQ ID NO: 45), CD8 hinge/TM (amino acids 247-315 of SEQ ID NO: 44; SEQ ID NO: 46), 4-1 BB ICD (amino acids 316-357 of SEQ ID NO: 44; SEQ ID NO: 47), CD3 (amino acids 358-469 of SEQ ID NO: 44; SEQ ID NO: 48), P2A (amino acids 470-491 of SEQ ID NO: 44; SEQ ID NO: 49), Ig signal sequence (amino acids 494-514 of SEQ ID NO: 44; SEQ ID NO: 50), CD19 scFv (amino acids 515-764 of SEQ ID NO: 44; SEQ ID NO: 51), CD3 scFv (amino acids 770-1012 of SEQ ID NO: 44; SEQ ID NO: 52).
TABLE-US-00048 (SEQIDNO:44) EIQLVQSGAEVKKPGESLRISCKGSGFNIEDYYIHWVRQMPGKGLEWMGR IDPENDETKYGPIFQGHVTISADTSINTVYLQWSSLKASDTAMYYCAFRG GVYWGQGTTVTVSSGGGGSGGGGSGGGGSGGGGSDVVMTQSPDSLAVSLG ERATINCKSSQSLLDSDGKTYLNWLQQKPGQPPKRLISLVSKLDSGVPDR FSGSGSGTDFTLTISSLQAEDVAVYYCWQGTHFPGTFGGGTKVEIKTTTP APRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAG TCGVLLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEE EEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDP EMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGL STATKDTYDALHMQALPPRGSGATNFSLLKQAGDVEENPGPPRMETDTLL LWVLLLWVPGSTGDDIQLTQSPASLAVSLGQRATISCKASQSVDYDGDSY LNWYQQIPGQPPKLLIYDASNLVSGIPPRFSGSGSGTDFTLNIHPVEKVD AATYHCQQSTEDPWTFGGGTKLEIKGGGGSGGGGSGGGGSQVQLQQSGAE LVRPGSSVKISCKASGYAFSSYWMNWVKQRPGQGLEWIGQIWPGDGDTNY NGKFKGKATLTADESSSTAYMQLSSLASEDSAVYFCARRETTTVGRYYYA MDYWGQGTTVTVSSGGGGSDIKLQQSGAELARPGASVKMSCKTSGYTFTR YTMHWVKQRPGQGLEWIGYINPSRGYTNYNQKFKDKATLTTDKSSSTAYM QLSSLTSEDSAVYYCARYYDDHYCLDYWGQGTTLTVSSVEGGSGGSGGSG GSGGVDDIQLTQSPAIMSASPGEKVTMTCRASSSVSYMNWYQQKSGTSPK RWIYDTSKVASGVPYRFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSNP LTFGAGTKLELKHHHHHH
2173 (anti-EGFRvIII) scFv (amino acids 1-246 of SEQ ID NO: 44)
TABLE-US-00049 (SEQIDNO:45) EIQLVQSGAEVKKPGESLRISCKGSGFNIEDYYIHWVRQMPGKGLEWMGR IDPENDETKYGPIFQGHVTISADTSINTVYLQWSSLKASDTAMYYCAFRG GVYWGQGTTVTVSSGGGGSGGGGSGGGGSGGGGSDVVMTQSPDSLAVSLG ERATINCKSSQSLLDSDGKTYLNWLQQKPGQPPKRLISLVSKLDSGVPDR FSGSGSGTDFTLTISSLQAEDVAVYYCWQGTHFPGTFGGGTKVEIK
CD8 hinge/TM (amino acids 247-315 of SEQ ID NO: 44)
TABLE-US-00050 (SEQIDNO:46) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWA PLAGTCGVLLLSLVITLYC
4-1 BB ICD (amino acids 316-357 of SEQ ID NO: 44)
TABLE-US-00051 (SEQIDNO:47) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL
CD3 (amino acids 358-469 of SEQ ID NO: 44)
TABLE-US-00052 (SEQIDNO:48) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR
P2A (amino acids 470-491 of SEQ ID NO: 44)
TABLE-US-00053 (SEQIDNO:49) GSGATNFSLLKQAGDVEENPGP
Ig signal sequence (amino acids 494-514 of SEQ ID NO: 44)
TABLE-US-00054 (SEQIDNO:50) METDTLLLWVLLLWVPGSTGD
Anti-CD19 scFv (amino acids 515-764 of SEQ ID NO: 44)
TABLE-US-00055 (SEQIDNO:51) DIQLTQSPASLAVSLGQRATISCKASQSVDYDGDSYLNWYQQIPGQPPKL LIYDASNLVSGIPPRFSGSGSGTDFTLNIHPVEKVDAATYHCQQSTEDPW TFGGGTKLEIKGGGGSGGGGSGGGGSQVQLQQSGAELVRPGSSVKISCKA SGYAFSSYWMNWVKQRPGQGLEWIGQIWPGDGDTNYNGKFKGKATLTADE SSSTAYMQLSSLASEDSAVYFCARRETTTVGRYYYAMDYWGQGTTVTVSS
Anti-CD3 scFv (amino acids 770-1012 of SEQ ID NO: 44)
TABLE-US-00056 (SEQIDNO:52) DIKLQQSGAELARPGASVKMSCKTSGYTFTRYTMHWVKQRPGQGLEWIGY INPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYYCARYY DDHYCLDYWGQGTTLTVSSVEGGSGGSGGSGGSGGVDDIQLTQSPAIMSA SPGEKVTMTCRASSSVSYMNWYQQKSGTSPKRWIYDTSKVASGVPYRFSG SGSGTSYSLTISSMEAEDAATYYCQQWSSNPLTFGAGTKLELK
Construct 8-(NFAT response element)-Ig signal sequence-Cetuximab (anti-EGFR) scFv-CD3-scFv-His-tag-(EF1 promoter)-2173 (anti-EGFRvIII) scFv-CD8 hinge/TM-4-1BB ICD-CD3 (SEQ ID NO: 53) including Ig signal sequence (amino acids 1-21 of SEQ ID NO: 53; SEQ ID NO: 54), Cetuximab scFv (amino acids 22-262 of SEQ ID NO: 53; SEQ ID NO: 55), CD3 scFv (amino acids 268-510 of SEQ ID NO: 53; SEQ ID NO: 56), 2173 scFv (amino acids 517-762 of SEQ ID NO: 53; SEQ ID NO: 57), CD8 hinge/TM (amino 763-831 of SEQ ID NO: 53; SEQ ID NO: 58), 4-1 BB ICD (amino acids 832-873 of SEQ ID NO: 53; SEQ ID NO: 59), CD3 (amino acids 874-985 of SEQ ID NO: 53; SEQ ID NO: 60). [0416] (NFAT response element)
TABLE-US-00057 METDTLLLWVLLLWVPGSTGDDILLTQSPVILSVSPGERVSFSCRASQSI GTNIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVE SEDIADYYCQQNNNWPTTFGAGTKLELKGGGGSGGGGSGGGGSQVQLKQS GPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNT DYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFA YWGQGTLVTVSAGGGGSDIKLQQSGAELARPGASVKMSCKTSGYTFTRYT MHWVKQRPGQGLEWIGYINPSRGYTNYNQKFKDKATLTTDKSSSTAYMQL SSLTSEDSAVYYCARYYDDHYCLDYWGQGTTLTVSSVEGGSGGSGGSGGS GGVDDIQLTQSPAIMSASPGEKVTMTCRASSSVSYMNWYQQKSGTSPKRW IYDTSKVASGVPYRFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSNPLT FGAGTKLELKHHHHHH [0417] (EF1 Promoter)
TABLE-US-00058 (SEQIDNO:53) EIQLVQSGAEVKKPGESLRISCKGSGFNIEDYYIHWVRQMPGKGLEWMGR IDPENDETKYGPIFQGHVTISADTSINTVYLQWSSLKASDTAMYYCAFRG GVYVVGQGTTVTVSSGGGGSGGGGSGGGGSGGGGSDVVMTQSPDSLAVSL GERATINCKSSQSLLDSDGKTYLNWLQQKPGQPPKRLISLVSKLDSGVPD RFSGSGSGTDFTLTISSLQAEDVAVYYCWQGTHFPGTFGGGTKVEIKTTT PAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLA GTCGVLLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPE EEEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRD PEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQG LSTATKDTYDALHMQALPPR [0418] (Note: the two polypeptides noted above are denoted with a single sequence identifier for convenience, but it should be understood that the CAR and BiTE components can be made separately, due to the two separate promoters; see above.)
Ig signal sequence (amino acids 1-21 of SEQ ID NO: 53)
TABLE-US-00059 (SEQIDNO:54) METDTLLLWVLLLWVPGSTGD
Cetuximab (anti-EGFR) scFv (amino acids 22-262 of SEQ ID NO: 53)
TABLE-US-00060 (SEQIDNO:55) DILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIK YASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTF GAGTKLELKGGGGSGGGGSGGGGSQVQLKQSGPGLVQPSQSLSITCTVS GFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNS KSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYVVGQGTLVTVSA
Anti-CD3 scFv (amino acids 268-510 of SEQ ID NO: 53)
TABLE-US-00061 (SEQIDNO:56) DIKLQQSGAELARPGASVKMSCKTSGYTFTRYTMHWVKQRPGQGLEWIG YINPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYYCAR YYDDHYCLDYWGQGTTLTVSSVEGGSGGSGGSGGSGGVDDIQLTQSPAI MSASPGEKVTMTCRASSSVSYMNWYQQKSGTSPKRWIYDTSKVASGVPY RFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSNPLTFGAGTKLELK
2173 (anti-EGFRvIII) scFv (amino acids 517-762 of SEQ ID NO: 53)
TABLE-US-00062 (SEQIDNO:57) EIQLVQSGAEVKKPGESLRISCKGSGFNIEDYYIHWVRQMPGKGLEWMG RIDPENDETKYGPIFQGHVTISADTSINTVYLQWSSLKASDTAMYYCAF RGGVYVVGQGTTVTVSSGGGGSGGGGSGGGGSGGGGSDVVMTQSPDSLA VSLGERATINCKSSQSLLDSDGKTYLNWLQQKPGQPPKRLISLVSKLDS GVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCWQGTHFPGTFGGGTKVE IK
CD8 hinge/TM (amino acids 763-831 of SEQ ID NO: 53)
TABLE-US-00063 (SEQIDNO:58) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIW APLAGTCGVLLLSLVITLYC
4-1 BB ICD (amino acids 832-873 of SEQ ID NO: 53)
TABLE-US-00064 (SEQIDNO:59) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL
CD3 (amino acids 874-985 of SEQ ID NO: 53)
TABLE-US-00065 (SEQIDNO:60) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKP RRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATK DTYDALHMQALPPR
Construct 9-(NFAT response element)-IgK signal sequence-CD19 scFv-CD3-scFv-His-tag-(EF1 Promoter)-2173 (anti-EGFRvIII) scFv-CD8 Hinge/TM-4-1BB ICD-CD3 (SEQ ID NO: 61) including (NFAT response element), Ig signal sequence (amino acids 1-21 of SEQ ID NO: 61; SEQ ID NO: 62), CD19 scFv (amino acids 22-271 of SEQ ID NO: 61; SEQ ID NO: 63), CD3 scFv (amino acids 277-519 of SEQ ID NO: 61; SEQ ID NO: 64), 2173 scFv (amino acids 526-771 of SEQ ID NO: 61; SEQ ID NO: 65), CD8 hinge/TM (amino acids 772-840 of SEQ ID NO: 61; SEQ ID NO: 66), 4-1 BB ICD (amino acids 841-882 of SEQ ID NO: 61; SEQ ID NO: 67), CD3 (amino acids 883-994 of SEQ ID NO: 61; SEQ ID NO: 68). [0419] (NFAT response element)
TABLE-US-00066 METDTLLLWVLLLWVPGSTGDDIQLTQSPASLAVSLGQRATISCKASQS VDYDGDSYLNWYQQIPGQPPKLLIYDASNLVSGIPPRFSGSGSGTDFTL NIHPVEKVDAATYHCQQSTEDPWTFGGGTKLEIKGGGGSGGGGSGGGGS QVQLQQSGAELVRPGSSVKISCKASGYAFSSYWMNWVKQRPGQGLEWIG QIWPGDGDTNYNGKFKGKATLTADESSSTAYMQLSSLASEDSAVYFCAR RETTTVGRYYYAMDYVVGQGTTVTVSSGGGGSDIKLQQSGAELARPGAS VKMSCKTSGYTFTRYTMHWVKQRPGQGLEWIGYINPSRGYTNYNQKFKD KATLTTDKSSSTAYMQLSSLTSEDSAVYYCARYYDDHYCLDYVVGQGTT LTVSSVEGGSGGSGGSGGSGGVDDIQLTQSPAIMSASPGEKVTMTCRAS SSVSYMNWYQQKSGTSPKRWIYDTSKVASGVPYRFSGSGSGTSYSLTIS SMEAEDAATYYCQQWSSNPLTFGAGTKLELKHHHHHH [0420] (EF1a Promoter)
TABLE-US-00067 (SEQIDNO:61) EIQLVQSGAEVKKPGESLRISCKGSGFNIEDYYIHWVRQMPGKGLEWMGR IDPENDETKYGPIFQGHVTISADTSINTVYLQWSSLKASDTAMYYCAFRG GVYVVGQGTTVTVSSGGGGSGGGGSGGGGSGGGGSDVVMTQSPDSLAVSL GERATINCKSSQSLLDSDGKTYLNWLQQKPGQPPKRLISLVSKLDSGVPD RFSGSGSGTDFTLTISSLQAEDVAVYYCWQGTHFPGTFGGGTKVEIKTTT PAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLA GTCGVLLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPE EEEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRD PEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQG LSTATKDTYDALHMQALPPR [0421] (Note: the two polypeptides noted above are denoted with a single sequence identifier for convenience, but it should be understood that the CAR and BiTE components can be made separately, due to the two separate promoters; see above.)
Ig signal sequence (amino acids 1-21 of SEQ ID NO: 61)
TABLE-US-00068 (SEQIDNO:62) METDTLLLWVLLLWVPGSTGD
Anti-CD19 scFv (amino acids 22-271 of SEQ ID NO: 61)
TABLE-US-00069 (SEQIDNO:63) DIQLTQSPASLAVSLGQRATISCKASQSVDYDGDSYLNWYQQIPGQPPKL LIYDASNLVSGIPPRFSGSGSGTDFTLNIHPVEKVDAATYHCQQSTEDPW TFGGGTKLEIKGGGGSGGGGSGGGGSQVQLQQSGAELVRPGSSVKISCKA SGYAFSSYWMNWVKQRPGQGLEWIGQIWPGDGDTNYNGKFKGKATLTADE SSSTAYMQLSSLASEDSAVYFCARRETTTVGRYYYAMDYWGQGTTVTVSS
Anti-CD3 scFv (amino acids 277-519 of SEQ ID NO: 61)
TABLE-US-00070 (SEQIDNO:64) DIKLQQSGAELARPGASVKMSCKTSGYTFTRYTMHWVKQRPGQGLEWIGY INPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYYCARYY DDHYCLDYWGQGTTLTVSSVEGGSGGSGGSGGSGGVDDIQLTQSPAIMSA SPGEKVTMTCRASSSVSYMNWYQQKSGTSPKRWIYDTSKVASGVPYRFSG SGSGTSYSLTISSMEAEDAATYYCQQWSSNPLTFGAGTKLELK
2173 (anti-EGFRvIII) scFv (amino acids 526-771 of SEQ ID NO: 61)
TABLE-US-00071 (SEQIDNO:65) EIQLVQSGAEVKKPGESLRISCKGSGFNIEDYYIHWVRQMPGKGLEWMGR IDPENDETKYGPIFQGHVTISADTSINTVYLQWSSLKASDTAMYYCAFRG GVYVVGQGTTVTVSSGGGGSGGGGSGGGGSGGGGSDVVMTQSPDSLAVSL GERATINCKSSQSLLDSDGKTYLNWLQQKPGQPPKRLISLVSKLDSGVPD RFSGSGSGTDFTLTISSLQAEDVAVYYCWQGTHFPGTFGGGTKVEIK
CD8 hinge/TM (amino acids 772-840 of SEQ ID NO: 61)
TABLE-US-00072 (SEQIDNO:66) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWA PLAGTCGVLLLSLVITLYC
4-1 BB ICD (amino acids 841-882 of SEQ ID NO: 61)
TABLE-US-00073 (SEQIDNO:67) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL
CD3 (amino acids 883-994 of SEQ ID NO: 61)
TABLE-US-00074 (SEQIDNO:68) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR
Construct 10-CD8 signal sequence-Anti-GARP scFv (H-L)-CD8 hinge/TM-4-1BB ICD-CD3 (SEQ ID NO: 69) including CD8 signal sequence (amino acids 1-21 of SEQ ID NO: 69; SEQ ID NO: 70), anti-GARP scFv (H-L) (amino acids 22-274 of SEQ ID NO: 69; SEQ ID NO: 71), CD8 hinge/TM (amino acids 275-343 of SEQ ID NO: 69; SEQ ID NO: 72), 4-1 BB ICD (amino acids 344-385 of SEQ ID NO: 69; SEQ ID NO: 73), CD3 (amino acids 386-497 of SEQ ID NO: 69; SEQ ID NO: 74).
TABLE-US-00075 (SEQIDNO:69) MALPVTALLLPLALLLHAARPEVQLVQPGAELRNSGASVKVSCKASGYRF TSYYIDWVRQAPGQGLEWMGRIDPEDGGTKYAQKFQGRVTFTADTSTSTA YVELSSLRSEDTAVYYCARNEWETVVVGDLMYEYEYWGQGTQVTVSSGGG GSGGGGSGGGGSGGGGSDIQMTQSPSSLSASLGDRVTITCQASQSISSYL AWYQQKPGQAPNILIYGASRLKTGVPSRFSGSGSGTSFTLTISGLEAEDA GTYYCQQYASVPVTFGQGTKVELKTTTPAPRPPTPAPTIASQPLSLRPEA CRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKL LYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQ GQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKD KMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
CD8 signal sequence (amino acids 1-21 of SEQ ID NO: 69)
TABLE-US-00076 (SEQIDNO:70) MALPVTALLLPLALLLHAARP
Anti-GARP scFv (H-L) (amino acids 22-274 of SEQ ID NO: 69)
TABLE-US-00077 (SEQIDNO:71) EVQLVQPGAELRNSGASVKVSCKASGYRFTSYYIDWVRQAPGQGLEWMGR IDPEDGGTKYAQKFQGRVTFTADTSTSTAYVELSSLRSEDTAVYYCARNE WETVVVGDLMYEYEYWGQGTQVTVSSGGGGSGGGGSGGGGSGGGGSDIQM TQSPSSLSASLGDRVTITCQASQSISSYLAWYQQKPGQAPNILIYGASRL KTGVPSRFSGSGSGTSFTLTISGLEAEDAGTYYCQQYASVPVTFGQGTKV ELK
CD8 hinge/TM (amino acids 275-343 of SEQ ID NO: 69)
TABLE-US-00078 (SEQIDNO:72) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWA PLAGTCGVLLLSLVITLYC
4-1 BB ICD (amino acids 344-385 of SEQ ID NO: 69)
TABLE-US-00079 (SEQIDNO:73) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL
CD3 (amino acids 386-497 of SEQ ID NO: 69)
TABLE-US-00080 (SEQIDNO:74) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR
Construct 11-CD8 signal sequence-Anti-GARP scFv (L-H)-CD8 hinge/TM-4-1BB ICD-CD3 (SEQ ID NO: 75) including CD8 signal sequence (amino acids 1-21 of SEQ ID NO: 75; SEQ ID NO: 76), anti-GARP scFv (L-H) (amino acids 22-274 of SEQ ID NO: 75; SEQ ID NO: 77), CD8 hinge/TM (amino acids 275-343 of SEQ ID NO: 75; SEQ ID NO: 78), 4-1 BB ICD (amino acids 344-385 of SEQ ID NO: 75; SEQ ID NO: 79), CD3 (amino acids 386-497 of SEQ ID NO: 75; SEQ ID NO: 80).
TABLE-US-00081 (SEQIDNO:75) MALPVTALLLPLALLLHAARPDIQMTQSPSSLSASLGDRVTITCQASQSI SSYLAWYQQKPGQAPNILIYGASRLKTGVPSRFSGSGSGTSFTLTISGLE AEDAGTYYCQQYASVPVTFGQGTKVELKGGGGSGGGGSGGGGSGGGGSEV QLVQPGAELRNSGASVKVSCKASGYRFTSYYIDWVRQAPGQGLEWMGRID PEDGGTKYAQKFQGRVTFTADTSTSTAYVELSSLRSEDTAVYYCARNEWE TVVVGDLMYEYEYWGQGTQVTVSSTTTPAPRPPTPAPTIASQPLSLRPEA CRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKL LYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQ GQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKD KMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
CD8 signal sequence (amino acids 1-21 of SEQ ID NO: 75)
TABLE-US-00082 (SEQIDNO:76) MALPVTALLLPLALLLHAARP
Anti-GARP scFv (L-H) (amino acids 22-274 of SEQ ID NO: 75)
TABLE-US-00083 (SEQIDNO:77) DIQMTQSPSSLSASLGDRVTITCQASQSISSYLAWYQQKPGQAPNILIYG ASRLKTGVPSRFSGSGSGTSFTLTISGLEAEDAGTYYCQQYASVPVTFGQ GTKVELKGGGGSGGGGSGGGGSGGGGSEVQLVQPGAELRNSGASVKVSCK ASGYRFTSYYIDWVRQAPGQGLEWMGRIDPEDGGTKYAQKFQGRVTFTAD TSTSTAYVELSSLRSEDTAVYYCARNEWETVVVGDLMYEYEYWGQGTQVT VSS
CD8 hinge/TM (amino acids 275-343 of SEQ ID NO: 75)
TABLE-US-00084 (SEQIDNO:78) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWA PLAGTCGVLLLSLVITLYC
4-1 BB ICD (amino acids 344-385 of SEQ ID NO: 75)
TABLE-US-00085 (SEQIDNO:79) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL
CD3 (amino acids 386-497 of SEQ ID NO: 75)
TABLE-US-00086 (SEQIDNO:80) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR
TABLE-US-00087 TABLE3 Anti-GARPsequencesofConstruct10 andConstruct11 SEQIDNO:81 CDR-H1 SYYID SEQIDNO:82 CDR-H2 RIDPEDGGTKYAQKFQG SEQIDNO:83 CDR-H3 NEWETVVVGDLMYEYEY SEQIDNO:84 CDR-L1 QASQSISSYLA SEQIDNO:85 CDR-L2 GASRLKT SEQIDNO:86 CDR-L3 QQYASVPVT SEQIDNO:87 VH EVQLVQPGAELRNSGAS VKVSCKASGYRFTSYYI DWVRQAPGQGLEWMGRI DPEDGGTKYAQKFQGRV TFTADTSTSTAYVELSS LRSEDTAVYYCARNEWE TVVVGDLMYEYEYWGQG TQVTVSS SEQIDNO:88 VL DIQMTQSPSSLSASLGD RVTITCQASQSISSYLA WYQQKPGQAPNILIYGA SRLKTGVPSRFSGSGSG TSFTLTISGLEAEDAGT YYCQQYASVPVTFGQGT KVELK
TABLE-US-00088 TABLE4 Anti-LAPsequencesofConstruct2 andConstruct3 SEQIDNO:89 CDR-H1 RASQDISNYLN SEQIDNO:90 CDR-H2 YTSRLHS SEQIDNO:91 CDR-H3 QQGDTLPWT SEQIDNO:92 CDR-L1 DYYMS SEQIDNO:93 CDR-L2 FIRNKPNGYTTEYSASV KG SEQIDNO:94 CDR-L3 YTGGGYFDY SEQIDNO:95 VH MKLWLNWIFLVTLLNDI QCEVKLVESGGGLVQPG GSLSLSCAASGFTFTDY YMSWVRQPPGKALEWLG FIRNKPNGYTTEYSASV KGRFTISRDNSQSILYL QMNVLRAEDSATYYCAR YTGGGYFDYWGQGTTLT VSS SEQIDNO:96 VL MMSSAQFLGLLLLCFQG TRCDIQMTQTTSSLSAS LGDRLTISCRASQDISN YLNWYQQKPDGTVKLLI YYTSRLHSGVPSRFSGS GSGTDYSLTISNLEQAD IATYFCQQGDTLPWTFG GGTKLEIK
Construct 12 (Tandem CAR)-IL-13 zetakine-linker-EGFRvIII scFv-CD8 hinge/TM-4-1BB ICD-CD3 (SEQ ID NO: 100) including IL-13 zetakine (SEQ ID NO: 101 (amino acids 1-112 of SEQ ID NO: 100)); linker (SEQ ID NO: 102 (amino acids 113-132 of SEQ ID NO: 100)); EGFRvIII scFv (SEQ ID NO: 103 (amino acids 133-378 of SEQ ID NO: 100)); CD8 hinge/TM (SEQ ID NO: 104 (amino acids 379-447 of SEQ ID NO: 100)); 4-1 BB ICD (SEQ ID NO: 105 (amino acids 448-489 of SEQ ID NO: 100)); and CD3 (SEQ ID NO: 106 (amino acids 490-601 of SEQ ID NO: 100))
TABLE-US-00089 (SEQIDNO:100) GPVPPSTALRYLIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESL INVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLL HLKKLFREGRFNGGGGSGGGGSGGGGSGGGGSEIQLVQSGAEVKKPGESL RISCKGSGFNIEDYYIHWVRQMPGKGLEWMGRIDPENDETKYGPIFQGHV TISADTSINTVYLQWSSLKASDTAMYYCAFRGGVYWGQGTTVTVSSGGGG SGGGGSGGGGSGGGGSDVVMTQSPDSLAVSLGERATINCKSSQSLLDSDG KTYLNWLQQKPGQPPKRLISLVSKLDSGVPDRFSGSGSGTDFTLTISSLQ AEDVAVYYCWQGTHFPGTFGGGTKVEIKTTTPAPRPPTPAPTIASQPLSL RPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRG RKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAP AYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNE LQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPP R
IL-13 zetakine (amino acids 1-112 of SEQ ID NO: 100)
TABLE-US-00090 (SEQIDNO:101) GPVPPSTALRYLIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESL INVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLL HLKKLFREGRFN
Linker (amino acids 113-132 of SEQ ID NO: 100)
TABLE-US-00091 (SEQIDNO:102) GGGGSGGGGSGGGGSGGGGS
Anti-EGFRvIII scFv (amino acids 133-378 of SEQ ID NO: 100)
TABLE-US-00092 (SEQIDNO:103) EIQLVQSGAEVKKPGESLRISCKGSGFNIEDYYIHWVRQMPGKGLEWMGR IDPENDETKYGPIFQGHVTISADTSINTVYLQWSSLKASDTAMYYCAFRG GVYWGQGTTVTVSSGGGGSGGGGSGGGGSGGGGSDVVMTQSPDSLAVSLG ERATINCKSSQSLLDSDGKTYLNWLQQKPGQPPKRLISLVSKLDSGVPDR FSGSGSGTDFTLTISSLQAEDVAVYYCWQGTHFPGTFGGGTKVEIK
CD8 hinge/TM (amino acids 379-447 of SEQ ID NO: 100)
TABLE-US-00093 (SEQIDNO:104) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWA PLAGTCGVLLLSLVITLYC
4-1 BB ICD (amino acids 448-489 of SEQ ID NO: 100)
TABLE-US-00094 (SEQIDNO:105) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL
CD3 (amino acids 490-601 of SEQ ID NO: 100)
TABLE-US-00095 (SEQIDNO:106) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR
Further sequences described herein are as follows:
TABLE-US-00096 TABLE5 Sequences SEQ ID NO: Description Sequence 98 EGFRBiTE DILLTQSPVILSVSPGERVSFSCRASQSI GTNIHWYQQRTNGSPRLLIKYASESISGI PSRFSGSGSGTDFTLSINSVESEDIADYY CQQNNNWPTTFGAGTKLELKGGGGSGGGG SGGGGSQVQLKQSGPGLVQPSQSLSITCT VSGFSLTNYGVHWVRQSPGKGLEWLGVIW SGGNTDYNTPFTSRLSINKDNSKSQVFFK MNSLQSNDTAIYYCARALTYYDYEFAYWG QGTLVTVSAGGGGSDIKLQQSGAELARPG ASVKMSCKTSGYTFTRYTMHWVKQRPGQG LEWIGYINPSRGYTNYNQKFKDKATLTTD KSSSTAYMQLSSLTSEDSAVYYCARYYDD HYCLDYWGQGTTLTVSSVEGGSGGSGGSG GSGGVDDIQLTQSPAIMSASPGEKVTMTC RASSSVSYMNWYQQKSGTSPKRWIYDTSK VASGVPYRFSGSGSGTSYSLTISSMEAED AATYYCQQWSSNPLTFGAGTKLELK 99 CD19BiTE DIQLTQSPASLAVSLGQRATISCKASQSV DYDGDSYLNWYQQIPGQPPKLLIYDASNL VSGIPPRFSGSGSGTDFTLNIHPVEKVDA ATYHCQQSTEDPWTFGGGTKLEIKGGGGS GGGGSGGGGSQVQLQQSGAELVRPGSSVK ISCKASGYAFSSYVVMNWVKQRPGQGLEW IGQIWPGDGDTNYNGKFKGKATLTADESS STAYMQLSSLASEDSAVYFCARRETTTVG RYYYAMDYVVGQGTTVTVSSGGGGSDIKL QQSGAELARPGASVKMSCKTSGYTFTRYT MHWVKQRPGQGLEWIGYINPSRGYTNYNQ KFKDKATLTTDKSSSTAYMQLSSLTSEDS AVYYCARYYDDHYCLDYVVGQGTTLTVSS VEGGSGGSGGSGGSGGVDDIQLTQSPAIM SASPGEKVTMTCRASSSVSYMNWYQQKSG TSPKRWIYDTSKVASGVPYRFSGSGSGTS YSLTISSMEAEDAATYYCQQWSSNPLTFG AGTKLELK 111 Anti-EGFRvIII EIQLVQSGAEVKKPGESLRISCKGSGFNI (2173)VH EDYYIHWVRQMPGKGLEWMGRIDPENDET KYGPIFQGHVTISADTSINTVYLQWSSLK ASDTAMYYCAFRGGVYWGQGTTVTVSS 112 Anti-EGFRvIII DVVMTQSPDSLAVSLGERATINCKSSQSL (2173)VL LDSDGKTYLNWLQQKPGQPPKRLISLVSK LDSGVPDRFSGSGSGTDFTLTISSLQAED VAVYYCWQGTHFPGTFGGGTKVEIK 113 Anti-EGFRvIII EIQLQQSGAELVKPGASVKLSCTGSGFNI (3C10)VH EDYYIHWVKQRTEQGLEWIGRIDPENDET KYGPIFQGRATITADTSSNTVYLQLSSLT SEDTAVYYCAFRGGVYWGPGTTLTVSS 114 Anti-EGFRvIII HMDVVMTQSPLTLSVAIGQSASISCKSSQ (3C10)VL SLLDSDGKTYLNWLLQRPGQSPKRLISLV SKLDSGVPDRFTGSGSGTDFTLRISRVEA EDLGIYYCWQGTHFPGTFGGGTKLEIK 115 Construct5 EIQLQQSGAELVKPGASVKLSCTGSGFNI CARsequence EDYYIHWVKQRTEQGLEWIGRIDPENDET only(noBiTE) KYGPIFQGRATITADTSSNTVYLQLSSLT SEDTAVYYCAFRGGVYWGPGTTLTVSSGG GGSGGGGSGGGGSHMDVVMTQSPLTLSVA IGQSASISCKSSQSLLDSDGKTYLNWLLQ RPGQSPKRLISLVSKLDSGVPDRFTGSGS GTDFTLRISRVEAEDLGIYYCWQGTHFPG TFGGGTKLEIKTTTPAPRPPTPAPTIASQ PLSLRPEACRPAAGGAVHTRGLDFACDIY IWAPLAGTCGVLLLSLVITLYCKRGRKKL LYIFKQPFMRPVQTTQEEDGCSCRFPEEE EGGCELRVKFSRSADAPAYQQGQNQLYNE LNLGRREEYDVLDKRRGRDPEMGGKPRRK NPQEGLYNELQKDKMAEAYSEIGMKGERR RGKGHDGLYQGLSTATKDTYDALHMQALP PR 116 Construct6 EIQLVQSGAEVKKPGESLRISCKGSGFNI CARsequence EDYYIHWVRQMPGKGLEWMGRIDPENDET only(noBiTE) KYGPIFQGHVTISADTSINTVYLQWSSLK ASDTAMYYCAFRGGVYWGQGTTVTVSSGG GGSGGGGSGGGGSGGGGSDVVMTQSPDSL AVSLGERATINCKSSQSLLDSDGKTYLNW LQQKPGQPPKRLISLVSKLDSGVPDRFSG SGSGTDFTLTISSLQAEDVAVYYCWQGTH FPGTFGGGTKVEIKTTTPAPRPPTPAPTI ASQPLSLRPEACRPAAGGAVHTRGLDFAC DIYIWAPLAGTCGVLLLSLVITLYCKRGR KKLLYIFKQPFMRPVQTTQEEDGCSCRFP EEEEGGCELRVKFSRSADAPAYQQGQNQL YNELNLGRREEYDVLDKRRGRDPEMGGKP RRKNPQEGLYNELQKDKMAEAYSEIGMKG ERRRGKGHDGLYQGLSTATKDTYDALHMQ ALPPR 117 Construct4 QVQLKQSGPGLVQPSQSLSITCTVSGFSL CARsequence TNYGVHWVRQSPGKGLEWLGVIWSGGNTD only(no YNTPFTSRLSINKDNSKSQVFFKMNSLQS camelid) NDTAIYYCARALTYYDYEFAYVVGQGTLV TVSAGGGGSGGGGSGGGGSGGGGSDILLT QSPVILSVSPGERVSFSCRASQSIGTNIH WYQQRTNGSPRLLIKYASESISGIPSRFS GSGSGTDFTLSINSVESEDIADYYCQQNN NWPTTFGAGTKLELKTTTPAPRPPTPAPT IASQPLSLRPEACRPAAGGAVHTRGLDFA CDIYIWAPLAGTCGVLLLSLVITLYCKRG RKKLLYIFKQPFMRPVQTTQEEDGCSCRF PEEEEGGCELRVKFSRSADAPAYQQGQNQ LYNELNLGRREEYDVLDKRRGRDPEMGGK PRRKNPQEGLYNELQKDKMAEAYSEIGMK GERRRGKGHDGLYQGLSTATKDTYDALHM QALPPR
[0422] Some embodiments of the technology described herein can be defined according to any of the following numbered paragraphs: [0423] 1. An immune cell engineered to express: [0424] (a) a chimeric antigen receptor (CAR) polypeptide comprising an extracellular domain comprising a first antigen-binding domain that binds to a first antigen and a second antigen-binding domain that binds to a second antigen; and [0425] (b) a bispecific T cell engager (BiTE), wherein the BiTE binds to a target antigen and a T cell antigen. [0426] 2. The immune cell of paragraph 1, wherein the CAR polypeptide comprises a transmembrane domain and an intracellular signaling domain. [0427] 3. The immune cell of paragraph 1 or 2, wherein the CAR polypeptide further comprises one or more co-stimulatory domains. [0428] 4. The immune cell of any one of paragraphs 1-3, wherein the first and second antigens are glioblastoma antigens. [0429] 5. The immune cell of any one of paragraphs 1-4, wherein the first and second antigens are independently selected from epidermal growth factor receptor (EGFR), epidermal growth factor receptor variant III (EGFRvIII), CD19, CD79b, CD37, prostate-specific membrane antigen (PSMA), prostate stem cell antigen (PSCA), interleukin-13 receptor alpha 2 (IL-13R2), ephrin type-A receptor 1 (EphA1), human epidermal growth factor receptor 2 (HER2), mesothelin, mucin 1, cell surface associated (MUC1), or mucin 16, cell surface associated (MUC16). [0430] 6. The immune cell of any one of paragraphs 1-5, wherein the first antigen-binding domain and/or the second antigen-binding domain comprises an antigen-binding fragment of an antibody. [0431] 7. The immune cell of paragraph 6, wherein the antigen-binding fragment of the antibody comprises a single domain antibody or a single chain variable fragment (scFv). [0432] 8. The immune cell of any one of paragraphs 1-7, wherein the first antigen-binding domain and/or the second antigen-binding domain comprises a ligand of the first and/or second antigen. [0433] 9. The immune cell of any one of paragraphs 1-8, wherein the extracellular domain does not comprise a linker between the first antigen-binding domain and the second antigen-binding domain. [0434] 10. The immune cell of any one of paragraphs 1-8, wherein the first antigen-binding domain is connected to the second antigen-binding domain by a linker. [0435] 11. The immune cell of paragraph 10, wherein the linker comprises an amino acid having at least 90% sequence identity to the linker of SEQ ID NO: 102, 107, 108, 109, or 110. [0436] 12. The immune cell of any one of paragraphs 2-11, wherein the transmembrane domain comprises a hinge/transmembrane domain. [0437] 13. The immune cell of paragraph 12, wherein the hinge/transmembrane domain comprises the hinge/transmembrane domain of an immunoglobulin-like protein, CD28, CD8, or 4-1 BB. [0438] 14. The immune cell of paragraph 12 or 13, wherein the transmembrane domain comprises the hinge/transmembrane domain of CD8, optionally comprising the amino acid sequence of SEQ ID NO: 4, 10, 16, 22, 28, 37, 46, 58, 66, 72, 78, or 104, or an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 4, 10, 16, 22, 28, 37, 46, 58, 66, 72, 78, or 104. [0439] 15. The immune cell of any one of paragraphs 2-14, wherein the intracellular signaling domain comprises the intracellular signaling domain of TCF, FcR, FcR, CD3, CD3, CD3, CD3, CD3CD22, CD79a, CD79b, or CD66d. [0440] 16. The immune cell of paragraph 15, wherein the intracellular signaling domain comprises the intracellular signaling domain of CD, optionally comprising the amino acid sequence of SEQ ID NO: 6, 12, 18, 24, 30, 39, 48, 60, 68, 74, 80, or 106, or an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 6, 12, 18, 24, 30, 39, 48, 60, 68, 74, 80, or 106. [0441] 17. The immune cell of any one of paragraphs 3-16, wherein the co-stimulatory domain comprises the co-stimulatory domain of 4-1 BB, CD27, CD28, or OX-40. [0442] 18. The immune cell of paragraph 17, wherein the co-stimulatory domain comprises the co-stimulatory domain of 4-1 BB, optionally comprising the amino acid sequence of SEQ ID NO: 5, 11, 17, 23, 29, 38, 47, 59, 67, 73, 79, or 105, or an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 5, 11, 17, 23, 29, 38, 47, 59, 67, 73, 79, or 105. [0443] 19. The immune cell of any one of paragraphs 1-18, wherein the first antigen-binding domain comprises an IL-13R2-binding domain. [0444] 20. The immune cell of any one of paragraphs 1-19, wherein the second antigen-binding domain comprises an EGFRvIII-binding domain. [0445] 21. The immune cell of paragraph 19 or 20, wherein the IL-13R2-binding domain comprises an anti-IL-13R2 scFv or a ligand of IL-13R2. [0446] 22. The immune cell of paragraph 21, wherein the ligand of IL-13R2 comprises IL-13 or IL-13 zetakine, or an antigen-binding fragment thereof. [0447] 23. The immune cell of any one of paragraphs 19-22, wherein the IL-13R2-binding domain comprises an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 101. [0448] 24. The immune cell of paragraph 23, wherein the IL-13R2-binding domain comprises the amino acid sequence of SEQ ID NO: 101. [0449] 25. The immune cell of any one of paragraphs 20-24, wherein the EGFRvIII-binding domain comprises an antigen-binding fragment of an antibody. [0450] 26. The immune cell of any one of paragraphs 20-25, wherein the EGFRvIII-binding domain comprises an anti-EGFRvIII scFv. [0451] 27. The immune cell of paragraph 26, wherein the anti-EGFRvIII scFv comprises a heavy chain variable domain (VH) comprising an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 111 or 113 and/or a light chain variable domain (VL) comprising an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 112 or 114. [0452] 28. The immune cell of paragraph 27, wherein the VH comprises the amino acid sequence of SEQ ID NO: 111 or 113 and/or the VL comprises the amino acid sequence of SEQ ID NO: 112 or 114. [0453] 29. The immune cell of any one of paragraphs 20-28, wherein the EGFRvIII-binding domain comprises an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 103. [0454] 30. The immune cell of paragraph 29, wherein the EGFRvIII-binding domain comprises the amino acid sequence of SEQ ID NO: 103. [0455] 31. The immune cell of any one of paragraphs 1-30, wherein the CAR polypeptide comprises an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 100. [0456] 32. The immune cell of paragraph 31, wherein the CAR polypeptide comprises the amino acid sequence of SEQ ID NO: 100. [0457] 33. An immune cell engineered to express: [0458] (i) a CAR polypeptide comprising an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 100; and [0459] (ii) a BiTE, wherein the BiTE binds to a target antigen and a T cell antigen. [0460] 34. An immune cell engineered to express: [0461] (i) a CAR polypeptide comprising the amino acid sequence of SEQ ID NO: 100; and [0462] (ii) a BiTE, wherein the BiTE binds to a target antigen and a T cell antigen. [0463] 35. The immune cell of any one of paragraphs 1-34, wherein the target antigen is a glioblastoma-associated antigen selected from one of EGFR, EGFRvIII, CD19, CD79b, CD37, PSMA, PSCA, IL-13R2, EphA1, HER2, mesothelin, MUC1, or MUC16. [0464] 36. The immune cell of any one of paragraphs 1-35, wherein the T cell antigen is CD3. [0465] 37. The immune cell of any one of paragraphs 1-36, wherein the target antigen is EGFR and the T cell antigen is CD3. [0466] 38. The immune cell of any one of paragraphs 1-37, wherein the BiTE comprises an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 98 or 99. [0467] 39. The immune cell of paragraph 38, wherein the BiTE comprises the amino acid sequence of SEQ ID NO: 98 or 99. [0468] 40. The immune cell of any one of paragraphs 1-39, wherein the immune cell is a T or natural killer (NK) cell. [0469] 41. The immune cell of any one of paragraphs 1-40, wherein the immune cell is a human cell. [0470] 42. A polynucleotide encoding the CAR polypeptide and the BiTE of any one of paragraphs 1-41. [0471] 43. The polynucleotide of paragraph 42, wherein the polynucleotide comprises a CAR polypeptide encoding sequence and a BiTE encoding sequence, and wherein the CAR polypeptide encoding sequence and the BiTE encoding sequence are separated by a ribosome skipping moiety. [0472] 44. The polynucleotide of paragraph 42 or 43, wherein the CAR polypeptide and/or the BiTE is expressed under a constitutive promoter. [0473] 45. The polynucleotide of paragraph 44, wherein the constitutive promoter comprises an elongation factor-1 alpha (EF1) promoter. [0474] 46. The polynucleotide of paragraph 42 or 43, wherein the CAR polypeptide and/or the BiTE is expressed under an inducible promoter. [0475] 47. The polynucleotide of paragraph 46, wherein the inducible promoter is inducible by T cell receptor (TCR) or CAR signaling. [0476] 48. The polynucleotide of paragraph 47, wherein the inducible promoter comprises a nuclear factor of activated T cells (NFAT) response element. [0477] 49. The polynucleotide of paragraph 42 or 43, wherein the CAR polypeptide and the BiTE are each expressed under a constitutive promoter. [0478] 50. The polynucleotide of paragraph 42 or 43, wherein the CAR polypeptide is expressed under a constitutive promoter and the BiTE is expressed under an inducible promoter. [0479] 51. The polynucleotide of any one of paragraphs 42-50, further comprising a suicide gene. [0480] 52. The polynucleotide of any one of paragraphs 42-51, further comprising a sequence encoding one or more signal sequences. [0481] 53. A vector comprising the polynucleotide of any one of paragraphs 42-52. [0482] 54. The vector of paragraph 53, wherein the vector is a lentiviral vector. [0483] 55. A pharmaceutical composition comprising the immune cell of any one of paragraphs 1-41, the polynucleotide of any one of paragraphs 42-52, or the vector of paragraph 53 or 54. [0484] 56. A method of treating a cancer in a subject in need thereof, the method comprising administering the immune cell of any one of paragraphs 1-41, the polynucleotide of any one of paragraphs 42-52, the vector of paragraph 53 or 54, or the pharmaceutical composition of paragraph 55 to the subject. [0485] 57. The method of paragraph 56, wherein the cancer is glioblastoma, lung cancer, pancreatic cancer, lymphoma, or myeloma, optionally wherein the cancer comprises expressing one or more of the group consisting of EGFR, EGFRvIII, CD19, CD79b, CD37, PSMA, PSCA, IL-13R2, EphA1, HER2, mesothelin, MUC1, and MUC16. [0486] 58. The method of paragraph 57, wherein the glioblastoma comprises cells expressing one or more of the group consisting of IL-13R2, EGFRvIII, EGFR, HER2, mesothelin, and EphA1. [0487] 59. The method of paragraph 57 or 58, wherein the glioblastoma comprises cells with reduced EGFRvIII expression. [0488] 60. An immune cell engineered to express: [0489] (i) a CAR polypeptide comprising an EGFR-binding domain, wherein the CAR polypeptide comprises an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 117; and [0490] (ii) an anti-GARP camelid comprising an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 25. [0491] 61. An immune cell engineered to express: [0492] (i) a CAR polypeptide comprising an EGFRvIII-binding domain, wherein the CAR polypeptide comprises an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 115 or 116; and [0493] (ii) a BiTE, wherein the BiTE binds to EGFR and CD3, comprising an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 98 or 99. [0494] 62. A polynucleotide encoding the CAR polypeptide and the anti-GARP camelid of paragraph 60. [0495] 63. A polynucleotide encoding the CAR polypeptide and the BiTE of paragraph 61. [0496] 64. The polynucleotide of paragraph 62 or 63, further comprising a suicide gene. [0497] 65. The polynucleotide of any one of paragraphs 62-64, further comprising a sequence encoding one or more signal sequences. [0498] 66. A vector comprising the polynucleotide of any one of paragraphs 62-65. [0499] 67. The vector of paragraph 66, wherein the vector is a lentiviral vector. [0500] 68. A pharmaceutical composition comprising the immune cell of paragraph 60 or 61, the polynucleotide of any one of paragraphs 62-65, or the vector of paragraph 66 or 67. [0501] 69. A method of treating glioblastoma having reduced EGFRvIII expression in a subject comprising administering to the subject an immune cell engineered to express: (i) a CAR polypeptide comprising an extracellular EGFRvIII-binding domain; and (ii) a BiTE, wherein the immune cell is optionally selected from the immune cell of any one of paragraphs 1-41, and 61. [0502] 70. A method of preventing or reducing immunosuppression in the tumor microenvironment in a subject comprising administering to the subject an immune cell comprising (i) a CAR comprising an extracellular target binding domain; and (ii) a BiTE, wherein the immune cell is optionally selected from the immune cell of any one of paragraphs 1-41, 60, and 61. [0503] 71. A method of preventing or reducing T cell exhaustion in the tumor microenvironment in a subject, the method comprising administering to the subject an immune cell comprising (i) a CAR comprising an extracellular target binding domain; and (ii) a BiTE, wherein the immune cell is optionally selected from the immune cell of any one of paragraphs 1-41, 60, and 61. [0504] 72. A method of treating a cancer having heterogeneous antigen expression in a subject, the method comprising administering to the subject an immune cell comprising (i) a CAR comprising an extracellular target binding domain; and (ii) a BiTE, wherein the immune cell is optionally selected from the immune cell of any one of paragraphs 1-41, 60, and 61. [0505] 73. The method of paragraph 72, wherein the cancer is glioblastoma, prostate cancer, lung cancer, pancreatic cancer, lymphoma, or myeloma. [0506] 74. The method of paragraph 72 or 73, wherein the cancer comprises cells expressing one or more of the group consisting of EGFR, EGFRvIII, CD19, PSMA, PSCA, IL-13R2, EphA1, Her2, mesothelin, MUC1, and MUC16. [0507] 75. A CAR T cell comprising a heterologous nucleic acid molecule, wherein the heterologous nucleic acid molecule comprises: [0508] (a) a first polynucleotide encoding a CAR comprising an extracellular antigen-binding domain, a transmembrane domain, and an intracellular signaling domain; and [0509] (b) a second polynucleotide encoding a therapeutic agent. [0510] 76. The CAR T cell of paragraph 75, wherein the therapeutic agent comprises an antibody reagent. [0511] 77. The CAR T cell of paragraph 76, wherein the antibody reagent comprises a single chain antibody or a single domain antibody. [0512] 78. The CAR T cell of paragraph 76, wherein the antibody reagent comprises a bispecific antibody reagent. [0513] 79. The CAR T cell of paragraph 78, wherein the bispecific antibody reagent comprises a BiTE. [0514] 80. The CAR T cell of paragraph 77, wherein the single domain antibody comprises a camelid antibody. [0515] 81. The CAR T cell of paragraph 75, wherein the therapeutic agent comprises a cytokine. [0516] 82. The CAR T cell of any one of paragraphs 75-81, wherein the CAR and the therapeutic agent are produced as separate CAR and therapeutic agent molecules. [0517] 83. The CAR T cell of paragraph 82, wherein the CAR T cell comprises a ribosome skipping moiety between the first polynucleotide encoding the CAR and the second polynucleotide encoding the therapeutic agent. [0518] 84. The CAR T cell of paragraph 83, wherein the ribosome skipping moiety comprises a 2A peptide. [0519] 85. The CAR T cell of paragraph 84, wherein the 2A peptide comprises P2A or T2A. [0520] 86. The CAR T cell of any one of paragraphs 75-85, wherein the CAR and the therapeutic agent are each constitutively expressed. [0521] 87. The CAR T cell of any one of paragraphs 75-86, wherein expression of the CAR and the therapeutic agent is driven by an EF1 promoter. [0522] 88. The CAR T cell of any one of paragraphs 75-85, wherein the therapeutic agent is expressed under the control of an inducible promoter, which is optionally inducible by T cell receptor or CAR signaling. [0523] 89. The CAR T cell of paragraph 88, wherein the inducible promoter comprises the NFAT promoter. [0524] 90. The CAR T cell of any one of paragraphs 75-89, wherein the CAR is expressed under the control of a constitutive promoter and the therapeutic agent is expressed under the control of an inducible promoter, which is optionally inducible by T cell receptor or CAR signaling. [0525] 91. The CAR T cell of any one of paragraphs 75-90, wherein the CAR further comprises one or more co-stimulatory domains. [0526] 92. The CAR T cell of any one of paragraphs 75-91, wherein the antigen-binding domain of the CAR comprises an antibody, a single chain antibody, a single domain antibody, or a ligand. [0527] 93. The CAR T cell of any one of paragraphs 75-92, wherein the transmembrane domain comprises a hinge/transmembrane domain. [0528] 94. The CAR T cell of paragraph 93, wherein the hinge/transmembrane domain comprises the hinge/transmembrane domain of an immunoglobulin-like protein, CD28, CD8, or 4-1 BB. [0529] 95. The CAR T cell of any one of paragraphs 75-94, wherein the transmembrane domain of the CAR comprises a CD8 hinge/transmembrane domain, which optionally comprises the sequence of any one of SEQ ID NOs: 4, 10, 16, 22, 28, 37, 46, 58, 66, 72, 78, and 104, or a variant thereof. [0530] 96. The CAR T cell of any one of paragraphs 75-95, wherein the intracellular signaling domain comprises the intracellular signaling domain of TCF, FcR, FcR, CD3, CD3, CD3, CD3, CD3, CD22, CD79a, CD79b, or CD66d. [0531] 97. The CAR T cell of any one of paragraphs 75-96, wherein the intracellular signaling domain comprises a CD3 intracellular signaling domain, which optionally comprises the sequence of any one of SEQ ID NOs: 6, 12, 18, 24, 30, 39, 48, 60, 68, 74, 80, and 106, or a variant thereof. [0532] 98. The CAR T cell of any one of paragraphs 91-97, wherein the co-stimulatory domain comprises the co-stimulatory domain of 4-1 BB, CD27, CD28, or OX-40. [0533] 99. The CAR T cell of any one of paragraphs 91-98, wherein the co-stimulatory domain comprises a 4-1 BB co-stimulatory domain, which optionally comprises the sequence of any one of SEQ ID NOs: 5, 11, 17, 23, 29, 38, 47, 59, 67, 73, 79, and 105, or a variant thereof. [0534] 100. The CAR T cell of any one of paragraphs 75-99, wherein the CAR antigen-binding domain binds to a tumor-associated antigen or a Treg-associated antigen. [0535] 101. The CAR T cell of paragraph 80, wherein the camelid antibody binds to a tumor-associated antigen or a Treg-associated antigen. [0536] 102. The CAR T cell of paragraph 79, wherein the BiTE binds to (i) a tumor-associated antigen or a Treg-associated antigen, and (ii) a T cell antigen. [0537] 103. The CAR T cell of any one of paragraphs 100-102, wherein the tumor-associated antigen is a solid tumor-associated antigen. [0538] 104. The CAR T cell of paragraph 103, wherein the tumor-associated antigen comprises EGFRvIII, EGFR, CD19, PSMA, PSCA, IL-13R2, EphA1, Her2, mesothelin, MUC1, or MUC16, and optionally the CAR antigen-binding domain or the therapeutic agent comprises a sequence selected from the group consisting of SEQ ID NO: 21, 27, 33, 36, 42, 45, 51, 55, 57, 63, 65, 103, and variants thereof. [0539] 105. The CAR T cell of any one of paragraphs 100-102, wherein the Treg-associated antigen is selected from the group consisting of glycoprotein A repetitions predominant (GARP), latency-associated peptide (LAP), CD25, and cytotoxic T lymphocyte-associated antigen-4 (CTLA-4), and optionally the CAR antigen-binding domain or the therapeutic agent comprises a sequence selected from the group consisting of SEQ ID NO: 3, 9, 15, 25, 71, 77, and variants thereof. [0540] 106. A CAR polypeptide comprising an extracellular antigen-binding domain, a transmembrane domain, and an intracellular signaling domain; and the antigen-binding domain binds to a Treg-associated antigen. [0541] 107. The CAR polypeptide of paragraph 106, wherein the Treg-associated antigen is selected from the group consisting of GARP, LAP, CD25, and CTLA-4. [0542] 108. The CAR polypeptide of paragraph 106 or 107, wherein the CAR further comprises one or more co-stimulatory domains. [0543] 109. The CAR polypeptide of any one of paragraphs 106-108, wherein the Treg-associated antigen is GARP or LAP. [0544] 110. The CAR polypeptide of any one of paragraphs 106-109, wherein the antigen-binding domain of the CAR comprises: [0545] (a) a heavy chain variable domain (VH) comprising three complementarity determining regions CDR-H1, CDR-H2, and CDR-H3, wherein the CDR-H1 comprises an amino acid sequence of SEQ ID NO: 81, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 81; the CDR-H2 comprises an amino acid sequence of SEQ ID NO: 82, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 82; and the CDR-H3 comprises an amino acid sequence of SEQ ID NO: 83, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 83, and/or [0546] (b) a light chain variable domain (VL) comprising three complementarity determining regions CDR-L1, CDR-L2, and CDR-L3, wherein the CDR-L1 comprises an amino acid sequence of SEQ ID NO: 84, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 84; the CDR-L2 comprises an amino acid sequence of SEQ ID NO: 85, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 85; and the CDR-L3 comprises an amino acid sequence of SEQ ID NO: 86, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 86. [0547] 111. The CAR polypeptide of paragraph 110, wherein the VH comprises an amino acid sequence of SEQ ID NO: 87, or an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 87, and/or the VL comprises an amino acid sequence of SEQ ID NO: 88, or an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 88. [0548] 112. The CAR polypeptide of any one of paragraphs 106-109, wherein the antigen-binding domain of the CAR comprises: [0549] (a) a heavy chain variable domain (VH) comprising three complementarity determining regions CDR-H1, CDR-H2, and CDR-H3, wherein the CDR-H1 comprises an amino acid sequence of SEQ ID NO: 89, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 89; the CDR-H2 comprises an amino acid sequence of SEQ ID NO: 90, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 90; and the CDR-H3 comprises an amino acid sequence of SEQ ID NO: 91, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 91, and/or [0550] (b) a light chain variable domain (VL) comprising three complementarity determining regions CDR-L1, CDR-L2, and CDR-L3, wherein the CDR-L1 comprises an amino acid sequence of SEQ ID NO: 92, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 92; the CDR-L2 comprises an amino acid sequence of SEQ ID NO: 93, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 93; and the CDR-L3 comprises an amino acid sequence of SEQ ID NO: 94, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 94. [0551] 113. The CAR polypeptide of paragraph 112, wherein the VH comprises an amino acid sequence of SEQ ID NO: 95, or an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 95, and/or the VL comprises an amino acid sequence of SEQ ID NO: 96, or an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 96. [0552] 114. The CAR polypeptide of any one of paragraphs 110-113, wherein the VH is N-terminal to the VL. [0553] 115. The CAR polypeptide of any one of paragraphs 110-113, wherein the VL is N-terminal to the VH. [0554] 116. The CAR polypeptide of any one of paragraphs 106-115, wherein the antigen-binding domain of the CAR comprises a scFv or a single domain antibody, which optionally comprises a sequence selected from the group consisting of SEQ ID NO: 3, 9, 15, 25, 71, 77, and variants thereof. [0555] 117. The CAR polypeptide of any one of paragraphs 106-116, wherein the transmembrane domain comprises a hinge/transmembrane domain. [0556] 118. The CAR polypeptide of paragraph 117, wherein the hinge/transmembrane domain comprises the hinge/transmembrane domain of an immunoglobulin-like protein, CD28, CD8, or 4-1 BB. [0557] 119. The CAR polypeptide of any one of paragraphs 106-118, wherein the transmembrane domain of the CAR comprises a CD8 hinge/transmembrane domain, which optionally comprises the sequence of any one of SEQ ID NOs: 4, 10, 16, 22, 28, 37, 46, 58, 66, 72, 78, and 104, or a variant thereof. [0558] 120. The CAR polypeptide of any one of paragraphs 106-119, wherein the intracellular signaling domain comprises the intracellular signaling domain of TCF, FcR, FcR, CD3, CD3, CD3, CD3, CD3, CD22, CD79a, CD79b, or CD66d. [0559] 121. The CAR polypeptide of any one of paragraphs 106-120, wherein the intracellular signaling domain comprises a CD3 intracellular signaling domain, which optionally comprises the sequence of any one of SEQ ID NOs: 6, 12, 18, 24, 30, 39, 48, 60, 68, 74, 80, and 106, or a variant thereof. [0560] 122. The CAR polypeptide of any one of paragraphs 108-121, wherein the co-stimulatory domain comprises the co-stimulatory domain of 4-1 BB, CD27, CD28, or OX-40. [0561] 123. The CAR polypeptide of any one of paragraphs 108-122, wherein the co-stimulatory domain comprises a 4-1 BB co-stimulatory domain, which optionally comprises the sequence of any one of SEQ ID NOs: 5, 11, 17, 23, 29, 38, 47, 59, 67, 73, 79, and 105, or a variant thereof. [0562] 124. A CAR polypeptide comprising an amino acid sequence having at least 90% sequence identity to the amino acid sequence of any one of SEQ ID NO: 26, SEQ ID NO: 35, SEQ ID NO: 44, SEQ ID NO: 53, SEQ ID NO: 61, SEQ ID NO: 19, SEQ ID NO: 1, SEQ ID NO: 7, SEQ ID NO: 13, SEQ ID NO: 69, SEQ ID NO: 75, and SEQ ID NO: 100. [0563] 125. The CAR polypeptide of paragraph 124, comprising the amino acid sequence of any one of SEQ ID NO: 26, SEQ ID NO: 35, SEQ ID NO: 44, SEQ ID NO: 53, SEQ ID NO: 61, SEQ ID NO: 19, SEQ ID NO: 1, SEQ ID NO: 7, SEQ ID NO: 13, SEQ ID NO: 69, SEQ ID NO: 75, and SEQ ID NO: 100. [0564] 126. A nucleic acid molecule encoding (i) the CAR polypeptide, or (ii) a polyprotein comprising the CAR polypeptide and the therapeutic agent, of any one of paragraphs 75-125. [0565] 127. The nucleic acid molecule of paragraph 126, further comprising a suicide gene. 128. The nucleic acid molecule of paragraph 126 or 127, further comprising a sequence encoding a signal sequence. [0566] 129. A vector comprising the nucleic acid molecule of any one of paragraphs 126-128. [0567] 130. The vector of paragraph 129, wherein the vector is a lentiviral vector. [0568] 131. A polypeptide comprising the CAR polypeptide, or a polyprotein comprising the CAR polypeptide and the therapeutic agent, of any one of paragraphs 75-125. [0569] 132. An immune cell comprising the CAR polypeptide of any one of paragraphs 106-125, the nucleic acid molecule of any one of paragraphs 126-128, the vector of paragraph 129 or 130, and/or the polypeptide of paragraph 131. [0570] 133. The immune cell of paragraph 132, wherein the immune cell is a T or NK cell. [0571] 134. The immune cell of paragraph 132 or 133, wherein the immune cell is a human cell. [0572] 135. A pharmaceutical composition comprising one or more CAR T cells, nucleic acid molecules, CAR polypeptides, polyproteins, or immune cells of any one of paragraphs 75-134. [0573] 136. A method of treating a patient having cancer, the method comprising administering to the patient the pharmaceutical composition of paragraph 135. [0574] 137. The method of paragraph 136, wherein by targeting the tumor microenvironment, systemic toxicity is reduced. [0575] 138. The method of paragraph 136 or 137, wherein the cancer is characterized by the presence of one or more solid tumors. [0576] 139. The method of any one of paragraphs 136-138, wherein the cancer is characterized by tumor-infiltrating Tregs. [0577] 140. The method of any one of paragraphs 136-139, wherein the cancer is a glioblastoma. [0578] 141. A method of treating a patient having cancer, the method comprising administering to the patient a CAR T cell product, genetically modified to secrete a tumor-toxic antibody or cytokine, wherein by directing the cancer toxicity locally to the tumor microenvironment, systemic toxicity is reduced. [0579] 142. The method of paragraph 141, wherein the CAR T cell is genetically modified to deliver an antibody against CTLA4, CD25, GARP, LAP, IL-15, CSF1R, or EGFR, EGFRvIII, CD19, CD79b, CD37, PSMA, PSCA, IL-13R2, EphA1, Her2, mesothelin, MUC1, or MUC16, or a bispecific antibody to the tumor microenvironment. [0580] 143. The method of paragraph 142, wherein the bispecific antibody is a BiTE directed against EGFR and CD3. [0581] 144. A method of delivering a therapeutic agent to a tissue or organ in a patient to treat a disease or pathology, the method comprising administering to said patient a CAR T cell, genetically modified to secrete a therapeutic antibody, toxin, or agent, wherein the therapeutic antibody, toxin, or agent would, by itself, be unable to enter or penetrate the tissue or organ. [0582] 145. The method of paragraph 144, wherein the tissue or organ is in the nervous system. [0583] 146. The method of paragraph 145, wherein the nervous system is the central nervous system. [0584] 147. The method of paragraph 146, wherein the central nervous system is the brain. [0585] 148. The method of any one of paragraphs 144-147, wherein the disease or pathology is a cancer. [0586] 149. The method of paragraph 148, wherein the cancer is glioblastoma, prostate cancer, lung cancer, pancreatic cancer, lymphoma, or myeloma. [0587] 150. The method of any one of paragraphs 144-149, wherein the therapeutic antibody is anti-EGFR or anti-EGFRvIII. [0588] 151. A method of treating glioblastoma having reduced EGFRvIII expression in a subject comprising administering to the subject a CAR T cell engineered to express: (i) a CAR polypeptide comprising an extracellular EGFRvIII-binding domain; and (ii) a BiTE, wherein the CAR T cell is optionally selected from the CAR T cell of any one of paragraphs 75-105. [0589] 152. A method of preventing or reducing immunosuppression in the tumor microenvironment in a subject comprising administering to the subject a CAR T cell engineered to express: (i) a CAR polypeptide comprising an extracellular target binding domain; and (ii) a BiTE, wherein the CAR T cell is optionally selected from the CAR T cell of any one of paragraphs 75-105. [0590] 153. A method of preventing or reducing T cell exhaustion in the tumor microenvironment in a subject, the method comprising administering to the subject a CAR T cell engineered to express: (i) a CAR polypeptide comprising an extracellular target binding domain; and (ii) a BiTE, wherein the CAR T cell is optionally selected from the CAR T cell of any one of paragraphs 75-105. [0591] 154. A method of treating a cancer having heterogeneous antigen expression in a subject, the method comprising administering to the subject a CAR T cell engineered to express: (i) a CAR polypeptide comprising an extracellular target binding domain; and (ii) a BiTE, wherein the CAR T cell is optionally selected from the CAR T cell of any one of paragraphs 75-105. [0592] 155. The method of paragraph 154, wherein the cancer is glioblastoma, prostate cancer, lung cancer, pancreatic cancer, lymphoma, or myeloma. [0593] 156. The method of paragraph 154 or 155, wherein the cancer comprises cells expressing one or more of EGFR, EGFRvIII, CD19, PSMA, PSCA, IL-13R2, EphA1, Her2, mesothelin, MUC1, and MUC16.
[0594] Still other embodiments of the technology described herein can be defined according to any of the following additional numbered paragraphs: [0595] 1. A chimeric antigen receptor (CAR) T cell comprising a heterologous nucleic acid molecule, wherein the heterologous nucleic acid molecule comprises: [0596] (a) a first polynucleotide encoding a CAR comprising an antigen-binding domain, a transmembrane domain, and an intracellular signaling domain; and [0597] (b) a second polynucleotide encoding a therapeutic agent. [0598] 2. The CAR T cell of paragraph 1, wherein the therapeutic agent comprises an antibody reagent. [0599] 3. The CAR T cell of paragraph 2, wherein the antibody reagent comprises a single chain antibody or a single domain antibody. [0600] 4. The CAR T cell of paragraph 2 or 3, wherein the antibody reagent comprises a bispecific antibody reagent. [0601] 5. The CAR T cell of paragraph 4, wherein the bispecific antibody reagent comprises a bispecific T cell engager (BiTE). [0602] 6. The CAR T cell of paragraph 3, wherein the single domain antibody comprises a camelid antibody. [0603] 7. The CAR T cell of paragraph 1, wherein the therapeutic agent comprises a cytokine. [0604] 8. The CAR T cell of any one of paragraphs 1 to 7, wherein the CAR and the therapeutic agent are produced in the form of a polyprotein, which is cleaved to generate separate CAR and therapeutic agent molecules. [0605] 9. The CAR T cell of paragraph 8, wherein the polyprotein comprises a cleavable moiety between the CAR and the therapeutic agent. [0606] 10. The CAR T cell of paragraph 9, wherein the cleavable moiety comprises a 2A peptide. [0607] 11. The CAR T cell of paragraph 10, wherein the 2A peptide comprises P2A or T2A. [0608] 12. The CAR T cell of any one of paragraphs 1 to 11, wherein the CAR and the therapeutic agent are each constitutively expressed. [0609] 13. The CAR T cell of any one of paragraphs 1 to 12, wherein expression of the CAR and the therapeutic agent is driven by an elongation factor-1 alpha (EF1) promoter. [0610] 14. The CAR T cell of any one of paragraphs 1 to 11, wherein the therapeutic agent is expressed under the control of an inducible promoter, which is optionally inducible by T cell receptor or CAR signaling. [0611] 15. The CAR T cell of paragraph 14, wherein the inducible promoter comprises the NFAT promoter. [0612] 16. The CAR T cell of any one of paragraphs 1 to 11, wherein the CAR is expressed under the control of a constitutive promoter and the therapeutic agent is expressed under the control of an inducible promoter, which is optionally inducible by T cell receptor or CAR signaling. [0613] 17. The CAR T cell of any one of paragraph 1 to 16, wherein the CAR further comprises one or more co-stimulatory domains. [0614] 18. The CAR T cell of any one of paragraphs 1 to 17, wherein the antigen-binding domain of the CAR comprises an antibody, a single chain antibody, a single domain antibody, or a ligand. [0615] 19. The CAR T cell of any one of paragraphs 1 to 18, wherein the transmembrane domain of the CAR comprises a CD8 hinge/transmembrane domain, which optionally comprises the sequence of any one of SEQ ID NOs: 4, 10, 16, 22, 28, 37, 46, 58, 66, 72, and 78, or a variant thereof.
[0616] 20. The CAR T cell of any one of paragraphs 1 to 19, wherein the intracellular signaling domain comprises a CD3 intracellular signaling domain, which optionally comprises the sequence of any one of SEQ ID NOs: 6, 12, 18, 24, 30, 39, 48, 60, 68, 74, and 80, or a variant thereof. [0617] 21. The CAR T cell of any one of paragraphs 1 to 20, comprising a 4-1 BB co-stimulatory domain, which optionally comprises the sequence of any one of SEQ ID NOs: 5, 11, 17, 23, 29, 38, 47, 59, 67, 73, and 79, or a variant thereof. [0618] 22. The CAR T cell of any one of paragraphs 1-21, wherein the CAR antigen-binding domain or the therapeutic agent, when the therapeutic agent comprises an antibody reagent, bind to a tumor-associated antigen. [0619] 23. The CAR T cell of paragraph 22, wherein the tumor-associated antigen to which the CAR antigen-binding domain or the therapeutic agent binds is a solid tumor-associated antigen. [0620] 24. The CAR T cell of paragraph 22 or 23, wherein the tumor-associated antigen to which the CAR antigen-binding domain or the therapeutic agent binds comprises epidermal growth factor receptor variant III (EGFRvIII), epidermal growth factor receptor (EGFR), CD19, prostate-specific membrane antigen (PSMA), or IL-13 receptor alpha 2 (IL-13R2), and optionally the CAR antigen-binding domain or the therapeutic agent comprises a sequence selected from the group consisting of SEQ ID NO: 21, 27, 33, 36, 42, 45, 51, 55, 57, 63, 65, and variants thereof. [0621] 25. The CAR T cell of any one of paragraphs 1 to 21, wherein the CAR antigen-binding domain or the therapeutic agent, when the therapeutic agent comprises an antibody reagent, binds to a Treg-associated antigen. [0622] 26. The CAR T cell of paragraph 25, wherein the Treg-associated antigen to which the CAR antigen-binding domain or the therapeutic agent binds is selected from the group consisting of glycoprotein A repetitions predominant (GARP), latency-associated peptide (LAP), CD25, and cytotoxic T lymphocyte-associated antigen-4 (CTLA-4), and optionally the CAR antigen-binding domain or the therapeutic agent comprises a sequence selected from the group consisting of SEQ ID NO: 3, 9, 15, 25, 71, 77, and variants thereof. [0623] 27. A CAR T cell comprising a polynucleotide encoding a CAR, wherein the CAR comprises an antigen-binding domain, a transmembrane domain, and an intracellular signaling domain; and the antigen-binding domain binds to a Treg-associated antigen. [0624] 28. The CAR T cell of paragraph 27, wherein the Treg-associated antigen is selected from the group consisting of GARP, LAP, CD25, and CTLA-4. [0625] 29. The CAR T cell of paragraph 27 or 28, wherein the CAR further comprises one or more co-stimulatory domains. [0626] 30. The CAR T cell of any one of paragraphs 27-29, wherein the Treg-associated antigen is GARP. [0627] 31. The CAR T cell of any one of paragraphs 27-30, wherein the antigen-binding domain of the CAR comprises: [0628] (a) a heavy chain variable domain (VH) comprising three complementarity determining regions CDR-H1, CDR-H2, and CDR-H3, wherein the CDR-H1 comprises an amino acid sequence of SEQ ID NO: 81, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 81; the CDR-H2 comprises an amino acid sequence of SEQ ID NO: 82, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 82; and the CDR-H3 comprises an amino acid sequence of SEQ ID NO: 83, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 83, and [0629] (b) a light chain variable domain (VL) comprising three complementarity determining regions CDR-L1, CDR-L2, and CDR-L3, wherein the CDR-L1 comprises an amino acid sequence of SEQ ID NO: 84, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 84; the CDR-L2 comprises an amino acid sequence of SEQ ID NO: 85, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 85; and the CDR-L3 comprises an amino acid sequence of SEQ ID NO: 86, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 86.32. The CAR T cell of paragraph 31, wherein the VH comprises an amino acid sequence of SEQ ID NO: 87, or an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 87, and the VL comprises an amino acid sequence of SEQ ID NO: 88, or an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 88. [0630] 33. The CAR T cell of paragraph 31 or 32, wherein the VH is N-terminal to the VL. [0631] 34. The CAR T cell of paragraph 31 or 32, wherein the VL is N-terminal to the VH. [0632] 35. The CAR T cell of any one of paragraphs 27 to 34, wherein the antigen-binding domain of the CAR comprises a scFv or a single domain antibody, which optionally comprises a sequence selected from the group consisting of SEQ ID NO: 3, 9, 15, 25, 71, 77, and variants thereof. [0633] 36. A CAR T cell comprising a heterologous nucleic acid molecule encoding an amino acid sequence having at least 90% sequence identity to the amino acid sequence of any one of SEQ ID NO: 26, SEQ ID NO: 35, SEQ ID NO: 44, SEQ ID NO: 53, SEQ ID NO: 61, SEQ ID NO: 19, SEQ ID NO: 1, SEQ ID NO: 7, SEQ ID NO: 13, SEQ ID NO: 69, and SEQ ID NO: 75. [0634] 37. The CAR T cell of paragraph 36, comprising a heterologous nucleic acid molecule encoding an amino acid sequence of any one of SEQ ID NO: 26, SEQ ID NO: 35, SEQ ID NO: 44, SEQ ID NO: 53, SEQ ID NO: 61, SEQ ID NO: 19, SEQ ID NO: 1, SEQ ID NO: 7, SEQ ID NO: 13, SEQ ID NO: 69, and SEQ ID NO: 75. [0635] 38. A nucleic acid molecule encoding (i) the CAR polypeptide, or (ii) a polyprotein comprising the CAR polypeptide and the therapeutic agent, of any one of paragraphs 1 to 37. [0636] 39. A polypeptide comprising the CAR polypeptide, or polyprotein comprising the CAR polypeptide and the therapeutic agent, of any one of paragraphs 1 to 37. [0637] 40. A pharmaceutical composition comprising one or more CAR T cells, nucleic acid molecules, CAR polypeptides, or polyproteins of any one of paragraphs 1 to 39. [0638] 41. A method of treating a patient having cancer, the method comprising administering to the patient a pharmaceutical composition comprising one or more CAR T cell of any one of paragraphs 1 to 37 or a pharmaceutical composition of paragraph 40. [0639] 42. The method of paragraph 41, wherein by targeting the tumor microenvironment, systemic toxicity is reduced. [0640] 43. The method of paragraph 41 or 42, wherein the cancer is characterized by the presence of one or more solid tumors. [0641] 44. The method of any one of paragraphs 41 to 43, wherein the cancer is characterized by tumor-infiltrating Tregs. [0642] 45. The method of any one of paragraphs 41 to 44, wherein the cancer is a glioblastoma. [0643] 46. A method of treating a patient having cancer, the method comprising administering to the patient a CAR T cell product, genetically modified to secrete a tumor-toxic antibody or cytokine, wherein by directing the cancer toxicity locally to the tumor microenvironment, systemic toxicity is reduced. [0644] 47. The method of paragraph 46, wherein the CAR T cell is genetically modified to deliver an antibody against CTLA4, CD25, GARP, LAP, IL15, CSF1R, or EGFR, or a bispecific antibody against to the tumor microenvironment. [0645] 48. The method of paragraph 47, wherein the bispecific antibody is directed against EGFR and CD3. [0646] 49. A method of delivering a therapeutic agent to a tissue or organ in a patient to treat a disease or pathology, the method comprising administering to said patient a CAR T cell, genetically modified to secrete a therapeutic antibody, toxin, or agent, wherein the therapeutic antibody, toxin, or agent would, by itself, be unable to enter or penetrate the tissue or organ. [0647] 50. The method of paragraph 49, wherein the tissue or organ is in the nervous system. [0648] 51. The method of paragraph 50, wherein the nervous system is the central nervous system. [0649] 52. The method of paragraph 51, wherein the central nervous system is the brain. [0650] 53. The method of any one of paragraphs 49 to 52, wherein the disease or pathology is glioblastoma. [0651] 54. The method of paragraph 49-53, wherein the therapeutic antibody is anti-EGFR or anti-EGFRvIII. [0652] 55. A CAR T cell comprising a polynucleotide encoding a CAR, wherein the CAR comprises an extracellular GARP-binding domain, a transmembrane domain, and an intracellular signaling domain, and wherein the GARP-binding domain comprises: [0653] (a) a heavy chain variable domain (VH) comprising three complementarity determining regions CDR-H1, CDR-H2, and CDR-H3, wherein the CDR-H1 comprises an amino acid sequence of SEQ ID NO: 81, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 81; the CDR-H2 comprises an amino acid sequence of SEQ ID NO: 82, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 82; and the CDR-H3 comprises an amino acid sequence of SEQ ID NO: 83, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 83, and [0654] (b) a light chain variable domain (VL) comprising three complementarity determining regions CDR-L1, CDR-L2, and CDR-L3, wherein the CDR-L1 comprises an amino acid sequence of SEQ ID NO: 84, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 84; the CDR-L2 comprises an amino acid sequence of SEQ ID NO: 85, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 85; and the CDR-L3 comprises an amino acid sequence of SEQ ID NO: 86, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 86. [0655] 56. The CAR T cell of paragraph 55, wherein the VH comprises an amino acid sequence of SEQ ID NO: 87, or an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 87, and the VL comprises an amino acid sequence of SEQ ID NO: 88, or an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 88. [0656] 57. The CAR T cell of paragraph 55 or 56, wherein the VH is N-terminal to the VL. [0657] 58. The CAR T cell of paragraph 55 or 56, wherein the VL is N-terminal to the VH. [0658] 59. The CAR T cell of any one of paragraphs 55-58, wherein the GARP-binding domain comprises an amino acid sequence SEQ ID NO: 71 or 77, or an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 71 or 77. [0659] 60. The CAR T cell of any one of paragraphs 55-59, wherein the CAR further comprises one or more co-stimulatory domains. [0660] 61. The CAR T cell of any one of paragraphs 55-60, wherein the transmembrane domain of the CAR comprises a hinge/transmembrane domain. [0661] 62. The CAR T cell of any one of paragraphs 61, wherein the hinge/transmembrane domain comprises a CD4, CD28, CD7, or CD8 hinge/transmembrane domain. [0662] 63. The CAR T cell of paragraph 62, wherein the hinge/transmembrane domain comprises a CD8 hinge/transmembrane domain of SEQ ID NO: 72 or 78. [0663] 64. The CAR T cell of any one of paragraphs 55-63, wherein the intracellular signaling domain comprises an intracellular signaling domain of TCR, FcR, FcR, CD3, CD3, CD3, CD3, CD3, CD22, CD79a, CD79b, or CD66d. [0664] 65. The CAR T cell of paragraph 64, wherein the intracellular signaling domain comprises a CD3 intracellular signaling domain of SEQ ID NO: 74 or 80. [0665] 66. The CAR T cell of any one of paragraphs 55-65, wherein the co-stimulatory domain comprises a co-stimulatory domain of CARD11, CD2, CD7, CD27, CD28, CD30, CD40, ICAM, CD83, OX40, 4-1 BB, CD150, CTLA4, LAGS, CD270, PD-L2, PD-L1, ICOS, DAP10, LAT, NKD2C SLP76, TRIM, or ZAP70. [0666] 67. The CAR T cell of paragraph 66, wherein the co-stimulatory domain comprises a 4-1 BB co-stimulatory domain of SEQ ID NO: 73 or 79. [0667] 68. The CAR T cell of any one of paragraphs 55-67, wherein the polynucleotide encodes a CAR comprising an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 69 or 75, or wherein the polynucleotide encodes a CAR comprising an amino acid sequence having at least 90% sequence identity to the combination of the amino acid sequences of SEQ ID NOs: 71-74 or 77-80. [0668] 69. The CAR T cell of paragraph 68, wherein the polynucleotide encodes a CAR comprising an amino acid sequence of SEQ ID NO: 69 or 75, or wherein the polynucleotide encodes a CAR comprising the combination of the amino acid sequences of SEQ ID NOs: 71-74 or 77-80. [0669] 70. A pharmaceutical composition comprising the CAR T cell of any one of paragraphs 55-69. [0670] 71. A method of treating a patient having cancer, the method comprising administering the CAR T cell of any one of paragraphs 55-69, or the pharmaceutical composition of paragraph 70, to the patient. [0671] 72. The method of paragraph 71, wherein by targeting the tumor microenvironment, systemic toxicity is reduced. [0672] 73. The method of paragraph 71 or 72, wherein the cancer is characterized by the presence of one or more solid tumors. [0673] 74. The method of any one of paragraphs 71-73, wherein the cancer is characterized by tumor-infiltrating Tregs. [0674] 75. The method of any one of paragraphs 71-74, wherein the cancer is a glioblastoma. 76. The CAR T cell of any one of paragraphs 1-26, wherein the heterologous nucleic acid molecule further comprises a suicide gene. [0675] 77. The CAR T cell of any one of paragraphs 27-35, wherein the polynucleotide further comprises a suicide gene. [0676] 78. The CAR T cell of paragraph 36 or 37, wherein the heterologous nucleic acid molecule further comprises a suicide gene. [0677] 79. The nucleic acid molecule of paragraph 38, further comprising a suicide gene. [0678] 80. The CAR T cell of any one of paragraphs 55-69, wherein the polynucleotide further comprises a suicide gene. [0679] 81. A CAR T cell comprising a polynucleotide encoding a CAR, wherein the CAR comprises an extracellular LAP-binding domain, a transmembrane domain, and an intracellular signaling domain, and wherein the LAP-binding domain comprises: [0680] (a) a heavy chain variable domain (VH) comprising three complementarity determining regions CDR-H1, CDR-H2, and CDR-H3, wherein the CDR-H1 comprises an amino acid sequence of SEQ ID NO: 89, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 89; the CDR-H2 comprises an amino acid sequence of SEQ ID NO: 90, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 90; and the CDR-H3 comprises an amino acid sequence of SEQ ID NO: 91, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 91, and [0681] (b) a light chain variable domain (VL) comprising three complementarity determining regions CDR-L1, CDR-L2, and CDR-L3, wherein the CDR-L1 comprises an amino acid sequence of SEQ ID NO: 92, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 92; the CDR-L2 comprises an amino acid sequence of SEQ ID NO: 93, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 93; and the CDR-L3 comprises an amino acid sequence of SEQ ID NO: 94, or an amino acid sequence with no more than 1, 2, or 3 amino acid substitutions of SEQ ID NO: 94, [0682] and wherein the CAR does not comprise one or more of SEQ ID NOs: 7, 9, 13, 15, 95, and 96, or wherein the CAR does not comprise the combination of SEQ ID NOs: 9-12 or 15-18. [0683] 82. The CAR T cell of paragraph 81, wherein the VH does not comprise SEQ ID NO: 95, and/or the VL does not comprise SEQ ID NO: 96. [0684] 83. The CAR T cell of paragraph 81 or 82, wherein the LAP-binding domain does not comprise SEQ ID NO: 9 or 15. [0685] 84. The CAR T cell of any one of paragraphs 81-83, wherein the polynucleotide does not encode a CAR of SEQ ID NO: 7 or 13. [0686] 85. The CAR T cell of any one of paragraphs 81-84, wherein the CAR does not comprise an amino acid sequence of the combination of SEQ ID NOs: 9-12 or 15-18. [0687] 86. The CAR T cell of any one of paragraphs 81-85, wherein the CAR further comprises one or more co-stimulatory domains. [0688] 87. The CAR T cell of any one of paragraphs 81-86, wherein the transmembrane domain of the CAR comprises a hinge/transmembrane domain. [0689] 88. The CAR T cell of paragraph 87, wherein the hinge/transmembrane domain comprises a CD4, CD28, CD7, or CD8 hinge/transmembrane domain. [0690] 89. The CAR T cell of any one of paragraphs 81-88, wherein the intracellular signaling domain comprises an intracellular signaling domain of TCF, FcR, FcR, CD3, CD3, CD3, CD3, CD3, CD22, CD79a, CD79b, or CD66d. [0691] 90. The CAR T cell of any one of paragraphs 81-89, wherein the co-stimulatory domain comprises a co-stimulatory domain of CARD11, CD2, CD7, CD27, CD28, CD30, CD40, ICAM, CD83, OX40, 4-1 BB, CD150, CTLA4, LAGS, CD270, PD-L2, PD-L1, ICOS, DAP10, LAT, NKD2C SLP76, TRIM, or ZAP70. [0692] 91. The CAR T cell of any one of paragraphs 81-90, wherein the polynucleotide further comprises a suicide gene. [0693] 92. A pharmaceutical comprising the CAR T cell of any one of paragraphs 81-91. [0694] 93. A method of treating a patient having cancer, the method comprising administering the CAR T cell of any one of paragraphs 81-91, or the pharmaceutical composition of paragraph 92, to the patient. [0695] 94. The method of paragraph 93, wherein by targeting the tumor microenvironment, systemic toxicity is reduced. [0696] 95. The method of paragraph 93 or 94, wherein the cancer is characterized by the presence of [0697] one or more solid tumors.
[0698] 96. The method of any one of paragraphs 93-95, wherein the cancer is characterized by tumor-infiltrating Tregs. [0699] 97. The method of any one of paragraphs 93-96, wherein the cancer is a glioblastoma.
[0700] The following claims are meant to be representative only and not to limit the scope of the disclosed invention. In at least one aspect, we claim: