HETEROLOGOUS COMBINATION PRIME:BOOST THERAPY AND METHODS OF TREATMENT

Abstract

The present disclosure provides a Farmington virus formulated to induce an immune response in a mammal against a tumour associated antigen. The Farmington virus may express an antigenic protein that includes an epitope from the tumour associated antigen. The Farmington virus may be formulated in a composition where the virus is separate from an antigenic protein that includes an epitope from the tumour associated antigen. The present disclosure also provides a prime:boost therapy for use in inducing an immune response in a mammal. The boost includes a Farmington virus, or a composition that includes a Farmington virus.

Claims

1. A Farmington virus comprising a nucleic acid that is capable of expressing a tumour associated antigen or an epitope thereof.

2. The Farmington virus of claim 1, wherein the genomic backbone of the Farmington virus encodes a protein having at least 90% sequence identity with any one of SEQ ID NOs 3-7.

3. The Farmington virus of claim 2, wherein the genomic backbone of the Farmington virus encodes a protein having at least 95% sequence identity with any one of SEQ ID NOs 3-7.

4. The Farmington virus of any one of claims 1-3, wherein the tumour associated antigen is a foreign antigen.

5. The Farmington virus of claim 4, wherein the foreign antigen comprises E6 protein from HPV or E7 protein from HPV.

6. The Farmington virus of claim any one of claims 1-3, wherein the tumour associated antigen is a self antigen.

7. The Farmington virus of claim 6, wherein the self antigen is MAGEA3.

8. The Farmington virus of claim any one of claims 1-3, wherein the tumour associated antigen is a neoepitope.

9. The Farmington virus of any one of claims 1-7, wherein the Farmington virus induces an immune response against the tumour associated antigen in a mammal to whom the Farmington virus is administered.

10. The Farmington virus of claim 9, wherein the mammal has been previously administered a prime that is immunologically distinct from the Farmington virus.

11. The Farmington virus of claim 10, wherein the prime is (a) a virus comprising a nucleic acid that is capable of expressing the tumour associated antigen or an epitope thereof; (b) T-cells specific for the tumour associated antigen; or (c) a peptide of the tumour associated antigen.

12. The Farmington virus of any one of claims 1-11, further encoding a cell death protein.

13. A composition comprising a Farmington virus comprising a nucleic acid that is capable of expressing a tumour associated antigen or an epitope thereof, the composition being formulated to induce an immune response in a mammal against the tumour associated antigen.

14. A composition comprising a Farmington virus and an antigenic protein that includes an epitope from a tumour associated antigen, wherein the Farmington virus is separate from the antigenic protein, the composition being formulated to induce an immune response in a mammal against the tumour associated antigen.

15. A heterologous combination prime:boost therapy for use in inducing an immune response in a mammal, wherein the prime is formulated to generate an immunity in the mammal to a tumour associated antigen, and the boost comprises: a Farmington virus comprising a nucleic acid that is capable of expressing a tumour associated antigen or an epitope thereof and is formulated to induce the immune response in the mammal against the tumour associated antigen.

16. A method of enhancing an immune response in a mammal having a cancer, the method comprising a step of: administering to the mammal a composition comprising a Farmington virus comprising a nucleic acid that is capable of expressing a tumour associated antigen or an epitope thereof, wherein the mammal has been administered a prime that is directed to the tumour associated antigen or an epitope thereof; and wherein the prime is immunologically distinct from the Farmington virus.

17. The method of claim 16, wherein the mammal has a tumour that expresses the tumour associated antigen.

18. The method of claim 16 or 17, wherein the cancer is brain cancer.

19. The method of claim 18, wherein the brain cancer is glioblastoma.

20. The method of claim 16 or 17, wherein the cancer is colon cancer.

21. The method of any one of claims 16-20, wherein the Farmington virus is capable of expressing an epitope of the tumour associated antigen.

22. The method of any one of claims 16-20, wherein the prime is directed to an epitope of the tumour associated antigen.

23. The method of claim 22, wherein the prime is directed the same epitope of the tumour associated antigen as the epitope encoded by the Farmington virus.

24. The method of any one of claims 16-23, wherein the prime comprises: (a) a virus comprising a nucleic acid that is capable of expressing the tumour associated antigen or an epitope thereof; (b) T-cells specific for the tumour associated antigen; or (c) a peptide of the tumour associated antigen.

25. The method of claim 24, wherein the prime comprises a virus comprising a nucleic acid that is capable of expressing the tumour associated antigen or an epitope thereof.

26. The method of claim 25, wherein the prime comprises a single-stranded RNA virus.

27. The method of claim 26, wherein the single-stranded RNA virus is a positive-strand RNA virus.

28. The method of claim 27, wherein the positive-strand RNA virus is a lentivirus.

29. The method of claim 26, wherein the single-stranded RNA virus is a negative-strand RNA virus.

30. The method of claim 25, wherein the prime comprises a double-stranded DNA virus.

31. The method of claim 30, wherein the double-stranded DNA virus is an adenovirus.

32. The method of claim 31, wherein the adenovirus is an Ad5 virus.

33. The method of claim 24, wherein the prime comprises T-cells specific for the tumour associated antigen.

34. The method of claim 24, wherein the prime comprises a peptide of the tumour associated antigen.

35. The method of claim 28, wherein the prime further comprises an adjuvant.

36. The method of claim any one of claims 16-35, wherein the mammal is administered the composition at least 9 days after the mammal was administered the prime.

37. The method of any one of claims 16-36, wherein the mammal is administered the composition no more than 14 days after the mammal was administered the prime.

38. The method of any one of claims 16-37, further comprising a second step of administering to the mammal a composition comprising a Farmington virus comprising a nucleic acid that is capable of expressing a tumour associated antigen or an epitope thereof.

39. The method of claim 38, wherein the second step of administering is performed at least 50, at least 75, at least 100, or at least 120 days after the first step of administering.

40. The method of claim 38 or 39, further comprising a third step of administering to the mammal a composition comprising a Farmington virus comprising a nucleic acid that is capable of expressing a tumour associated antigen or an epitope thereof.

41. The method of claim 40, wherein the third step of administering is performed at least 50, at least 75, at least 100, or at least 120 days after the second step of administering.

42. The method of any one of claims 16-41, wherein at least one step of administering is performed by a systemic route of administration.

43. The method of any one of claims 16-41, wherein at least one step of administering is performed by a non-systemic route of administration.

44. The method of any one of claims 16-41, wherein at least one step of administering is performed by injection directly into a tumour of the mammal.

45. The method of any one of claims 16-41, wherein at least one step of administering is performed intracranially.

46. The method of any one of claims 16-41, wherein at least one step of administering is performed intravenously.

47. The method of any one of claims 16-41, wherein at least one step of administering is performed both intravenously and intracranially.

48. The method of any one of claims 16-47, wherein the frequency of T cells specific for the tumour associated antigen is increased after the step of administering.

49. The method of claim 48, wherein the T cells comprise CD8 T cells.

50. The method of any one of claims 16-49, wherein the mammal's survival is extended compared to that of a control mammal who is not administered the composition.

51. The method of claim 50, wherein the control mammal is administered a prime directed to the tumour associated antigen, wherein the prime is immunologically distinct from the composition.

52. The method of any one of claims 16-51, wherein the frequency of T cells specific for the Farmington virus increases by no more than 3% after the step of administering.

53. The method of claim 52, wherein the frequency of CD8 T cells specific for the Farmington virus increases by no more than 3% after the step of administering.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0047] Embodiments of the present disclosure will now be described, by way of example only, with reference to the attached Figures.

[0048] FIGS. 1A-1E: Engineered Farmington (FMT) virus is a versatile cancer vaccine platform. FMT virus engineered to express m38 antigen can boost immune responses when paired with 3 different prime methods: engineered AdV-m38, ACT of m38-specific CD8 T cells or m38 peptide with adjuvant, as demonstrated by frequencies and numbers of IFN-secreting CD8 T cells (FIG. 1A) and IFN and TNF-secreting CD8 T cells (FIG. 1B) after ex-vivo peptide stimulation of PBMCs isolated from vaccinated mice 5-6 days after boost. Moreover, FMT virus can boost immune responses directed to different classes of antigens: self-antigens (e.g., DCT (FIG. 1C)); foreign antigens (e.g., m38 (FIG. 1D)); and neo-epitopes (e.g., mutated Adpgk and Reps1 (FIG. 1E)). The graphs show mean and SEM. Data was analysed with 1-way ANOVA Dunn's Multiple Comparison Test (FIGS. 1A, 1B), 1-way ANOVA Dunn's Multiple Comparison Test (FIG. 1C), Mann Whitney test (FIG. 1D), and 2-way ANOVA Bonferroni Multiple Comparison Test (FIG. 1E). AdVadenovirus, ACTadoptive cell trasfer, P values: *p<0.05, **P<0.01, ***P<0.001.

[0049] FIGS. 2A-I: FMT-based vaccination induces long-lasting immune responses. Increases in m38-specific CD8 T cells frequencies and numbers were observed following a first boost with FMT-m38 compared to PBS control and following a second boost with FMT-m38 applied 120 days after the first boost compared to PBS control and immune response just before boost (FIG. 2A). An anti-m38 immune response was sustained for over 5 months (FIG. 2A). Homologous multiple boosts were more effective when applied with longer time interval (minimum 3 months compared to 1 month) (FIGS. 2B, 2C). Higher frequencies and numbers of neo-epitope-specific CD8 T cells were detected after vaccination in mice primed with only one peptide compared to mice primed with all 3 peptides (FIGS. 2B, 2C). These immune responses lasted for over 6 months (FIGS. 2B, 2C). Data were analysed with Mann Whitney test (FIGS. 2B, 2C, 2E, and 2H) and 1-way ANOVA Dunn's Multiple Comparison Test (FIGS. 2D and 2I). ACTadoptive cell transfer.

[0050] FIGS. 3A-3D: Anti-tumour efficacy of FMT virus-based cancer vaccine. Treatment with FMT-m38 virus in a prime+boost setting significantly extended survival of CT2A-m38 tumour-bearing mice compared with PBS and prime only controls and induced antigen-specific CD8 T cell responses in tumour-bearing mice (FIGS. 3A, 3B, and 3C). FMT-based vaccination against Adpgk and Reps1 neo-epitopes delayed tumour progression, extended survival of MC-38-tumour bearing mice and boosted antigen-specific CD8 T cells responses (FIG. 3D). Data were analysed as follows: for FIGS. 3A-3C: Log-rank (Mantel-Cox) test for survival analysis and 1-way ANOVA Dunn's Multiple Comparison Test; for FIG. 1D Log-rank (Mantel-Cox) test for survival analysis and 2-way ANOVA Bonferroni Multiple Comparison Test. AdVadenovirus, ACTadoptive cell trasfer. P values: *p<0.05, **P<0.01, ***P<0.001, ****P<0.0001.

[0051] FIGS. 4A-4C: Inducing TAA-specific effector CD8 T cells provides therapeutic efficacy. Treatment with anti-m38 prime and boost induced high frequencies and numbers of m38-specific CD8 T cells and extended the survival of mice bearing m38-expressing CT2A tumours, while vaccination with irrelevant antigens did not have an impact on survival (FIG. 4A). Prime+boost treatment improved the survival of tumour-bearing mice at a ACT starting dose 10.sup.3 cells (FIG. 4B). Increasing the ACT prime dose resulted in higher frequencies and numbers of antigen-specific CD8 T cells and increased cure rate; however, no further survival benefit was observed above an ACT dose of 10.sup.5 cells (FIG. 4B). FMT-m38 treatment administered intravenously (iv) induced highest frequencies and numbers of m38-specific CD8 T cells and had the best therapeutic efficacy compared with intracranial (ic) (intra-tumour) route and a combination of intravenous (iv) and intracranial (ic) routes (FIG. 4C). The higher amount of infectious particles detected in the spleen after FMT virus intravenous injection compared to after intracranial injection might explain this observation (FIG. 4C). All treatment strategies extended survival, but a higher cure rate was observed in groups administered by the intravenous route alone or in combination with intracranial injection compared to intracranial injection alone (FIG. 4C).

[0052] FIGS. 5A-5E: Pre-existing TAA-specific CD8 effector T cells extend survival post tumour challenge. (See Example 8.) FIGS. 5A and 5C show percentages of CD8+ IFN+(out of all CD8+ cells) in blood from mice 9 days before and 6 days after, respectively, tumour challenge. FIGS. 5B and 5D show amounts of m38-specific CD8.sup.+ T cells per mL blood from mice 9 days before and 6 days after, respectively, tumour challenge. FIG. 5E shows Kaplan-Meier survival curves of mice receiving various prime:boost treatments or PBS.

[0053] FIGS. 6A-6E: FMT-based vaccination administered intracranially promotes anti-tumour immune response within the brain tumour microenvironment. FMT-m38 injection by both intravenous (iv) and intracranial (ic) routes increased the frequency and numbers of tumour-infiltrating lymphocytes (TILs) compared to PBS control, while numbers of macrophages remained the same in each group (FIG. 6A). In the FMT-m38 intravenous treatment group, a distinct CD11b.sup.low CD45+ population of macrophages was observed (FIG. 6A). The all macrophages population in FIG. 6A includes both the CD11b.sup.low CD45+ and CD11b+CD45.sup.bright macrophage populations (red gate on dot plots). FMT-m38-based vaccination reduced the frequency and numbers of CD206+ macrophages, while CD86 expression was very similar with in PBS controls (FIG. 6B). Treatment with intracranially delivered FMT-m38 increased the recruitment of both CD8 and CD4 T cells, while reduced amounts of these cells were found in tumours from mice treated with intravenously administered FMT-m38 compared to tumours from control mice (FIG. 6C). CD8.sup.low T cells were gated and considered CD8 T cells, as they formed a distinct population on the dot plot (FIG. 6C), and downregulation of CD8 marker upon activation was observed in other experiments. Intracranial injection of FMT virus increased IL-7, IL-13, IL-6 and TNFa cytokines and G-CSF growth factor levels (FIG. 6D). Elevated levels of chemokines Eotaxin, CXCL5, RANTES, CXCL1 and MIP-2 were observed in tumours from mice injected intracranially with FMT virus compared to that observed in tumors from mice in the PBS control or FMT-intravenous group. Intravenous injection resulted in diminished levels of CXCL5, MIG, RANTES and CXCL1 compared to levels in the PBS control or FMT-intracranial group (FIG. 6E).

[0054] Graphs show mean and SEM and representative dot plots from each treatment group. All data in FIGS. 6A-6C were analysed with 2 way ANOVA Bonferroni multiple comparison test, except CD206+ cell numbers, which were analysed with Kruskal-Wallis and Dunn's multiple comparison test. All data in FIGS. 6D and 6E were analysed with Kruskal-Wallis and Dunn's multiple comparison test. P values: *p<0.05, **P<0.01, ***P<0.001, ****P<0.0001.

[0055] FIG. 7A-7C: Ex vivo expansion of antigen-specific central memory CD8 T cells. Splenocytes were extracted from Maxim38 mice and cultured for 6 days in supplemented RPMI medium in the presence of m38 peptide. On the day of harvest, cells were phenotyped by flow cytometry. The majority of cells were CD8-positive (FIG. 7A). Within the CD8+ population, 40-60% of cells were of memory CD127+CD62L+ phenotype (FIG. 7B). Most of memory T cells expressed CD27, none expressed KLRG1 and the expression of CCR7 varied between different cellular products, but in most cases was low (FIG. 7C).

[0056] FIG. 8. CD8 T cell response to FMT viral backbone. CD8 T cell response against a dominant epitope of FMT virus was assessed by peptide stimulation and intracelluar cytokine staining (ICS) assay 5-6 days after FMT-m38 boost. The frequencies of FMT-specific CD8 T cells ranged from 0-3% and were significantly higher compared to PBS control only in a group primed with ACT-m38. 1-way ANOVA Dunn's Multiple Comparison Test. AdVadenovirus, ACTadoptive cell trasfer, P values: * p<0.05, **P<0.01, ***P<0.001.

[0057] FIGS. 9A and 9B. CT2A-m38 brain tumour model characteristics. MRI imaging of brains in mice injected with wild type CT2A cells (left panels) vs. those of mice injected with CT2A-m38 cells (FIG. 9A). Expression of a major histocompatibility complex class I (MHC I) allele that presents the m38 epitope in tumour cells extracted from mice 21 days after intracranial implantation of CT2A-m38 cells (FIG. 9B).

[0058] FIG. 10. Immune response at the day of brain tumour collection. Blood was collected from CT2A-m38 tumour-bearing mice 6 days after FMT-m38 is or iv injection. FMT-m38 boost expanded the frequencies and numbers of m38-specific cells.

[0059] FIGS. 11A-11D. Gating strategy for phenotyping of tumour-infiltrating immune cells. The debris and dead cells were excluded on the FSC vs SSC plot, then singlets were gated on the FSC-A vs SSC-A plot, and remaining dead cells were excluded by Viability dye stain (FIG. 11A). Immune cells were gated based on the expression of CD45 (FIG. 11B). Next, within the CD45+ population, we distinguished microglia (defined as the CD11 b+CD45.sup.low population), all macrophages (red gate) (defined as CD11b+CD45.sup.bright cells), and lymphocytes (defined as CD11 b-CD45+ cells) (FIG. 11C). Expression of the NK cell marker NKp46 within all CD45+ cells was also examined; however, this population was less than 0.5% of all immune cells (data not shown). The all macrophages population was further divided into CD11b+CD45.sup.bright and CD11 b.sup.lowCD45+ populations (FIG. 11C). Both macrophage and microglia populations may also contain dendritic cells and granulocytes. Within the CD11b-CD45+ lymphocyte population, T cells were gated as CD3+ cells (FIG. 11D). Macrophages and T cells were further examined for the expression of other markers as indicated in FIGS. 5A-E. FSC-AForward Scatter-Area, FSC-HForward Scatter-Height, SSCSide Scatter-Area.

DETAILED DESCRIPTION

[0060] Generally, the present disclosure provides Farmington virus and its use as, or in, an immunostimulatory composition. The Farmington virus may be used as a boost of a pre-existing immunity to a tumour associated antigen. The boost may be a component in a heterologous combination prime:boost treatment, where the prime generates the pre-existing immunity. In heterologous prime:boost treatments, the prime and the boost are immunologically distinct.

[0061] In the context of the present disclosure, the expression immunologically distinct should be understood to mean that at least two agents or compositions (e.g., the prime and the boost) do not produce antisera that cross react with one another. The use of a prime and a boost that are immunologically distinct permits an effective prime/boost response to the tumour associated antigen that is commonly targeted by the prime and the boost.

[0062] In the context of the present disclosure, a combination prime:boost therapy should be understood to refer to therapies for which (1) the prime and (2) the boost are to be administered as a prime:boost treatment. A therapy should be understood to refer to physical components, while a treatment should be understood to refer to the method associated with administration of the therapeutic components. The prime and boost need not be physically provided or packaged together, since the prime is to be administered first and the boost is to be administered only after an immunological response has been generated in the mammal. In some examples, the combination may be provided to a medical institute, such as a hospital or doctor's office, in the form of a package (or plurality of packages) of the prime, and a separate package (or plurality of packages) of the boost. The packages may be provided at different times. In other examples, the combination may be provided to a medical institute, such as a hospital or doctor's office, in the form of a package that includes both the prime and the boost. In yet other examples, the prime may be generated by a medical institute, such as through isolation of T-cells from the mammal for adoptive cell transfer, and the boost may be provided at a different time.

[0063] In the context of the present disclosure, the expression tumour associated antigen, self tumour associated antigen, is meant to refer to any immunogen that is that is associated with tumour cells, and that is either absent from or less abundant in healthy cells or corresponding healthy cells (depending on the application and requirements). For instance, the tumour associated antigen may be unique, in the context of the organism, to the tumour cells. Examples of such antigens include but are not limited to human dopachrome tautomerase (hDCT) antigen; melanoma-associated antigen (MAGEA3); human Six-Transmembrane Epithelial Antigen of the prostate protein (huSTEAP); human Cancer Testis Antigen 1 (NYESO1); and others.

[0064] In the context of the present disclosure, the expression foreign antigen or non-self antigen refers to an antigen that originates outside the body of an organism, e.g., antigens from viruses or microorganisms, foods, cells and substances from other organisms, etc. Examples of such antigens include but are not limited to E6 protein from Human Papilloma Virus (HPV); E7 protein from HPV; E6/E7 fusion protein; E6/E7 fusion protein; human CMV antigen, pp65; murine CMV antigen, m38; and others.

[0065] In the context of the present disclosure, the term neo-antigen refers to newly formed antigens that have not previously been recognized by the immune system and that arise from genetic aberrations within a tumor.

[0066] In the context of the present disclosure, the expression self antigen refers to an antigen that originates within the body of an organism.

[0067] The boost is formulated to generate an immune response in the mammal to a tumour associated antigen. The boost may be, for example: a Farmington virus that expresses an antigenic protein; a composition that includes a Farmington virus and a separate antigenic protein; or a cell infected with a Farmington virus that expresses an antigenic protein.

[0068] The full-length genomic sequence for wild type Farmington virus has been determined. The sequence of the complementary DNA (cDNA) polynucleotide produced by Farmington virus is shown in SEQ ID NO: 1 (SEQ ID NO: 1 of WO2012167382). The disclosure of WO2012167382 is incorporated herein by reference. The RNA polynucleotide sequence of Farmington virus is shown in SEQ ID NO: 2 (SEQ ID NO: 2 of WO2012167382). Five putative open reading frames were identified in the genomic sequence. Additional ORFs may be present in the virus that have not yet been identified. The sequences of the corresponding proteins are shown in SEQ ID NOs: 3, 4, 5, 6, and 7 (SEQ ID NOs: 3, 4, 5, 6 and 7 of WO2012167382).

[0069] Table 1 provide a description of SEQ ID NOs: 1-7.

TABLE-US-00001 TABLE 1 Description of Sequences SEQ ID NO: 1 Farmington cDNA produced by the FMT rhabdovirus- rhabdovirus DNA SEQ ID NO: 2 Farmington rhabdovirus- RNA SEQ ID NO: 3 Farmington The promoter is at position 134 to rhabodvirus 149 and the encoding sequence is at ORF1 positions 206 to 1444 of SEQ ID NO: 1. SEQ ID NO: 4 Farmington The promoter is at positions 1562 to rhabodvirus 1578 and the encoding sequence is ORF2 at positions 1640 to 2590 of SEQ ID NO: 1. SEQ ID NO: 5 Farmington The promoter is at positions 2799 to rhabodvirus 2813 and the encoding sequence is ORF3 at positions 2894 to 3340 of SEQ ID NO: 1. SEQ ID NO: 6 Farmington The promoter is at positions 3457 to rhabodvirus 3469 and the encoding sequence is ORF4 at positions 3603 to 5717 of SEQ ID NO: 1. SEQ ID NO: 7 Farmington The promoter is at positions 5766 to rhabodvirus 5780 and the encoding sequence is ORF5 at positions 5832 to 12221 of SEQ ID NO: 1.

[0070] The encoding DNA sequences are shown in SEQ ID Nos: 8, 9, 10, 11, and 12 respectively (SEQ ID NOs: 8, 9, 10, 11 and 12, respectively, of WO2015154197). (The disclosures of WO 2012/167382 and WO2 015/154197 are incorporated herein by reference.)

[0071] In the context of the present disclosure, the expression a Farmington virus should be understood to refer to any virus whose genomic backbone encodes: [0072] a protein that is at least 90% identical, and more preferably at least 95% identical, to the protein of SEQ ID NO: 3 (SEQ ID NO: 3 of WO2012167382); [0073] a protein that is at least 90% identical, and more preferably at least 95% identical, to the protein of SEQ ID NO: 4 (SEQ ID NO: 4 of WO2012167382); [0074] a protein that is at least 90% identical, and more preferably at least 95% identical, to the protein of SEQ ID NO: 5 (SEQ ID NO: 5 of WO2012167382); [0075] a protein that is at least 90% identical, and more preferably at least 95% identical, to the protein of SEQ ID NO: 6 (SEQ ID NO: 6 of WO2012167382); and [0076] a protein that is at least 90% identical, and more preferably at least 95% identical, to the protein of SEQ ID NO: 7 (SEQ ID NO: 7 of WO2012167382).

[0077] A Farmington virus according to the present disclosure that expresses an antigenic protein (e.g., a tumour associated antigen or an epitope thereof) may have the nucleic acid sequence encoding the antigenic protein inserted anywhere in the genomic backbone that does not interfere with the production of the viral gene products. For example: the sequence encoding the antigenic protein may be located between the N and the P genes, between the P and the M genes, or between the G and the L genes.

[0078] A Farmington virus according to the present disclosure that expresses an antigenic protein may additionally include a nucleic acid sequence that encodes a protein implicated in cell death (cell death protein), or a variant thereof. Examples of cell death proteins include, but are not limited to: Apoptin; Bcl-2-associated death promoter (BAD); BCL2-antagonist/killer 1 (BAK1); BCL2-associated X (BAX); p15 BH3 interacting-domain death agonist, transcript variant 2 (BIDv2); B-cell lymphoma 2 interacting mediator of cell death (BIM); Carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase (CAD); caspase 2 (CASP2); caspace 3 (CASP3); caspace 8 (CASP8); CCAAT-enhancer-binding protein homologous protein (CHOP); DNA fragmentation factor subunit alpha (DFFA); Granzyme B; activated c-Jun N-terminal kinase (JNK); Phorbol-12-myristate-13-acetate-induced protein 1 (PMAPI 1, also referred to as NOXA); p53 upregulated modulator of apoptosis beta (PUMA beta); p53 upregulated modulator of apoptosis gamma (PUMA gamma); p53-induced death domain protein (PIDD); recombinant ADAM15 disintegrin domain (RAIDD); ubiquitin conjugated Second Mitochondrial-derived Activator of Caspases (SMAC); autophagy related 12 (ATG12); autophagy related 3 (ATG3); Beclin-1 (BECN1); solute carrier family 25 member 4 (SLC25A4); Receptor-interacting serine/threonine-protein kinase 1 (RIPK1); Receptor-interacting serine/threonine-protein kinase 3 (RIPK3); short form of Phosphoglycerate mutase family member 5 (PGAM5S); mixed lineage kinase domain-like (MLKL); Cathepsin D; Maraba M; and any variant thereof.

[0079] Specific examples of such an additional protein are: mixed lineage kinase domain-like (MLKL), caspase 2 (CASP2), p15 BH3 interacting-domain death agonist, transcript variant 2 (BIDv2), and Bcl-2-associated death promoter (BAD).

[0080] Farmington viruses that encode cell death proteins, or variants thereof, are discussed in WO2015154197, the disclosure of which is incorporated herein by reference. Specific examples of the MLKL, CASP2, BIDv2, and BAD proteins have the sequences shown in SEQ ID NOs: 13, 15, 17 and 19, respectively, of WO2015154197.

[0081] The prime and the boost may include different antigenic proteins, so long as the antigenic proteins are based on the same tumour associated antigen. This should be understood to mean that the antigenic protein of the prime and the antigenic protein of the boost are design or selected, such that they each comprise sequences eliciting an immune reaction to the same tumour associated antigen. It will be appreciated that the antigenic protein of the prime and the antigenic protein of the boost need not be exactly the same in order to accomplish this. For instance, they may be peptides comprising sequences that partially overlap, with the overlapping segment comprising a sequence corresponding to the tumour associated antigen, or a sequence designed to elicit an immune reaction to the tumour associated antigen, thereby allowing an effective prime and boost to the same antigen to be achieved. However, in some embodiments, the antigenic protein of the prime and the antigenic protein of the boost are the same.

[0082] The prime, formulated to generate an immunity in the mammal to a tumour associated antigen, may be any combination of components that potentiates the immune response to the tumour associated antigen. For example, the prime may be, or may include: a virus that expresses an antigenic protein; a mixture of a virus and an antigenic protein; a pharmacological agent and an antigenic protein; an immunological agent and an antigenic protein (e.g., an adjuvant and a peptide); adoptive cell transfer; or any combination thereof. In the context of the present disclosure, the subject may have prior exposure to certain antigens unrelated to the present therapy. Any immune response to such prior exposure is not considered a prime for the purpose of the presently disclosed methods and compositions.

[0083] In some embodiments, the prime comprises

[0084] (a) a virus comprising a nucleic acid that is capable of expressing the tumour associated antigen or an epitope thereof;

[0085] (b) T-cells specific for the tumour associated antigen; or

[0086] (c) a peptide of the tumour associated antigen.

[0087] In some embodiments, the prime comprises an oncolytic virus.

[0088] In some embodiments, the prime comprises a virus comprising a nucleic acid that is capable of expressing the tumour associated antigen or an epitope thereof.

[0089] In some embodiments, the prime comprises a single-stranded RNA virus.

[0090] The single-stranded RNA virus may be a positive-sense single stranded RNA virus (e.g., a lentivirus) or a negative-sense single stranded RNA virus.

[0091] In some embodiments, the prime comprises a double-stranded DNA virus.

[0092] For example, the virus may be an adenovirus, e.g., an Ad5 virus.

[0093] In some embodiments, the prime comprises T-cells specific for the tumour associated antigen. For example, the prime may comprise T-cells of the memory phenotype, e.g., CD8+ memory cells (e.g., CD8+CD127+CD62L+ cells).

[0094] In some embodiments, the prime comprises a peptide, e.g., an epitope of a tumour associated antigen. In some such embodiments, the prime further comprises an adjuvant.

[0095] More specific examples of primes contemplated by the authors include: an adenovirus that expresses an antigenic protein; a lentivirus that expresses an antigenic protein; Listeria monocytogenes (LM) that expresses an antigenic protein; an oncolytic virus that expresses an antigenic protein; an adenovirus and an antigenic protein where the antigenic protein is not encoded by the adenovirus; an oncolytic virus and an antigenic protein where the antigenic protein is not encoded by the oncolytic virus; a mixture of poly I:C and an antigenic protein; CD8 memory T-cells specific to an antigenic protein; a mixture of poly I:C, anti CD40 antibody, and an antigenic protein; and a nanoparticle adjuvant with an immunostimulatory RNA or DNA, or with an antigenic protein.

[0096] The tumour associated antigen may be, for example, an antigen in: Melanoma Antigen, family A,3 (MAGEA3); human Papilloma Virus E6 protein (HPV E6); human Papilloma Virus E7 protein (HPV E7); human Six-Transmembrane Epithelial Antigen of the Prostate protein (huSTEAP); Cancer Testis Antigen 1 (NYESO1); Brachyury protein; Prostatic Acid Phosphatase; Mesothelin; CMV pp65; CMV IE1; EGFRvIII; IL13R alpha2; Her2/neu; CD70; CD133; BCA; FAP; Mesothelin; KRAS; p53; CHI; CSP; FABP7; NLGN4X; PTP; H3F3A K27M; G34R/V; or any combination thereof. In some embodiments, the tumor associated antigen is a foreign antigen. In some embodiments, the tumor associated antigen is a self antigen. In some embodiments, the tumour associated antigen is a neo-antigen that results from a tumour-specific mutation of a wild-type self-protein.

[0097] The protein sequence of full length, wild type, human MAGEA3 is shown in SEQ ID NO: 13 (SEQ ID NO: 1 of WO/2014/127478). The protein sequence of a variant of full length, wild type, human MAGEA3 is shown in SEQ ID NO; 14 (SEQ ID NO: 4 of WO/2014/127478). The protein sequences of HPV16 E6, HPV18 E6, HPV16 E7 and HPV18 E7 are shown in SEQ ID NOs: 15-18 (SEQ ID Nos: 9-12 of WO/2017/195032). The protein sequence of a huSTEAP protein is shown in SEQ ID NO: 19 (SEQ ID NO: 13 of WO/2017/195032). The protein sequence of NYESO1 is shown in SEQ ID NO: 20 (SEQ ID NO: 13 of WO/2014/127478). The protein sequence of human Brachyury protein is disclosed in the Uniprot database under identifier 015178-1 (www.uniprot.org/uniprot/015178) (SEQ ID NO: 21). The protein sequence of secreted human prostatic acid phosphatase is disclosed in the Uniprot database under identifier P15309-1 (www.uniprot.org/uniprot/P15309) (SEQ ID NO: 22). The disclosure of which is incorporated herein by reference. Variants of these specific sequences may be used as antigenic proteins for the prime and/or the boost of the present disclosure so long as the variant protein includes at least one tumour associated epitope of the reference protein, and the amino acid sequence of the variant protein is at least 70% identical to the amino acid sequence of the reference protein.

[0098] In one aspect, the present disclosure provides a heterologous combination prime:boost therapy for use in inducing an immune response in a mammal. The prime is formulated to generate an immunity in the mammal to a tumour associated antigen. The boost includes a Farmington virus, and is formulated to induce the immune response in the mammal against the tumour associated antigen. Aside from the immune responses to the tumour associated antigen, the prime and the boost are immunologically distinct.

[0099] In some embodiments, the prime:boost therapy is formulated to generate immune responses against a plurality of antigens. It should be understood that antigenic proteins, such as MAGEA3, HPV E6, HPV E7, huSTEAP, Cancer Testis Antigen 1; Brachyury; Prostatic Acid Phosphatase; FAP; HER2; and Mesothelin have more than one antigenic epitope. Formulating the prime and the Farmington virus to include or express an antigenic protein having a plurality of antigenic epitopes may result in the mammal generating immune responses against more than one of the antigenic epitopes.

[0100] In one specific example, the prime and the Farmington virus are both formulated to induce an immune response against at least one antigen in the E6 and E7 transforming proteins of the HPV16 and HPV18 serotypes. This may be accomplished by having the Farmington virus express a fusion protein that includes HPV16 E6, HPV18 E6, HPV16 E7 and HPV18 E7 protein domains. The four protein domains are linked by proteasomally degradable linkers that result in the separate HPV16 E6, HPV18 E6, HPV16 E7 and HPV18 E7 proteins once the fusion protein is in the proteasome. Exemplary fusion proteins are discussed in WO/2014/127478 and WO/2017/195032, the disclosures of which are incorporated herein by reference. The prime may be formulated to induce an immune response against an antigenic protein that is different from the antigenic protein expressed by the Farmington virus. For example, the prime may be an oncolytic virus that expresses an HPV E6/E7 fusion protein where the four protein domains are linked in a different order.

[0101] In another specific example, the prime and the Farmington virus are both formulated to induce an immune response against at least one antigen in MAGEA3. This may be accomplished by having the Farmington virus express an antigenic protein comprising an amino acid sequence (a) that includes at least one tumour associated epitope selected from the group consisting of: EVDPIGHLY (SEQ ID NO: 23), FLWGPRALV (SEQ ID NO: 24), KVAELVHFL (SEQ ID NO: 25), TFPDLESEF (SEQ ID NO: 26), VAELVHFLL (SEQ ID NO: 27), REPVTKAEML (SEQ ID NO: 28), AELVHFLLL (SEQ ID NO: 29), WQYFFPVIF (SEQ ID NO: 30) EGDCAPEEK (SEQ ID NO: 31), KKLLTQHFVQENYLEY (SEQ ID NO: 32), VIFSKASSSLQL (SEQ ID NO: 33), VFGIELMEVDPIGHL (SEQ ID NO: 34), GDNQIMPKAGLLIIV (SEQ ID NO: 35), TSYVKVLHHMVKISG (SEQ ID NO: 36), and FLLLKYRAREPVTKAE (SEQ ID NO: 37), and (b) that is at least 70% identical to the amino acid sequence of SEQ ID NO: 13( ). The prime may be formulated to induce an immune response against an antigenic protein that is different from the antigenic protein expressed by the Farmington virus. For example, the prime may be a mixture of poly I:C and a synthetic long peptide that includes FLWGPRALV (SEQ ID NO: 24).

[0102] In yet another specific example, the prime and the Farmington virus are both formulated to induce an immune response against a neo-antigen. This may be accomplished by formulating the Farmington virus as an adjuvant to an antigenic protein that includes the neo-antigen, where the Farmington virus does not encode the antigenic protein. The prime may be formulated against the same antigenic protein or against a different antigenic protein, so long as the immunogenic sequence of the neo-antigen is conserved.

1. A prime:boost therapy according to the present disclosure may be used in the treatment of cancer. For example, in one aspect, provided are methods of enhancing an immune response in a mammal having a cancer, the method comprising a step of:

[0103] administering to the mammal a composition comprising a Farmington virus comprising a nucleic acid that is capable of expressing a tumour associated antigen or an epitope thereof, [0104] wherein the mammal has been administered a prime is directed to the tumour associated antigen or an epitope thereof; and

[0105] wherein the prime is immunologically distinct from the Farmington virus.

[0106] In some embodiments, the mammal has brain cancer, such as glioblastoma. In some embodiments, the prime has colon cancer.

[0107] The prime and the composition comprising the Farmington virus may be administered by any of a variety of routes of administration, which may be the same or different for the prime and the composition comprising the Farmington virus. One of ordinary skill in the art reading the present specification will understand that the appropriate route of administration may depend on one or more factors, including, e.g., on the type of cancer the mammal has. In some embodiments, at least one of the prime and the composition comprising the Farmington virus is administered by a systemic route of administration. In some embodiments, at least one of the prime and the composition comprising the Farmington virus is administered by a non-systemic route of administration.

[0108] Non-limiting examples of routes of administration include intravenous, intramuscular, intraperitoneal, intranasal, intracranial, and direct injection into a tumour. For example, in the case of brain cancer, intracranial administration may be suitable. In some embodiments, the prime and/or the composition comprising the Farmington virus is administered by more than one method, e.g., both intracranially and intravenously.

[0109] In some embodiments, provided methods comprise more than one boost with Farmington virus, e.g., methods may further comprise a second step (and optionally a third step) of administering to the mammal a composition comprising a Farmington virus as disclosed herein. In embodiments comprising more than one boost, a subsequent boost may be separated by a time interval, e.g., at 50, at least 75, at least 100, or at least 120 days from the previous step of administering. In embodiments comprising at least three boosts, the time intervals between boosts may be approximately the same, or they may be different.

[0110] In some embodiments, an immune response is generated in the mammal after the step of administering the composition comprising the Farmington virus (or after each step of administering the composition). For example, the immune response can comprise an immune response specific for the tumour associated antigen (TAA), e.g., an increase in the frequency of T cells (e.g., CD8 T cells) specific for the tumour associated antigen (e.g., as determined in a sample such as a blood or serum sample from the mammal).

[0111] In some embodiments, a limited immune response, or no immune response, specific for the Farmington virus is generated in the mammal after the step of administering the composition comprising the Farmington virus (or after each step of administering the composition). For example, in some embodiments, after the step of administering the composition comprising the Farmington virus (or after each step of administering the composition), the frequency of T cells (e.g., CD8 T cells) specific for the Farmington virus is no greater than 3% (e.g., as determined in a sample such as a blood or serum sample from the mammal).

[0112] Provided prime:boost therapies may be formulated in accordance with provided methods, e.g., the prime and/or the boost may be formulated for particular routes of administration as discussed herein.

TABLE-US-00002 SEQUENCES (FarmingtonrhabdoviruscDNA) SEQIDNO:1 ttacgacgcataagctgagaaacataagagactatgttcatagtcaccctgtattcatta60 ttgacttttatgacctattattcgtgaggtcatatgtgaggtaatgtcatctgcttatgc120 gtttgcttataagataaaacgatagacccttcacgggtaaatccttctccttgcagttct180 cgccaagtacctccaaagtcagacgatggctcgtccgctagctgctgcgcaacatctcat240 aaccgagcgtcattcccttcaggcgactctgtcgcgggcgtccaagaccagagccgagga300 attcgtcaaagatttctaccttcaagagcagtattctgtcccgaccatcccgacggacga360 cattgcccagtctgggcccatgctgcttcaggccatcctgagcgaggaatacacaaaggc420 cactgacatagcccaatccatcctctggaacactcccacacccaacgggctcctcagaga480 gcatctagatgccgatgggggaggctcattcacagcgctgcccgcgtctgcaatcagacc540 cagcgacgaggcgaatgcatgggccgctcgcatctccgactcagggttggggcctgtctt600 ctatgcagccctcgctgcttacatcatcggctggtcaggaagaggagagactagccgcgt660 gcagcagaacataggtcagaaatggctgatgaacctgaacgcaatcttcggcaccacgat720 cacccatccaacaaccgtgcgtctgccaatcaacgtcgtcaacaacagcctcgcagtgag780 gaacggacttgctgccacactctggctatactaccgttcatcacctcagagtcaggacgc840 gttcttctatgggctcatccgtccctgttgcagtggatatctcggcctgctacatcgggt900 gcaggagattgatgagatggagccggacttcctcagtgacccccggatcatccaggtgaa960 tgaggtctacagtgcactcagagccctggttcaactgggaaacgacttcaagaccgccga1020 tgatgagcccatgcaggtctgggcgtgcaggggaatcaacaacggatatctgacatatct1080 ctcagaaactcctgcgaagaaaggagctgttgtgcttatgtttgcccaatgcatgctgaa1140 gggcgactctgaggcctggaacagctaccgcactgcaacctgggtgatgccctattgcga1200 caatgtggccctaggagcgatggcaggctacatccaagcccgccagaacaccagggcata1260 tgaggtctcagcccagacaggtctcgacgtcaacatggccgcggtcaaggactttgaggc1320 cagttcaaaacccaaggctgctccaatctcgctgatcccacgccccgctgatgtcgcatc1380 ccgcacctctgagcgcccatctattcctgaggttgacagcgacgaagagctcggaggaat1440 gtaaaccaataagcttcactgccggtagtttaggcatacacacgcagttccgttatccat1500 cacacccgtcccttcttttatgctgctattatttcagttgctaagcttcctgatttgatt1560 aacaaaaaaccgtagacctcctacgtgaggtatagctagaaattggttctatcggttgag1620 agtctttgtactattagccatggaggactatttgtctagcttagaggccgcgagagagct1680 cgtccggacggagctggagcccaagcgtaacctcatagccagcttagagtccgacgatcc1740 cgatccggtaatagcgccagcggtaaaaccaaaacatcccaagccatgcctgagcactaa1800 agaagaggatcatctcccctctcttcgcctactattcggcgcaaaacgagacacctcggt1860 gggcgtagagcagactctccacaagcgtctctgcgcttgtctcgacggttacctgaccat1920 gacgaagaaagaggccaatgcctttaaggccgcggctgaagcagcagcattagcagtcat1980 ggacattaagatggagcatcagcgccaggatctagaggatctgaccgctgctatccctag2040 gatagaattcaaactcaatgccatcctggaaaacaacaaggagatagccaaggctgtaac2100 tgctgctaaggagatggagcgggagatgtcgtggggggaaagcgccgccagctcgctcaa2160 gtctgtcaccctagatgagtcgtttaggggccctgaagagctttcagagtcatttggcat2220 ccgatataaggtcagaacctggaatgagttcaagaaggcgctggaaaccagcattgtgga2280 cctgaggcctagccctgtttcatttagggaattacggactatgtggctgtctcttgacac2340 ctcctttaggctcattgggtttgccttcattcccacatgcgagcgcctggagaccaaagc2400 caaatgcaaggagacaaggactctactcccccttgcagagtcgatcatgcgaagatggga2460 cctgcgggatccaaccatcttggagaaagcctgcgtagtaatgatgatccgtgggaatga2520 gattgcatcgctgaatcaggtaaaagatgttctcccgaccacaattcgtgggtggaagat2580 cgcttattagtcactgctcccattagtcccactagacggcatacttccattccgcccttt2640 aattcccctgtcagacactcatgctccgaaatcactaaccatccttgtccaccaagcaat2700 acgcatattcagtagcactgcatctcgccctccccctatcaagccccagcgctgcagatc2760 ttcaccacatatatacatgcatcaactacatgtgatttagaaaaaaccagacccttcacg2820 ggtaatagcctaactcacgaacgttcctctcgtttcgtatgataaggccttaagcattgt2880 cgatacggtcgttatgcgtcggttctttttaggagagagcagtgcccctgcgagggactg2940 ggagtccgagcgacctcccccctatgctgttgaggtccctcaaagtcacgggataagagt3000 caccgggtacttccagtgcaacgagcgtccgaaatccaagaagaccctccacagcttcgc3060 cgtaaaactctgcgacgcaattaagccggttcgagcggatgctcccagcttgaagatagc3120 aatatggacggctctagatctggccttcgtgaaacctcccaatggaactgtaacaataga3180 tgcggcggtgaaagctacaccgctaatcgggaacacccagtacaccgtaggcgatgaaat3240 cttccagatgctagggagaaggggtggcctgatcgtcatcaggaacttaccccatgatta3300 tcctcgaacgttgattgagttcgcctctcccgagccttgagcaccagggcatcggtccgc3360 ccgccctgtgatctcccgtagccgggctcagcgatcaagccggcccgggtcgggggggac3420 tggtgcaacacaaggggcggcagtggacgctgattaacaaaaaaccacctatatagaccc3480 ctcacggtcttagactctgttgccagctgacaaccaacacacaagacatctctctgattc3540 agccgacccgatcgattcctccccacccaattcctaccaacgcactcctcacaagctcca3600 ccatgctcaggatccagatccctccgattgctatcattctggtaagtctcctcacactcg3660 acctgtccggtgcaaggaggacaaccacacaaagaatccctctccttaatgattcgtggg3720 atttgttctcgagctatggcgacattcccgaagaacttgtcgtataccagaactacagcc3780 acaattcctccgagttaccccctcctggcttcgagagatggtacataaaccgaagagtgg3840 cagacacttccataccgtgcaggggcccctgtctagtgccctacatccttcatggcctca3900 atgacacaactgtctctcgacggggaggaggatggcgaaggtccggaatgaagtacccaa3960 cccacgctgtcaggctaggcccttcaacagacgacgagagagttgaggaagacatcggct4020 acgtcaatgtctccgcactatcctgcacagggtcgcccgttgagatggcgataccaacaa4080 tccccgactgcaccagtgctatccatccacgatccgaggttactgtgcccgtcaagctcg4140 atgtcatgagacgaaatcccaactaccctcccattagagcgtggtcgtgcatcggacaga4200 aaatcaccaaccgatgtgattgggcactcttcggcgagaacctcatatatactcaagttg4260 aagctagctctctagcattcaagcacacaagagcctctcttttgaacgaatccaacggga4320 tagacgctgaaggacgtgcagttccctatatcctcggggatatcgaacccgggtactgcc4380 gaaccctattcaacacatgggtctctagtgagatcgtgtcatgcacgcccatcgaacttg4440 tcctagttgacctgaaccctttgtccccgggacatggcggatatgctgtattgctgccaa4500 acggagacaaagtggatgtacacgacaagcatgcatgggatggggacaacaaaatgtgga4560 gatgggtgtacgagaagaaagatccctgtgcgttcgagctggtatccagggaagtgtgtc4620 ttttctcactgagtaggggtagtagactgagaggagcaacccctccccaaggagagctcc4680 tcacctgcccgcattcgggaaaggcatttgacctgaagggggcccgaaggattacaccca4740 tttcatgcaaaatcgacatggaatatgacttgctgtcactaccaaccggagtcatcctag4800 gcctccacctatcagaactcgggacctcctttggcaacctctcaatgagtcttgaaatgt4860 atgaacctgccacaactctgacccctgagcaaatcaacttctcgcttaaagagctgggaa4920 gctggaccgaggctcaactgaagagcctgtctcactcaatctgcctctccacattctcca4980 tatgggaactatcggttgggatgatcgatctaaaccctaccagggcagcaagggccttgc5040 tccatgatgataacatactggcaacattcgagaacggtcacttttccatcgtcagatgtc5100 gtccggaaatagttcaagtcccttcgcatcctcgagcatgtcacatggatctccgccctt5160 atgacaagcaatcacgggcatcaaccctggtggttccccttgacaacagcactgccctcc5220 tggtccccgacaacatcgtggttgaaggagtagaggccagtctatgcaaccactccgttg5280 ccatcacgctgtcgaagaacagaactcactcatacagcctctatccccagggtcgtcctg5340 tgcttcgacagaaaggtgccgtggagctcccgacgatagggcccctccagttacatcctg5400 ccactcgagtggacctttatacactgaaagagttccaggaggaccgaatagcgcgcagtc5460 gagtcacagacatcaaggctgccgttgacgatctgcgtgcgaagtggcgtaaaggcaaat5520 ttgaggcggacaccacgggagggggactttggtcggcgattgtgggagtcttcagttctc5580 tcggggggttcttcatgaggcccttgattgctctcgcggcgatagtgacctcaatcatca5640 tcctgtatatccttctgcgtgtactgtgtgctgcctcatgttcgacacaccgaagagtaa5700 ggcaggactcttggtaaagaggactgcgattgttgagtggacaaaccctaggcctattcc5760 gatttagaaaaaaccagacctctcacgaggtcttttctactagctgggttttcctcattc5820 tatccagagccatggccttcgacccgaactggcagagagaaggttatgaatgggatccgt5880 caagtgagggcagaccgaccgatgagaacgaagacgacagaggtcatcggccaaaaacga5940 gacttcgtacattccttgcccgcacgttaaatagccctatccgagccctattctacacaa6000 tattcctaggaattcgagcggtttgggacgggttcaaaagactcctacctgtgaggaccg6060 aaaagggttatgcgaggttttctgagtgcgtcacatatggaatgatcggatgtgatgagt6120 gtgtaatagacccggtgagggttgtcattgagctgaccgagatgcagttaccgattaaag6180 gcaaaggctctacgaggttgagagcaatgataactgaagaccttctcacggggatgcgca6240 cagccgtgcctcagatcagagtgagatcgaagatcctagcagagcggttagggagagcaa6300 tcggccgagagaccttgccggcaatgatccatcatgagtgggcatttgtgatggggaaga6360 ttctcactttcatggcagacaatgtgggtatgaacgctgacacggtcgagggcgttctat6420 cactatcagaggtcacacggcgatgggatatcggcaactctgtgtccgcagtgttcaatc6480 ctgatggccttactatcagagtagaaaacacgggttacatcatgaccagagagactgcct6540 gcatgatcggagacattcatgctcaatttgcaatccaatacctagctgcatacctagacg6600 aggtgatcggcacaaggacgtctctctcacccgccgaactgacctctctcaaactatggg6660 gacttaacgtcctgaaactcctaggacggaacggttatgaggtgatcgcctgcatggagc6720 ccatagggtacgctgtcctgatgatgggaagagacaggagtcctgatccctatgtcaatg6780 acacctatttaaacagcatcctctcagaattccctgtcgactctgacgctcgagcctgcg6840 ttgaagccctcttaactatctatatgagcttcggcacaccccataaagtctcggacgcat6900 tcggcctcttcagaatgttgggacatccgatggttgatggagctgacgggattgaaaaga6960 tgcgaaggttaagcaagaaggtcaagatcccagaccagtctacagcgatcgacctcgggg7020 ctatcatggccgaactgtttgtgcggagtttcgtaaagaagcacaaaaggtggcccaact7080 gctccatcaatctcccgccacgacaccccttccaccacgcccgcctatgtgggtatgtcc7140 cggctgaaacccatcccctaaacaacactgcatcctgggcggctgtggagttcaaccagg7200 aattcgagccgccgagacagtacaaccttgcagacatcattgatgacaagtcgtgctctc7260 ccaacaagcatgagctatatggtgcttggatgaagtcaaaaacagctgggtggcaggaac7320 aaaagaagctcatactccgatggttcactgagaccatggttaaaccttcggagctcctgg7380 aagagattgatgcacacggcttccgagaagaggataagttgattggattaacaccaaagg7440 agagagagctgaaattaacaccaagaatgttctccttgatgacattcaagttcagaacct7500 accaagtcctcactgagagtatggtcgccgatgagatcctcccgcacttcccccagatca7560 ccatgaccatgtccaaccacgaactcacaaagaggttgattagcagaacgagacctcaat7620 ctggaggagggcgtgatgttcacatcaccgtgaacatagatttccagaaatggaacacaa7680 acatgagacacggactggtcaaacatgtcttcgagcgactggacaacctctttggcttca7740 ccaacttaatcagacgaactcatgaatacttccaggaggcgaaatactatctggctgaag7800 atggaactaatctgtcgttcgacaggaacggggagttaatagatggcccatacgtttaca7860 ccggatcatacggggggaacgaggggttacgacagaagccctggacaatagttaccgtgt7920 gtggaatatacaaggtagctagagacctgaaaatcaaacatcagatcaccggtcagggag7980 ataatcaggtggtcaccctaatatttccggatcgagagttgccttcagatccggtggaga8040 ggagcaagtactgtagagacaagagcagtcagttcctgacacgtctcagtcaatatttcg8100 ctgaggttggtttgcccgtcaagactgaagagacatggatgtcatcacgtctctatgctt8160 acggtaagcgcatgttcttagagggagttccacttaagatgtttctcaagaagataggca8220 gagctttcgccctctcgaatgagtttgtcccgtccctcgaggaagatctggccagagtct8280 ggagtgccaccagcgcagcggtagagcttgacctaactccctacgtaggatatgtcctcg8340 ggtgctgcttgtctgcgcaggcgatcagaaatcacctcatctactcccctgttctggagg8400 gccctctgctggttaaggcctacgagcgtaagttcattaactacgacggaggaacaaagc8460 ggggggcgatgcccggcctacgtccaacctttgagagcctagtcaaaagtatctgctgga8520 agccaaaggccatcggagggtggccggtattgatgttagaagatctcatcatcaaagggt8580 tccctgatccggcgactagcgccctggctcaattgaagtcaatggtgccatatacctctg8640 gtatcgaccgggagatcatactttcctgtctcaaccttcccttatcgtcggtggtatctc8700 cgtcaatgttgttaaaggacccggcggccatcaacaccatcacaaccccgtccgcgggcg8760 acatcctgcaagaggtcgccagagactatgttaccgattacccactccaaaacccgcagc8820 tcagagcagtggtcaagaacgtgaagaccgagctagacacattggccagtgacttattca8880 aatgtgaacctttctttcctcctttaatgagcgatatcttctcggcatctctcccggcat8940 atcaagacaggattgttcgcaagtgctccacgacttctacaatcaggagaaaagctgccg9000 agaggggctccgactctctcctcaaccggatgaaaaggaatgagatcaataagatgatgt9060 tacatctttgggctacctggggaaggagccctctggccagattagacaccagatgtctca9120 caacctgcaccaagcaattagcccaacagtatcggaaccagtcttggggaaagcagatcc9180 atggagtctcagtcggccaccccttagaactgttcggtcgaataacacccagccatagat9240 gcctacatgaggaggaccacggagatttcctgcaaaccttcgccagcgagcatgtgaacc9300 aagtggacaccgacatcaccacaactctggggccgttctacccttacataggctcggaga9360 cgcgagaacgggcagtcaaggttcgaaaaggagtgaattacgtagttgagccgcttctga9420 aacccgcagttcgactactaagagccattaattggttcattcccgaggagtcagatgcgt9480 cccatttgctgagcaatctattagcgtctgttaccgacatcaatcctcaagaccactact9540 catctaccgaagtaggggggggcaacgccgtccatcgctacagctgccgactatccgaca9600 aattgagcagagtcaacaacttatatcagttgcatacttatttatctgtcacaacagagc9660 ggttgaccaagtacagtcgaggatcaaaaaacactgacgcacacttccagagcatgatga9720 tttatgcacaaagccgtcatatagacctcatcttggagtctctgcacaccggagagatgg9780 taccgttggagtgtcatcatcacattgagtgcaatcactgtatagaggatatacccgacg9840 agccaatcacgggggacccggcttggactgaagtcaagtttccttcaagtcctcaggagc9900 cctttctttacatcaggcaacaagatctgccggtcaaagacaaactcgagcctgtgcctc9960 gcatgaacatcgtccgtcttgccggattgggtccggaggcgattagtgagctagcgcact10020 actttgttgcattccgagttatccgggcgtcagagacggatgtcgaccctaacgatgttc10080 tctcgtggacctggctgagccgaattgatcctgacaaattggttgagtatatcgtgcatg10140 tgttcgcttcactggaatggcatcatgtattaatgtcaggcgtgagtgtgagcgtcagag10200 atgcattctttaagatgctagtgtctaaaagaatctcagagactccgctaagttcattct10260 attatctggccaacctgttcgttgaccctcagactcgcgaagcactaatgagctctaaat10320 acgggttcagcccccccgccgagacagtccccaacgcaaatgccgccgcagccgaaataa10380 gaagatgctgtgcgaacagtgcgccgtcgatcttagaatcagcccttcacagccgtgagg10440 ttgtttggatgccaggaacgaacaattatggagacgttgtcatctggtctcattacatta10500 gattacggttcagcgaagttaaactagttgacattacacgatatcagcagtggtggagac10560 agtctgagcgagacccctacgatttggtcccggacatgcaggttcttgagagcgacctag10620 atacgctgatgaaacggataccgaggctcatgcgcaaggcgagacgtccccctcttcagg10680 taattcgagaggacctggatgtcgcagtcatcaatgctgatcatcccgctcactctgtgc10740 ttcagaacaaatacaggaaattgattttcagagagccgaagattatcacgggagctgtgt10800 acaagtacctctccctaaaatcagagttgacagagttcacctcagcaatggtgatcggag10860 acggaactggaggtatcaccgccgccatgatggccgatgggatagatgtgtggtatcaga10920 cgctcgtcaactatgaccacgtgacacaacagggattatccgtacaagccccggcagcat10980 tggatcttctgcgcggggcaccctctggtaggctcttgaatccgggaagattcgcatcat11040 ttgggtctgacctaactgaccctcgatttacagcctactttgatcaatatcccccgttca11100 aggtggacactctatggtctgacgcagagggcgacttttgggacaagccttccaagttga11160 atcaatactttgagaacatcattgctttgagacatcggttcgtgaagacaaatggacagc11220 ttgtcgtgaaggtgtatctgactcaagacactgctaccacaattgaagcattcagaaaga11280 agctgtccccatgcgccatcatcgtgtctctcttctcgacggaaggctccacagaatgct11340 tcgtcctaagcaatctcatcgcaccagacacccctgtcgaccttgagatggtggagaata11400 tccctaaactaacatcccttgttccccagaggacgacagtgaaatgctattcccgacgag11460 tagcgtgcatcagtaaaaggtggggacttttcagatctccgagcatagcccttgaagtcc11520 aaccgttccttcactacatcacaaaggtcatctcagacaaaggaacacaactgagtctca11580 tggcggtagctgacacaatgatcaacagttacaagaaggctatctcaccccgagtgttcg11640 atctacaccggcatagggccgcactgggtttcgggaggagatccttgcatctcatctggg11700 ggatgatcatctcaccaatcgcttaccagcattttgagaatccggccaagttgatggatg11760 tcctggacatgttgaccaataacatctcagctttcttatcgatatcgtcgtcaggatttg11820 acctgtcatttagtgtcagtgcagaccgagatgtccggattgacagcaaacttgtcagac11880 tcccgctattcgaaggatcagacctaaaattcatgaaaaccatcatgtctaccctcggat11940 ctgtgttcaaccaggtcgagccttttaaggggatcgccataaacccttctaaactaatga12000 ctgtcaagaggacacaggagttacgttacaacaacctaatttacactaaggatgccatcc12060 tattccccaatgaagcggcaaaaaacactgccccgcttcgagccaacatggtataccccg12120 tccggggagatctattcgcccctaccgatcgcataccaatcatgactctagtcagcgatg12180 agacaacacctcagcactctcctccagaggatgaggcataactgaatcctccctgaaggc12240 tcacatgtcccacgcgacgcaagatataacgacaagcaactcgccctattaactgtgatt12300 aataaaaaaccgattattcagttgcttgagggagtttcaatccgttcagtgtatgatagg12360 aagtttctgagatggtggggattagggggcacctagagtatgtttgttcgttttatgcgt12420 cgt12423 (FarmingtonrhabdovirusRNA) SEQIDNO:2 uuacgacgcauaagcugagaaacauaagagacuauguucauagucacccuguauucauua60 uugacuuuuaugaccuauuauucgugaggucauaugugagguaaugucaucugcuuaugc120 guuugcuuauaagauaaaacgauagacccuucacggguaaauccuucuccuugcaguucu180 cgccaaguaccuccaaagucagacgauggcucguccgcuagcugcugcgcaacaucucau240 aaccgagcgucauucccuucaggcgacucugucgcgggcguccaagaccagagccgagga300 auucgucaaagauuucuaccuucaagagcaguauucugucccgaccaucccgacggacga360 cauugcccagucugggcccaugcugcuucaggccauccugagcgaggaauacacaaaggc420 cacugacauagcccaauccauccucuggaacacucccacacccaacgggcuccucagaga480 gcaucuagaugccgaugggggaggcucauucacagcgcugcccgcgucugcaaucagacc540 cagcgacgaggcgaaugcaugggccgcucgcaucuccgacucaggguuggggccugucuu600 cuaugcagcccucgcugcuuacaucaucggcuggucaggaagaggagagacuagccgcgu660 gcagcagaacauaggucagaaauggcugaugaaccugaacgcaaucuucggcaccacgau720 cacccauccaacaaccgugcgucugccaaucaacgucgucaacaacagccucgcagugag780 gaacggacuugcugccacacucuggcuauacuaccguucaucaccucagagucaggacgc840 guucuucuaugggcucauccgucccuguugcaguggauaucucggccugcuacaucgggu900 gcaggagauugaugagauggagccggacuuccucagugacccccggaucauccaggugaa960 ugaggucuacagugcacucagagcccugguucaacugggaaacgacuucaagaccgccga1020 ugaugagcccaugcaggucugggcgugcaggggaaucaacaacggauaucugacauaucu1080 cucagaaacuccugcgaagaaaggagcuguugugcuuauguuugcccaaugcaugcugaa1140 gggcgacucugaggccuggaacagcuaccgcacugcaaccugggugaugcccuauugcga1200 caauguggcccuaggagcgauggcaggcuacauccaagcccgccagaacaccagggcaua1260 ugaggucucagcccagacaggucucgacgucaacauggccgcggucaaggacuuugaggc1320 caguucaaaacccaaggcugcuccaaucucgcugaucccacgccccgcugaugucgcauc1380 ccgcaccucugagcgcccaucuauuccugagguugacagcgacgaagagcucggaggaau1440 guaaaccaauaagcuucacugccgguaguuuaggcauacacacgcaguuccguuauccau1500 cacacccgucccuucuuuuaugcugcuauuauuucaguugcuaagcuuccugauuugauu1560 aacaaaaaaccguagaccuccuacgugagguauagcuagaaauugguucuaucgguugag1620 agucuuuguacuauuagccauggaggacuauuugucuagcuuagaggccgcgagagagcu1680 cguccggacggagcuggagcccaagcguaaccucauagccagcuuagaguccgacgaucc1740 cgauccgguaauagcgccagcgguaaaaccaaaacaucccaagccaugccugagcacuaa1800 agaagaggaucaucuccccucucuucgccuacuauucggcgcaaaacgagacaccucggu1860 gggcguagagcagacucuccacaagcgucucugcgcuugucucgacgguuaccugaccau1920 gacgaagaaagaggccaaugccuuuaaggccgcggcugaagcagcagcauuagcagucau1980 ggacauuaagauggagcaucagcgccaggaucuagaggaucugaccgcugcuaucccuag2040 gauagaauucaaacucaaugccauccuggaaaacaacaaggagauagccaaggcuguaac2100 ugcugcuaaggagauggagcgggagaugucguggggggaaagcgccgccagcucgcucaa2160 gucugucacccuagaugagucguuuaggggcccugaagagcuuucagagucauuuggcau2220 ccgauauaaggucagaaccuggaaugaguucaagaaggcgcuggaaaccagcauugugga2280 ccugaggccuagcccuguuucauuuagggaauuacggacuauguggcugucucuugacac2340 cuccuuuaggcucauuggguuugccuucauucccacaugcgagcgccuggagaccaaagc2400 caaaugcaaggagacaaggacucuacucccccuugcagagucgaucaugcgaagauggga2460 ccugcgggauccaaccaucuuggagaaagccugcguaguaaugaugauccgugggaauga2520 gauugcaucgcugaaucagguaaaagauguucucccgaccacaauucguggguggaagau2580 cgcuuauuagucacugcucccauuagucccacuagacggcauacuuccauuccgcccuuu2640 aauuccccugucagacacucaugcuccgaaaucacuaaccauccuuguccaccaagcaau2700 acgcauauucaguagcacugcaucucgcccucccccuaucaagccccagcgcugcagauc2760 uucaccacauauauacaugcaucaacuacaugugauuuagaaaaaaccagacccuucacg2820 gguaauagccuaacucacgaacguuccucucguuucguaugauaaggccuuaagcauugu2880 cgauacggucguuaugcgucgguucuuuuuaggagagagcagugccccugcgagggacug2940 ggaguccgagcgaccuccccccuaugcuguugaggucccucaaagucacgggauaagagu3000 caccggguacuuccagugcaacgagcguccgaaauccaagaagacccuccacagcuucgc3060 cguaaaacucugcgacgcaauuaagccgguucgagcggaugcucccagcuugaagauagc3120 aauauggacggcucuagaucuggccuucgugaaaccucccaauggaacuguaacaauaga3180 ugcggcggugaaagcuacaccgcuaaucgggaacacccaguacaccguaggcgaugaaau3240 cuuccagaugcuagggagaagggguggccugaucgucaucaggaacuuaccccaugauua3300 uccucgaacguugauugaguucgccucucccgagccuugagcaccagggcaucgguccgc3360 ccgcccugugaucucccguagccgggcucagcgaucaagccggcccgggucgggggggac3420 uggugcaacacaaggggcggcaguggacgcugauuaacaaaaaaccaccuauauagaccc3480 cucacggucuuagacucuguugccagcugacaaccaacacacaagacaucucucugauuc3540 agccgacccgaucgauuccuccccacccaauuccuaccaacgcacuccucacaagcucca3600 ccaugcucaggauccagaucccuccgauugcuaucauucugguaagucuccucacacucg3660 accuguccggugcaaggaggacaaccacacaaagaaucccucuccuuaaugauucguggg3720 auuuguucucgagcuauggcgacauucccgaagaacuugucguauaccagaacuacagcc3780 acaauuccuccgaguuacccccuccuggcuucgagagaugguacauaaaccgaagagugg3840 cagacacuuccauaccgugcaggggccccugucuagugcccuacauccuucauggccuca3900 augacacaacugucucucgacggggaggaggauggcgaagguccggaaugaaguacccaa3960 cccacgcugucaggcuaggcccuucaacagacgacgagagaguugaggaagacaucggcu4020 acgucaaugucuccgcacuauccugcacagggucgcccguugagauggcgauaccaacaa4080 uccccgacugcaccagugcuauccauccacgauccgagguuacugugcccgucaagcucg4140 augucaugagacgaaaucccaacuacccucccauuagagcguggucgugcaucggacaga4200 aaaucaccaaccgaugugauugggcacucuucggcgagaaccucauauauacucaaguug4260 aagcuagcucucuagcauucaagcacacaagagccucucuuuugaacgaauccaacggga4320 uagacgcugaaggacgugcaguucccuauauccucggggauaucgaacccggguacugcc4380 gaacccuauucaacacaugggucucuagugagaucgugucaugcacgcccaucgaacuug4440 uccuaguugaccugaacccuuuguccccgggacauggcggauaugcuguauugcugccaa4500 acggagacaaaguggauguacacgacaagcaugcaugggauggggacaacaaaaugugga4560 gauggguguacgagaagaaagaucccugugcguucgagcugguauccagggaaguguguc4620 uuuucucacugaguagggguaguagacugagaggagcaaccccuccccaaggagagcucc4680 ucaccugcccgcauucgggaaaggcauuugaccugaagggggcccgaaggauuacaccca4740 uuucaugcaaaaucgacauggaauaugacuugcugucacuaccaaccggagucauccuag4800 gccuccaccuaucagaacucgggaccuccuuuggcaaccucucaaugagucuugaaaugu4860 augaaccugccacaacucugaccccugagcaaaucaacuucucgcuuaaagagcugggaa4920 gcuggaccgaggcucaacugaagagccugucucacucaaucugccucuccacauucucca4980 uaugggaacuaucgguugggaugaucgaucuaaacccuaccagggcagcaagggccuugc5040 uccaugaugauaacauacuggcaacauucgagaacggucacuuuuccaucgucagauguc5100 guccggaaauaguucaagucccuucgcauccucgagcaugucacauggaucuccgcccuu5160 augacaagcaaucacgggcaucaacccuggugguuccccuugacaacagcacugcccucc5220 ugguccccgacaacaucgugguugaaggaguagaggccagucuaugcaaccacuccguug5280 ccaucacgcugucgaagaacagaacucacucauacagccucuauccccagggucguccug5340 ugcuucgacagaaaggugccguggagcucccgacgauagggccccuccaguuacauccug5400 ccacucgaguggaccuuuauacacugaaagaguuccaggaggaccgaauagcgcgcaguc5460 gagucacagacaucaaggcugccguugacgaucugcgugcgaaguggcguaaaggcaaau5520 uugaggcggacaccacgggagggggacuuuggucggcgauugugggagucuucaguucuc5580 ucgggggguucuucaugaggcccuugauugcucucgcggcgauagugaccucaaucauca5640 uccuguauauccuucugcguguacugugugcugccucauguucgacacaccgaagaguaa5700 ggcaggacucuugguaaagaggacugcgauuguugaguggacaaacccuaggccuauucc5760 gauuuagaaaaaaccagaccucucacgaggucuuuucuacuagcuggguuuuccucauuc5820 uauccagagccauggccuucgacccgaacuggcagagagaagguuaugaaugggauccgu5880 caagugagggcagaccgaccgaugagaacgaagacgacagaggucaucggccaaaaacga5940 gacuucguacauuccuugcccgcacguuaaauagcccuauccgagcccuauucuacacaa6000 uauuccuaggaauucgagcgguuugggacggguucaaaagacuccuaccugugaggaccg6060 aaaaggguuaugcgagguuuucugagugcgucacauauggaaugaucggaugugaugagu6120 guguaauagacccggugaggguugucauugagcugaccgagaugcaguuaccgauuaaag6180 gcaaaggcucuacgagguugagagcaaugauaacugaagaccuucucacggggaugcgca6240 cagccgugccucagaucagagugagaucgaagauccuagcagagcgguuagggagagcaa6300 ucggccgagagaccuugccggcaaugauccaucaugagugggcauuugugauggggaaga6360 uucucacuuucauggcagacaauguggguaugaacgcugacacggucgagggcguucuau6420 cacuaucagaggucacacggcgaugggauaucggcaacucuguguccgcaguguucaauc6480 cugauggccuuacuaucagaguagaaaacacggguuacaucaugaccagagagacugccu6540 gcaugaucggagacauucaugcucaauuugcaauccaauaccuagcugcauaccuagacg6600 aggugaucggcacaaggacgucucucucacccgccgaacugaccucucucaaacuauggg6660 gacuuaacguccugaaacuccuaggacggaacgguuaugaggugaucgccugcauggagc6720 ccauaggguacgcuguccugaugaugggaagagacaggaguccugaucccuaugucaaug6780 acaccuauuuaaacagcauccucucagaauucccugucgacucugacgcucgagccugcg6840 uugaagcccucuuaacuaucuauaugagcuucggcacaccccauaaagucucggacgcau6900 ucggccucuucagaauguugggacauccgaugguugauggagcugacgggauugaaaaga6960 ugcgaagguuaagcaagaaggucaagaucccagaccagucuacagcgaucgaccucgggg7020 cuaucauggccgaacuguuugugcggaguuucguaaagaagcacaaaagguggcccaacu7080 gcuccaucaaucucccgccacgacaccccuuccaccacgcccgccuauguggguaugucc7140 cggcugaaacccauccccuaaacaacacugcauccugggcggcuguggaguucaaccagg7200 aauucgagccgccgagacaguacaaccuugcagacaucauugaugacaagucgugcucuc7260 ccaacaagcaugagcuauauggugcuuggaugaagucaaaaacagcuggguggcaggaac7320 aaaagaagcucauacuccgaugguucacugagaccaugguuaaaccuucggagcuccugg7380 aagagauugaugcacacggcuuccgagaagaggauaaguugauuggauuaacaccaaagg7440 agagagagcugaaauuaacaccaagaauguucuccuugaugacauucaaguucagaaccu7500 accaaguccucacugagaguauggucgccgaugagauccucccgcacuucccccagauca7560 ccaugaccauguccaaccacgaacucacaaagagguugauuagcagaacgagaccucaau7620 cuggaggagggcgugauguucacaucaccgugaacauagauuuccagaaauggaacacaa7680 acaugagacacggacuggucaaacaugucuucgagcgacuggacaaccucuuuggcuuca7740 ccaacuuaaucagacgaacucaugaauacuuccaggaggcgaaauacuaucuggcugaag7800 auggaacuaaucugucguucgacaggaacggggaguuaauagauggcccauacguuuaca7860 ccggaucauacggggggaacgagggguuacgacagaagcccuggacaauaguuaccgugu7920 guggaauauacaagguagcuagagaccugaaaaucaaacaucagaucaccggucagggag7980 auaaucagguggucacccuaauauuuccggaucgagaguugccuucagauccgguggaga8040 ggagcaaguacuguagagacaagagcagucaguuccugacacgucucagucaauauuucg8100 cugagguugguuugcccgucaagacugaagagacauggaugucaucacgucucuaugcuu8160 acgguaagcgcauguucuuagagggaguuccacuuaagauguuucucaagaagauaggca8220 gagcuuucgcccucucgaaugaguuugucccgucccucgaggaagaucuggccagagucu8280 ggagugccaccagcgcagcgguagagcuugaccuaacucccuacguaggauauguccucg8340 ggugcugcuugucugcgcaggcgaucagaaaucaccucaucuacuccccuguucuggagg8400 gcccucugcugguuaaggccuacgagcguaaguucauuaacuacgacggaggaacaaagc8460 ggggggcgaugcccggccuacguccaaccuuugagagccuagucaaaaguaucugcugga8520 agccaaaggccaucggaggguggccgguauugauguuagaagaucucaucaucaaagggu8580 ucccugauccggcgacuagcgcccuggcucaauugaagucaauggugccauauaccucug8640 guaucgaccgggagaucauacuuuccugucucaaccuucccuuaucgucggugguaucuc8700 cgucaauguuguuaaaggacccggcggccaucaacaccaucacaaccccguccgcgggcg8760 acauccugcaagaggucgccagagacuauguuaccgauuacccacuccaaaacccgcagc8820 ucagagcaguggucaagaacgugaagaccgagcuagacacauuggccagugacuuauuca8880 aaugugaaccuuucuuuccuccuuuaaugagcgauaucuucucggcaucucucccggcau8940 aucaagacaggauuguucgcaagugcuccacgacuucuacaaucaggagaaaagcugccg9000 agaggggcuccgacucucuccucaaccggaugaaaaggaaugagaucaauaagaugaugu9060 uacaucuuugggcuaccuggggaaggagcccucuggccagauuagacaccagaugucuca9120 caaccugcaccaagcaauuagcccaacaguaucggaaccagucuuggggaaagcagaucc9180 auggagucucagucggccaccccuuagaacuguucggucgaauaacacccagccauagau9240 gccuacaugaggaggaccacggagauuuccugcaaaccuucgccagcgagcaugugaacc9300 aaguggacaccgacaucaccacaacucuggggccguucuacccuuacauaggcucggaga9360 cgcgagaacgggcagucaagguucgaaaaggagugaauuacguaguugagccgcuucuga9420 aacccgcaguucgacuacuaagagccauuaauugguucauucccgaggagucagaugcgu9480 cccauuugcugagcaaucuauuagcgucuguuaccgacaucaauccucaagaccacuacu9540 caucuaccgaaguaggggggggcaacgccguccaucgcuacagcugccgacuauccgaca9600 aauugagcagagucaacaacuuauaucaguugcauacuuauuuaucugucacaacagagc9660 gguugaccaaguacagucgaggaucaaaaaacacugacgcacacuuccagagcaugauga9720 uuuaugcacaaagccgucauauagaccucaucuuggagucucugcacaccggagagaugg9780 uaccguuggagugucaucaucacauugagugcaaucacuguauagaggauauacccgacg9840 agccaaucacgggggacccggcuuggacugaagucaaguuuccuucaaguccucaggagc9900 ccuuucuuuacaucaggcaacaagaucugccggucaaagacaaacucgagccugugccuc9960 gcaugaacaucguccgucuugccggauuggguccggaggcgauuagugagcuagcgcacu10020 acuuuguugcauuccgaguuauccgggcgucagagacggaugucgacccuaacgauguuc10080 ucucguggaccuggcugagccgaauugauccugacaaauugguugaguauaucgugcaug10140 uguucgcuucacuggaauggcaucauguauuaaugucaggcgugagugugagcgucagag10200 augcauucuuuaagaugcuagugucuaaaagaaucucagagacuccgcuaaguucauucu10260 auuaucuggccaaccuguucguugacccucagacucgcgaagcacuaaugagcucuaaau10320 acggguucagcccccccgccgagacaguccccaacgcaaaugccgccgcagccgaaauaa10380 gaagaugcugugcgaacagugcgccgucgaucuuagaaucagcccuucacagccgugagg10440 uuguuuggaugccaggaacgaacaauuauggagacguugucaucuggucucauuacauua10500 gauuacgguucagcgaaguuaaacuaguugacauuacacgauaucagcagugguggagac10560 agucugagcgagaccccuacgauuuggucccggacaugcagguucuugagagcgaccuag10620 auacgcugaugaaacggauaccgaggcucaugcgcaaggcgagacgucccccucuucagg10680 uaauucgagaggaccuggaugucgcagucaucaaugcugaucaucccgcucacucugugc10740 uucagaacaaauacaggaaauugauuuucagagagccgaagauuaucacgggagcugugu10800 acaaguaccucucccuaaaaucagaguugacagaguucaccucagcaauggugaucggag10860 acggaacuggagguaucaccgccgccaugauggccgaugggauagaugugugguaucaga10920 cgcucgucaacuaugaccacgugacacaacagggauuauccguacaagccccggcagcau10980 uggaucuucugcgcggggcacccucugguaggcucuugaauccgggaagauucgcaucau11040 uugggucugaccuaacugacccucgauuuacagccuacuuugaucaauaucccccguuca11100 agguggacacucuauggucugacgcagagggcgacuuuugggacaagccuuccaaguuga11160 aucaauacuuugagaacaucauugcuuugagacaucgguucgugaagacaaauggacagc11220 uugucgugaagguguaucugacucaagacacugcuaccacaauugaagcauucagaaaga11280 agcuguccccaugcgccaucaucgugucucucuucucgacggaaggcuccacagaaugcu11340 ucguccuaagcaaucucaucgcaccagacaccccugucgaccuugagaugguggagaaua11400 ucccuaaacuaacaucccuuguuccccagaggacgacagugaaaugcuauucccgacgag11460 uagcgugcaucaguaaaagguggggacuuuucagaucuccgagcauagcccuugaagucc11520 aaccguuccuucacuacaucacaaaggucaucucagacaaaggaacacaacugagucuca11580 uggcgguagcugacacaaugaucaacaguuacaagaaggcuaucucaccccgaguguucg11640 aucuacaccggcauagggccgcacuggguuucgggaggagauccuugcaucucaucuggg11700 ggaugaucaucucaccaaucgcuuaccagcauuuugagaauccggccaaguugauggaug11760 uccuggacauguugaccaauaacaucucagcuuucuuaucgauaucgucgucaggauuug11820 accugucauuuagugucagugcagaccgagauguccggauugacagcaaacuugucagac11880 ucccgcuauucgaaggaucagaccuaaaauucaugaaaaccaucaugucuacccucggau11940 cuguguucaaccaggucgagccuuuuaaggggaucgccauaaacccuucuaaacuaauga12000 cugucaagaggacacaggaguuacguuacaacaaccuaauuuacacuaaggaugccaucc12060 uauuccccaaugaagcggcaaaaaacacugccccgcuucgagccaacaugguauaccccg12120 uccggggagaucuauucgccccuaccgaucgcauaccaaucaugacucuagucagcgaug12180 agacaacaccucagcacucuccuccagaggaugaggcauaacugaauccucccugaaggc12240 ucacaugucccacgcgacgcaagauauaacgacaagcaacucgcccuauuaacugugauu12300 aauaaaaaaccgauuauucaguugcuugagggaguuucaauccguucaguguaugauagg12360 aaguuucugagaugguggggauuagggggcaccuagaguauguuuguucguuuuaugcgu12420 cgu12423 (FarmingtonrhabdovirusORF1protein) SEQIDNO:3 MARPLAAAQHLITERHSLQATLSRASKTRAEEFVKDFYLQEQYSVPTIPTDDIAQSGPML LQAILSEEYTKATDIAQSILWNTPTPNGLLREHLDADGGGSFTALPASAIRPSDEANAWA ARISDSGLGPVFYAALAAYIIGWSGRGETSRVQQNIGQKWLMNLNAIFGTTITHPTTVRL PINVVNNSLAVRNGLAATLWLYYRSSPQSQDAFFYGLIRPCCSGYLGLLHRVQEIDEMEP DFLSDPRIIQVNEVYSALRALVQLGNDFKTADDEPMQVWACRGINNGYLTYLSETPAKKG AVVLMFAQCMLKGDSEAWNSYRTATWVMPYCDNVALGAMAGYIQARQNTRAYEVSAQTGL DVNMAAVKDFEASSKPKAAPISLIPRPADVASRTSERPSIPEVDSDEELGGM (FarmingtonrhabdovirusORF2protein) SEQIDNO:4 MEDYLSSLEAARELVRTELEPKRNLIASLESDDPDPVIAPAVKPKHPKPCLSTKEEDHLP SLRLLFGAKRDTSVGVEQTLHKRLCACLDGYLTMTKKEANAFKAAAEAAALAVMDIKMEH QRQDLEDLTAAIPRIEFKLNAILENNKEIAKAVTAAKEMEREMSWGESAASSLKSVTLDE SFRGPEELSESFGIRYKVRTWNEFKKALETSIVDLRPSPVSFRELRTMWLSLDTSFRLIG FAFIPTCERLETKAKCKETRTLLPLAESIMRRWDLRDPTILEKACVVMMIRGNEIASLNQ VKDVLPTTIRGWKIAY (FarmingtonrhabdovirusORF3protein) SEQIDNO:5 MRRFFLGESSAPARDWESERPPPYAVEVPQSHGIRVTGYFQCNERPKSKKTLHSFAVKLC DAIKPVRADAPSLKIAIWTALDLAFVKPPNGTVTIDAAVKATPLIGNTQYTVGDEIFQML GRRGGLIVIRNLPHDYPRTLIEFASPEP (FarmingtonrhabdovirusORF4protein) SEQIDNO:6 MLRIQIPPIAIILVSLLTLDLSGARRTTTQRIPLLNDSWDLFSSYGDIPEELVVYQNYSH NSSELPPPGFERWYINRRVADTSIPCRGPCLVPYILHGLNDTTVSRRGGGWRRSGMKYPT HAVRLGPSTDDERVEEDIGYVNVSALSCTGSPVEMAIPTIPDCTSAIHPRSEVTVPVKLD VMRRNPNYPPIRAWSCIGQKITNRCDWALFGENLIYTQVEASSLAFKHTRASLLNESNGI DAEGRAVPYILGDIEPGYCRTLFNTWVSSEIVSCTPIELVLVDLNPLSPGHGGYAVLLPN GDKVDVHDKHAWDGDNKMWRWVYEKKDPCAFELVSREVCLFSLSRGSRLRGATPPQGELL TCPHSGKAFDLKGARRITPISCKIDMEYDLLSLPTGVILGLHLSELGTSFGNLSMSLEMY EPATTLTPEQINFSLKELGSWTEAQLKSLSHSICLSTFSIWELSVGMIDLNPTRAARALL HDDNILATFENGHFSIVRCRPEIVQVPSHPRACHMDLRPYDKQSRASTLVVPLDNSTALL VPDNIVVEGVEASLCNHSVAITLSKNRTHSYSLYPQGRPVLRQKGAVELPTIGPLQLHPA TRVDLYTLKEFQEDRIARSRVTDIKAAVDDLRAKWRKGKFEADTTGGGLWSAIVGVFSSL GGFFMRPLIALAAIVTSIIILYILLRVLCAASCSTHRRVRQDSW (FarmingtonrhabdovirusORF5protein) SEQIDNO:7 MAFDPNWQREGYEWDPSSEGRPTDENEDDRGHRPKTRLRTFLARTLNSPIRALFYTIFLG IRAVWDGFKRLLPVRTEKGYARFSECVTYGMIGCDECVIDPVRVVIELTEMQLPIKGKGS TRLRAMITEDLLTGMRTAVPQIRVRSKILAERLGRAIGRETLPAMIHHEWAFVMGKILTF MADNVGMNADTVEGVLSLSEVTRRWDIGNSVSAVFNPDGLTIRVENTGYIMTRETACMIG DIHAQFAIQYLAAYLDEVIGTRTSLSPAELTSLKLWGLNVLKLLGRNGYEVIACMEPIGY AVLMMGRDRSPDPYVNDTYLNSILSEFPVDSDARACVEALLTIYMSFGTPHKVSDAFGLF RMLGHPMVDGADGIEKMRRLSKKVKIPDQSTAIDLGAIMAELFVRSFVKKHKRWPNCSIN LPPRHPFHHARLCGYVPAETHPLNNTASWAAVEFNQEFEPPRQYNLADIIDDKSCSPNKH ELYGAWMKSKTAGWQEQKKLILRWFTETMVKPSELLEEIDAHGFREEDKLIGLTPKEREL KLTPRMFSLMTFKFRTYQVLTESMVADEILPHFPQITMTMSNHELTKRLISRTRPQSGGG RDVHITVNIDFQKWNTNMRHGLVKHVFERLDNLFGFTNLIRRTHEYFQEAKYYLAEDGTN LSFDRNGELIDGPYVYTGSYGGNEGLRQKPWTIVTVCGIYKVARDLKIKHQITGQGDNQV VTLIFPDRELPSDPVERSKYCRDKSSQFLTRLSQYFAEVGLPVKTEETWMSSRLYAYGKR MFLEGVPLKMFLKKIGRAFALSNEFVPSLEEDLARVWSATSAAVELDLTPYVGYVLGCCL SAQAIRNHLIYSPVLEGPLLVKAYERKFINYDGGTKRGAMPGLRPTFESLVKSICWKPKA IGGWPVLMLEDLIIKGFPDPATSALAQLKSMVPYTSGIDREIILSCLNLPLSSVVSPSML LKDPAAINTITTPSAGDILQEVARDYVTDYPLQNPQLRAVVKNVKTELDTLASDLFKCEP FFPPLMSDIFSASLPAYQDRIVRKCSTTSTIRRKAAERGSDSLLNRMKRNEINKMMLHLW ATWGRSPLARLDTRCLTTCTKQLAQQYRNQSWGKQIHGVSVGHPLELFGRITPSHRCLHE EDHGDFLQTFASEHVNQVDTDITTTLGPFYPYIGSETRERAVKVRKGVNYVVEPLLKPAV RLLRAINWFIPEESDASHLLSNLLASVTDINPQDHYSSTEVGGGNAVHRYSCRLSDKLSR VNNLYQLHTYLSVTTERLTKYSRGSKNTDAHFQSMMIYAQSRHIDLILESLHTGEMVPLE CHHHIECNHCIEDIPDEPITGDPAWTEVKFPSSPQEPFLYIRQQDLPVKDKLEPVPRMNI VRLAGLGPEAISELAHYFVAFRVIRASETDVDPNDVLSWTWLSRIDPDKLVEYIVHVFAS LEWHHVLMSGVSVSVRDAFFKMLVSKRISETPLSSFYYLANLFVDPQTREALMSSKYGFS PPAETVPNANAAAAEIRRCCANSAPSILESALHSREVVWMPGTNNYGDVVIWSHYIRLRF SEVKLVDITRYQQWWRQSERDPYDLVPDMQVLESDLDTLMKRIPRLMRKARRPPLQVIRE DLDVAVINADHPAHSVLQNKYRKLIFREPKIITGAVYKYLSLKSELTEFTSAMVIGDGTG GITAAMMADGIDVWYQTLVNYDHVTQQGLSVQAPAALDLLRGAPSGRLLNPGRFASFGSD LTDPRFTAYFDQYPPFKVDTLWSDAEGDFWDKPSKLNQYFENIIALRHRFVKTNGQLVVK VYLTQDTATTIEAFRKKLSPCAIIVSLFSTEGSTECFVLSNLIAPDTPVDLEMVENIPKL TSLVPQRTTVKCYSRRVACISKRWGLFRSPSIALEVQPFLHYITKVISDKGTQLSLMAVA DTMINSYKKAISPRVFDLHRHRAALGFGRRSLHLIWGMIISPIAYQHFENPAKLMDVLDM LTNNISAFLSISSSGFDLSFSVSADRDVRIDSKLVRLPLFEGSDLKFMKTIMSTLGSVFN QVEPFKGIAINPSKLMTVKRTQELRYNNLIYTKDAILFPNEAAKNTAPLRANMVYPVRGD LFAPTDRIPIMTLVSDETTPQHSPPEDEA (FarmingtonrhabdovirusORF1) SEQIDNO:8 atggctcgtccgctagctgctgcgcaacatctcataaccgagcgtcattcccttcaggcg60 actctgtcgcgggcgtccaagaccagagccgaggaattcgtcaaagatttctaccttcaa120 gagcagtattctgtcccgaccatcccgacggacgacattgcccagtctgggcccatgctg180 cttcaggccatcctgagcgaggaatacacaaaggccactgacatagcccaatccatcctc240 tggaacactcccacacccaacgggctcctcagagagcatctagatgccgatgggggaggc300 tcattcacagcgctgcccgcgtctgcaatcagacccagcgacgaggcgaatgcatgggcc360 gctcgcatctccgactcagggttggggcctgtcttctatgcagccctcgctgcttacatc420 atcggctggtcaggaagaggagagactagccgcgtgcagcagaacataggtcagaaatgg480 ctgatgaacctgaacgcaatcttcggcaccacgatcacccatccaacaaccgtgcgtctg540 ccaatcaacgtcgtcaacaacagcctcgcagtgaggaacggacttgctgccacactctgg600 ctatactaccgttcatcacctcagagtcaggacgcgttcttctatgggctcatccgtccc660 tgttgcagtggatatctcggcctgctacatcgggtgcaggagattgatgagatggagccg720 gacttcctcagtgacccccggatcatccaggtgaatgaggtctacagtgcactcagagcc780 ctggttcaactgggaaacgacttcaagaccgccgatgatgagcccatgcaggtctgggcg840 tgcaggggaatcaacaacggatatctgacatatctctcagaaactcctgcgaagaaagga900 gctgttgtgcttatgtttgcccaatgcatgctgaagggcgactctgaggcctggaacagc960 taccgcactgcaacctgggtgatgccctattgcgacaatgtggccctaggagcgatggca1020 ggctacatccaagcccgccagaacaccagggcatatgaggtctcagcccagacaggtctc1080 gacgtcaacatggccgcggtcaaggactttgaggccagttcaaaacccaaggctgctcca1140 atctcgctgatcccacgccccgctgatgtcgcatcccgcacctctgagcgcccatctatt1200 cctgaggttgacagcgacgaagagctcggaggaatg1236 (FarmingtonrhabdovirusORF2) SEQIDNO:9 atggaggactatttgtctagcttagaggccgcgagagagctcgtccggacggagctggag60 cccaagcgtaacctcatagccagcttagagtccgacgatcccgatccggtaatagcgcca120 gcggtaaaaccaaaacatcccaagccatgcctgagcactaaagaagaggatcatctcccc180 tctcttcgcctactattcggcgcaaaacgagacacctcggtgggcgtagagcagactctc240 cacaagcgtctctgcgcttgtctcgacggttacctgaccatgacgaagaaagaggccaat300 gcctttaaggccgcggctgaagcagcagcattagcagtcatggacattaagatggagcat360 cagcgccaggatctagaggatctgaccgctgctatccctaggatagaattcaaactcaat420 gccatcctggaaaacaacaaggagatagccaaggctgtaactgctgctaaggagatggag480 cgggagatgtcgtggggggaaagcgccgccagctcgctcaagtctgtcaccctagatgag540 tcgtttaggggccctgaagagctttcagagtcatttggcatccgatataaggtcagaacc600 tggaatgagttcaagaaggcgctggaaaccagcattgtggacctgaggcctagccctgtt660 tcatttagggaattacggactatgtggctgtctcttgacacctcctttaggctcattggg720 tttgccttcattcccacatgcgagcgcctggagaccaaagccaaatgcaaggagacaagg780 actctactcccccttgcagagtcgatcatgcgaagatgggacctgcgggatccaaccatc840 ttggagaaagcctgcgtagtaatgatgatccgtgggaatgagattgcatcgctgaatcag900 gtaaaagatgttctcccgaccacaattcgtgggtggaagatcgcttat948 (FarmingtonrhabdovirusORF3) SEQIDNO:10 atgcgtcggttctttttaggagagagcagtgcccctgcgagggactgggagtccgagcga60 cctcccccctatgctgttgaggtccctcaaagtcacgggataagagtcaccgggtacttc120 cagtgcaacgagcgtccgaaatccaagaagaccctccacagcttcgccgtaaaactctgc180 gacgcaattaagccggttcgagcggatgctcccagcttgaagatagcaatatggacggct240 ctagatctggccttcgtgaaacctcccaatggaactgtaacaatagatgcggcggtgaaa300 gctacaccgctaatcgggaacacccagtacaccgtaggcgatgaaatcttccagatgcta360 gggagaaggggtggcctgatcgtcatcaggaacttaccccatgattatcctcgaacgttg420 attgagttcgcctctcccgagcct444 (FarmingtonrhabdovirusORF4) SEQIDNO:11 atgctcaggatccagatccctccgattgctatcattctggtaagtctcctcacactcgac60 ctgtccggtgcaaggaggacaaccacacaaagaatccctctccttaatgattcgtgggat120 ttgttctcgagctatggcgacattcccgaagaacttgtcgtataccagaactacagccac180 aattcctccgagttaccccctcctggcttcgagagatggtacataaaccgaagagtggca240 gacacttccataccgtgcaggggcccctgtctagtgccctacatccttcatggcctcaat300 gacacaactgtctctcgacggggaggaggatggcgaaggtccggaatgaagtacccaacc360 cacgctgtcaggctaggcccttcaacagacgacgagagagttgaggaagacatcggctac420 gtcaatgtctccgcactatcctgcacagggtcgcccgttgagatggcgataccaacaatc480 cccgactgcaccagtgctatccatccacgatccgaggttactgtgcccgtcaagctcgat540 gtcatgagacgaaatcccaactaccctcccattagagcgtggtcgtgcatcggacagaaa600 atcaccaaccgatgtgattgggcactcttcggcgagaacctcatatatactcaagttgaa660 gctagctctctagcattcaagcacacaagagcctctcttttgaacgaatccaacgggata720 gacgctgaaggacgtgcagttccctatatcctcggggatatcgaacccgggtactgccga780 accctattcaacacatgggtctctagtgagatcgtgtcatgcacgcccatcgaacttgtc840 ctagttgacctgaaccctttgtccccgggacatggcggatatgctgtattgctgccaaac900 ggagacaaagtggatgtacacgacaagcatgcatgggatggggacaacaaaatgtggaga960 tgggtgtacgagaagaaagatccctgtgcgttcgagctggtatccagggaagtgtgtctt1020 ttctcactgagtaggggtagtagactgagaggagcaacccctccccaaggagagctcctc1080 acctgcccgcattcgggaaaggcatttgacctgaagggggcccgaaggattacacccatt1140 tcatgcaaaatcgacatggaatatgacttgctgtcactaccaaccggagtcatcctaggc1200 ctccacctatcagaactcgggacctcctttggcaacctctcaatgagtcttgaaatgtat1260 gaacctgccacaactctgacccctgagcaaatcaacttctcgcttaaagagctgggaagc1320 tggaccgaggctcaactgaagagcctgtctcactcaatctgcctctccacattctccata1380 tgggaactatcggttgggatgatcgatctaaaccctaccagggcagcaagggccttgctc1440 catgatgataacatactggcaacattcgagaacggtcacttttccatcgtcagatgtcgt1500 ccggaaatagttcaagtcccttcgcatcctcgagcatgtcacatggatctccgcccttat1560 gacaagcaatcacgggcatcaaccctggtggttccccttgacaacagcactgccctcctg1620 gtccccgacaacatcgtggttgaaggagtagaggccagtctatgcaaccactccgttgcc1680 atcacgctgtcgaagaacagaactcactcatacagcctctatccccagggtcgtcctgtg1740 cttcgacagaaaggtgccgtggagctcccgacgatagggcccctccagttacatcctgcc1800 actcgagtggacctttatacactgaaagagttccaggaggaccgaatagcgcgcagtcga1860 gtcacagacatcaaggctgccgttgacgatctgcgtgcgaagtggcgtaaaggcaaattt1920 gaggcggacaccacgggagggggactttggtcggcgattgtgggagtcttcagttctctc1980 ggggggttcttcatgaggcccttgattgctctcgcggcgatagtgacctcaatcatcatc2040 ctgtatatccttctgcgtgtactgtgtgctgcctcatgttcgacacaccgaagagtaagg2100 caggactcttgg2112 (FarmingtonrhabdovirusORF5) SEQIDNO:12 atggccttcgacccgaactggcagagagaaggttatgaatgggatccgtcaagtgagggc60 agaccgaccgatgagaacgaagacgacagaggtcatcggccaaaaacgagacttcgtaca120 ttccttgcccgcacgttaaatagccctatccgagccctattctacacaatattcctagga180 attcgagcggtttgggacgggttcaaaagactcctacctgtgaggaccgaaaagggttat240 gcgaggttttctgagtgcgtcacatatggaatgatcggatgtgatgagtgtgtaatagac300 ccggtgagggttgtcattgagctgaccgagatgcagttaccgattaaaggcaaaggctct360 acgaggttgagagcaatgataactgaagaccttctcacggggatgcgcacagccgtgcct420 cagatcagagtgagatcgaagatcctagcagagcggttagggagagcaatcggccgagag480 accttgccggcaatgatccatcatgagtgggcatttgtgatggggaagattctcactttc540 atggcagacaatgtgggtatgaacgctgacacggtcgagggcgttctatcactatcagag600 gtcacacggcgatgggatatcggcaactctgtgtccgcagtgttcaatcctgatggcctt660 actatcagagtagaaaacacgggttacatcatgaccagagagactgcctgcatgatcgga720 gacattcatgctcaatttgcaatccaatacctagctgcatacctagacgaggtgatcggc780 acaaggacgtctctctcacccgccgaactgacctctctcaaactatggggacttaacgtc840 ctgaaactcctaggacggaacggttatgaggtgatcgcctgcatggagcccatagggtac900 gctgtcctgatgatgggaagagacaggagtcctgatccctatgtcaatgacacctattta960 aacagcatcctctcagaattccctgtcgactctgacgctcgagcctgcgttgaagccctc1020 ttaactatctatatgagcttcggcacaccccataaagtctcggacgcattcggcctcttc1080 agaatgttgggacatccgatggttgatggagctgacgggattgaaaagatgcgaaggtta1140 agcaagaaggtcaagatcccagaccagtctacagcgatcgacctcggggctatcatggcc1200 gaactgtttgtgcggagtttcgtaaagaagcacaaaaggtggcccaactgctccatcaat1260 ctcccgccacgacaccccttccaccacgcccgcctatgtgggtatgtcccggctgaaacc1320 catcccctaaacaacactgcatcctgggcggctgtggagttcaaccaggaattcgagccg1380 ccgagacagtacaaccttgcagacatcattgatgacaagtcgtgctctcccaacaagcat1440 gagctatatggtgcttggatgaagtcaaaaacagctgggtggcaggaacaaaagaagctc1500 atactccgatggttcactgagaccatggttaaaccttcggagctcctggaagagattgat1560 gcacacggcttccgagaagaggataagttgattggattaacaccaaaggagagagagctg1620 aaattaacaccaagaatgttctccttgatgacattcaagttcagaacctaccaagtcctc1680 actgagagtatggtcgccgatgagatcctcccgcacttcccccagatcaccatgaccatg1740 tccaaccacgaactcacaaagaggttgattagcagaacgagacctcaatctggaggaggg1800 cgtgatgttcacatcaccgtgaacatagatttccagaaatggaacacaaacatgagacac1860 ggactggtcaaacatgtcttcgagcgactggacaacctctttggcttcaccaacttaatc1920 agacgaactcatgaatacttccaggaggcgaaatactatctggctgaagatggaactaat1980 ctgtcgttcgacaggaacggggagttaatagatggcccatacgtttacaccggatcatac2040 ggggggaacgaggggttacgacagaagccctggacaatagttaccgtgtgtggaatatac2100 aaggtagctagagacctgaaaatcaaacatcagatcaccggtcagggagataatcaggtg2160 gtcaccctaatatttccggatcgagagttgccttcagatccggtggagaggagcaagtac2220 tgtagagacaagagcagtcagttcctgacacgtctcagtcaatatttcgctgaggttggt2280 ttgcccgtcaagactgaagagacatggatgtcatcacgtctctatgcttacggtaagcgc2340 atgttcttagagggagttccacttaagatgtttctcaagaagataggcagagctttcgcc2400 ctctcgaatgagtttgtcccgtccctcgaggaagatctggccagagtctggagtgccacc2460 agcgcagcggtagagcttgacctaactccctacgtaggatatgtcctcgggtgctgcttg2520 tctgcgcaggcgatcagaaatcacctcatctactcccctgttctggagggccctctgctg2580 gttaaggcctacgagcgtaagttcattaactacgacggaggaacaaagcggggggcgatg2640 cccggcctacgtccaacctttgagagcctagtcaaaagtatctgctggaagccaaaggcc2700 atcggagggtggccggtattgatgttagaagatctcatcatcaaagggttccctgatccg2760 gcgactagcgccctggctcaattgaagtcaatggtgccatatacctctggtatcgaccgg2820 gagatcatactttcctgtctcaaccttcccttatcgtcggtggtatctccgtcaatgttg2880 ttaaaggacccggcggccatcaacaccatcacaaccccgtccgcgggcgacatcctgcaa2940 gaggtcgccagagactatgttaccgattacccactccaaaacccgcagctcagagcagtg3000 gtcaagaacgtgaagaccgagctagacacattggccagtgacttattcaaatgtgaacct3060 ttctttcctcctttaatgagcgatatcttctcggcatctctcccggcatatcaagacagg3120 attgttcgcaagtgctccacgacttctacaatcaggagaaaagctgccgagaggggctcc3180 gactctctcctcaaccggatgaaaaggaatgagatcaataagatgatgttacatctttgg3240 gctacctggggaaggagccctctggccagattagacaccagatgtctcacaacctgcacc3300 aagcaattagcccaacagtatcggaaccagtcttggggaaagcagatccatggagtctca3360 gtcggccaccccttagaactgttcggtcgaataacacccagccatagatgcctacatgag3420 gaggaccacggagatttcctgcaaaccttcgccagcgagcatgtgaaccaagtggacacc3480 gacatcaccacaactctggggccgttctacccttacataggctcggagacgcgagaacgg3540 gcagtcaaggttcgaaaaggagtgaattacgtagttgagccgcttctgaaacccgcagtt3600 cgactactaagagccattaattggttcattcccgaggagtcagatgcgtcccatttgctg3660 agcaatctattagcgtctgttaccgacatcaatcctcaagaccactactcatctaccgaa3720 gtaggggggggcaacgccgtccatcgctacagctgccgactatccgacaaattgagcaga3780 gtcaacaacttatatcagttgcatacttatttatctgtcacaacagagcggttgaccaag3840 tacagtcgaggatcaaaaaacactgacgcacacttccagagcatgatgatttatgcacaa3900 agccgtcatatagacctcatcttggagtctctgcacaccggagagatggtaccgttggag3960 tgtcatcatcacattgagtgcaatcactgtatagaggatatacccgacgagccaatcacg4020 ggggacccggcttggactgaagtcaagtttccttcaagtcctcaggagccctttctttac4080 atcaggcaacaagatctgccggtcaaagacaaactcgagcctgtgcctcgcatgaacatc4140 gtccgtcttgccggattgggtccggaggcgattagtgagctagcgcactactttgttgca4200 ttccgagttatccgggcgtcagagacggatgtcgaccctaacgatgttctctcgtggacc4260 tggctgagccgaattgatcctgacaaattggttgagtatatcgtgcatgtgttcgcttca4320 ctggaatggcatcatgtattaatgtcaggcgtgagtgtgagcgtcagagatgcattcttt4380 aagatgctagtgtctaaaagaatctcagagactccgctaagttcattctattatctggcc4440 aacctgttcgttgaccctcagactcgcgaagcactaatgagctctaaatacgggttcagc4500 ccccccgccgagacagtccccaacgcaaatgccgccgcagccgaaataagaagatgctgt4560 gcgaacagtgcgccgtcgatcttagaatcagcccttcacagccgtgaggttgtttggatg4620 ccaggaacgaacaattatggagacgttgtcatctggtctcattacattagattacggttc4680 agcgaagttaaactagttgacattacacgatatcagcagtggtggagacagtctgagcga4740 gacccctacgatttggtcccggacatgcaggttcttgagagcgacctagatacgctgatg4800 aaacggataccgaggctcatgcgcaaggcgagacgtccccctcttcaggtaattcgagag4860 gacctggatgtcgcagtcatcaatgctgatcatcccgctcactctgtgcttcagaacaaa4920 tacaggaaattgattttcagagagccgaagattatcacgggagctgtgtacaagtacctc4980 tccctaaaatcagagttgacagagttcacctcagcaatggtgatcggagacggaactgga5040 ggtatcaccgccgccatgatggccgatgggatagatgtgtggtatcagacgctcgtcaac5100 tatgaccacgtgacacaacagggattatccgtacaagccccggcagcattggatcttctg5160 cgcggggcaccctctggtaggctcttgaatccgggaagattcgcatcatttgggtctgac5220 ctaactgaccctcgatttacagcctactttgatcaatatcccccgttcaaggtggacact5280 ctatggtctgacgcagagggcgacttttgggacaagccttccaagttgaatcaatacttt5340 gagaacatcattgctttgagacatcggttcgtgaagacaaatggacagcttgtcgtgaag5400 gtgtatctgactcaagacactgctaccacaattgaagcattcagaaagaagctgtcccca5460 tgcgccatcatcgtgtctctcttctcgacggaaggctccacagaatgcttcgtcctaagc5520 aatctcatcgcaccagacacccctgtcgaccttgagatggtggagaatatccctaaacta5580 acatcccttgttccccagaggacgacagtgaaatgctattcccgacgagtagcgtgcatc5640 agtaaaaggtggggacttttcagatctccgagcatagcccttgaagtccaaccgttcctt5700 cactacatcacaaaggtcatctcagacaaaggaacacaactgagtctcatggcggtagct5760 gacacaatgatcaacagttacaagaaggctatctcaccccgagtgttcgatctacaccgg5820 catagggccgcactgggtttcgggaggagatccttgcatctcatctgggggatgatcatc5880 tcaccaatcgcttaccagcattttgagaatccggccaagttgatggatgtcctggacatg5940 ttgaccaataacatctcagctttcttatcgatatcgtcgtcaggatttgacctgtcattt6000 agtgtcagtgcagaccgagatgtccggattgacagcaaacttgtcagactcccgctattc6060 gaaggatcagacctaaaattcatgaaaaccatcatgtctaccctcggatctgtgttcaac6120 caggtcgagccttttaaggggatcgccataaacccttctaaactaatgactgtcaagagg6180 acacaggagttacgttacaacaacctaatttacactaaggatgccatcctattccccaat6240 gaagcggcaaaaaacactgccccgcttcgagccaacatggtataccccgtccggggagat6300 ctattcgcccctaccgatcgcataccaatcatgactctagtcagcgatgagacaacacct6360 cagcactctcctccagaggatgaggca6387 (Proteinsequenceoffulllength,wildtype,humanMAGEA3) SEQIDNO:13 MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVEVTLGEVPAAESPDPPQSPQGASSLP TTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAELVHFLLLKYRAREPVTKAEMLGSWGNWQY FFPVIFSKASSSLQLVFGIELMEVDPIGHLYIFATCLGLSYDGLLGDNQIMPKAGLLIIVLAIIAREGDCAP EEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSDPACYEFLWGPRALVETSYVKVLHH MVKISGGPHISYPPLHEWVLREGEE (Proteinsequenceofavariantoffulllength,wildtype, humanMAGEA3) SEQIDNO:14 MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVEVTLGEVPAAESPDPPQSPQGASSLP TTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAELVHFLLLKYRAREPVTKAEMLGSWGNWQY FFPVIFSKASSSLQLVFGIELMEVDPIGHLYIFATCLGLSYDGLLGDNQIMPKAGLLIIVLAIIAREGDCAP EEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSDPACYEFLWGPRALVETSYVKVLHH MVKISGGPHISYPPLHEWVLREGEEDYKDDDDK* (artificialHPV16E6proteinsequence) EachXcanbepresentorabsent;ifpresent,Xcanbeanynaturally occuringaminoacid.WhenallX'sarecysteines,thesequence correspondstothewildtypeHPV16E6proteinsequence. SEQIDNO:15 MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILEXVYXKQQLLRREVYDFAFRDLCIV YRDGNPYAVXDKXLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRXINXQKPLCPE EKQRHLDKKQRFHNIRGRWTGRXMSXCRSSRTRRETQL (artificialHPV18E6proteinsequence) EachXcanbepresentorabsent;ifpresent,Xcanbeanynaturally occuringaminoacid.WhenallX'sarecysteines,thesequence correspondstothewildtypeHPV18E6proteinsequence. SEQIDNO:16 MARFEDPTRRPYKLPDLCTELNTSLQDIElTXVYXKTVLELTEVFEFAFKDLFVVYRDSI PHAAXHKXIDFYSRIRELRHYSDSVYGDTLEKLTNTGLYNLLIRXLRXQKPLNPAEKLRH LNEKRRFHNIAGHYRGQXHSXCNRARQERLQRRRETQV (artificialHPV16E7proteinsequence) EachXcanbepresentorabsent;ifpresent,Xcanbeanynaturally occuringaminoacid.WhenXXXisCYEandX'satpositions91and94 arecysteine,thesequencecorrespondstothewildtypeHPV16E7 proteinsequence. SEQIDNO:17 MHGDTPTLHEYMLDLQPETTDLYXXXQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCK CDSTLRLCVQSTHVDIRTLEDLLMGTLGIVXPIXSQKP (artificialHPV18E7proteinsequence) EachXcanbepresentorabsent;ifpresent,Xcanbeanynaturally occuringaminoacid.WhenXXXisCHEandX'satpositions98and101 arecysteine,thesequencecorrespondstothewildtypeHPV18E7 proteinsequence. SEQIDNO:18 MHGPKATLQDIVLHLEPQNEIPVDLLXXXQLSDSEEENDEIDGVNHQHLPARRAEPQRHT MLCMCCKCEARIKLVVESSADDLRAFQQLFLNTLSFVXPWXASQQ (codon-optimizedhumanSTEAPprotein) SEQIDNO:19 MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSE LQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPM VSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSL SYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPS VSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPly VLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQLKL (ProteinsequenceofNYESQ1MARprotein) SEQIDNO:20 MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGL NGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQ LQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR* (Isoform1ofhumanBrachyuryprotein;Uniprotdatabaseunder identifierO15178-1) SEQIDNO:21 MSSPGTESAGKSLQYRVDHLLSAVENELQAGSEKGDPTERELRVGLEESE LWLRFKELTNEMIVTKNGRRMFPVLKVNVSGLDPNAMYSFLLDFVAADNH RWKYVNGEWVPGGKPEPQAPSCVYIHPDSPNFGAHWMKAPVSFSKVKLTN KLNGGGQIMLNSLHKYEPRIHIVRVGGPQRMITSHCFPETQFIAVTAYQN EEITALKIKYNPFAKAFLDAKERSDHKEMMEEPGDSQQPGYSQWGWLLPG TSTLCPPANPHPQFGGALSLPSTHSCDRYPTLRSHRSSPYPSPYAHRNNS PTYSDNSPACLSMLQSHDNWSSLGMPAHPSMLPVSHNASPPTSSSQYPSL WSVSNGAVTPGSQAAAVSNGLGAQFFRGSPAHYTPLTHPVSAPSSSGSPL YEGAAAATDIVDSQYDAAAQGRLIASWTPVSPPSM (Isoform1ofhumanprostaticacidphosphatase;Uniprotdatabase underidentifierP15309-1) SEQIDNO:22 MRAAPLLLARAASLSLGFLELLFEWLDRSVLAKELKEVTLVERHGDRSPI DTFPTDPIKESSWPQGFGQLTQLGMEQHYELGEYIRKRYRKFLNESYKHE QVYIRSTDVDRTLMSAMTNLAALFPPEGVSIWNPILLWQPIPVHTVPLSE DQLLYLPFRNCPRFQELESETLKSEEFQKRLHPYKDFIATLGKLSGLHGQ DLFGIWSKVYDPLYCESVHNFTLPSWATEDTMTKLRELSELSLLSLYGIH KQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMYSAHDTTVSGLQMAL DVYNGLLPPYASCHLTELYFEKGEYFVEMYYRNETQHEPYPLMLPGCSPS CPLERFAELVGPVIPQDWSTECMTTNSHQGTEDSTD (tumourassociatedepitope) SEQIDNO:23 EVDPIGHLY (tumourassociatedepitope) SEQIDNO:24 FLWGPRALV (tumourassociatedepitope) SEQIDNO:25 KVAELVHFL (tumourassociatedepitope) SEQIDNO:26 TFPDLESEF (tumourassociatedepitope) SEQIDNO:27 VAELVHFLL (tumourassociatedepitope) SEQIDNO:28 REPVTKAEML (tumourassociatedepitope) SEQIDNO:29 AELVHFLLL (tumourassociatedepitope) SEQIDNO:30 WQYFFPVIF (tumourassociatedepitope) SEQIDNO:31 EGDCAPEEK (tumourassociatedepitope) SEQIDNO:32 KKLLTQHFVQENYLEY (tumourassociatedepitope) SEQIDNO:33 VIFSKASSSLQL (tumourassociatedepitope) SEQIDNO:34 VFGIELMEVDPIGHL (tumourassociatedepitope) SEQIDNO:35 GDNQIMPKAGLLIIV (tumourassociatedepitope) SEQIDNO:36 TSYVKVLHHMVKISG (tumourassociatedepitope) SEQIDNO:37 FLLLKYRAREPVTKAE

EXPERIMENTS

[0113] In the following examples, it should be understood that the tested primes and the tested antigenic proteins provide proof of the concept that Farmington (FMT) virus may be used to generate an immune response in prime:boost combination treatments with different primes and with different classes of antigenic peptides. As demonstrated herein, the FMT virus may provide a boost of an immune response for a variety of types of primes and antigenic peptides.

Experiment 1. FMT Virus Engineered to Express an Antigenic Protein Boosts Antigen-Specific Immune Responses in Three Different Prime Strategies

[0114] To characterize the FMT virus as a boost component in a combination prime: boost therapy, the authors of the present disclosure investigated the capacity of an FMT virus engineered to express mCMV-derived antigen m38 (FMT-m38) to expand m38-specific CD8 T cells in vivo when combined with three different primes:

[0115] 1) Adenovirus (AdV) engineered to express m38 (AdV-m38),

[0116] 2) adoptive cell transfer (ACT) of m38-specific CD8 memory T cells (ACT-m38) and

[0117] 3) m38 peptide with adjuvant (peptide m38).

[0118] In each of these combinations FMT-m38 induced an increase in the frequencies (mean of 8.4%, 38.3% and 55.7% of all CD8 T cells for AdV-m38, ACT-m38 and m38 peptide prime, respectively, compared to 0.2% for PBS control, P<0.0001; See FIG. 1A) and numbers (mean of 8.210.sup.4, 16.810.sup.4 and 125.710.sup.4 cells for AdV-m38, ACT-m38 and m38 peptide prime, respectively, compared to 1 cell for PBS control, P<0.0001; see FIG. 1A) of m38-specific CD8 T cells defined as CD8 T cells expressing IFN upon ex-vivo stimulation with the dominant epitope of m38 antigen.

[0119] The same results were observed for poly-functional CD8 T cells expressing both IFN and TNF upon peptide stimulation, although not all CD8+ IFN+ T cells secreted TNF (FIG. 1B). Additionally, during the same assay but in separate wells the authors of the present disclosure assessed the CD8 immune response against the dominant epitope of the FMT virus. The frequencies of FMT-specific CD8 T cells in the ACT-m38-primed group were significantly higher compared to PBS (mean 1.1% vs 0.02%, P<0.001), but did not exceed 3% of all CD8 T cells, while the groups primed with AdV-m38 and m38 peptide were no different than PBS control (mean 0.06% and 0.13%, respectively, FIG. 8). These levels of FMT-specific CD8 T cells were consistent during all further experiments in nave and tumour-bearing mice receiving FMT-m38 virus. To summarize, the authors of the present disclosure found that FMT virus can successfully be used as a boost in a variety of prime:boost treatment strategies with small or even hardly detectable levels of FMT-specific cellular immune responses.

Experiment 2. FMT Virus-Based Prime:Boost Treatment Induces Potent Immune Responses Against Different Classes of Antigens

[0120] Even though some types of cancers express foreign antigens (for example glioblastomas expressing CMV proteins in CMV-positive patients), in most cases cancer vaccines need to target aberrantly expressed self-antigens or cancer-specific mutations manifested by neo-epitopes presented by MHC I.

[0121] The authors of the present disclosure tested FMT virus for its ability to act as a boost against three different classes of antigens:

[0122] 1) tumour associated self-antigens,

[0123] 2) foreign antigens and

[0124] 3) tumour-derived neo-epitopes.

[0125] A prime:boost treatment directed against DCT, a melanoma-associated self-antigen, with AdV and FMT virus expressing DCT (AdV-DCT and FMT-DCT) as a prime and boost, respectively, resulted in an expansion of DCT-specific CD8 T cells compared to group primed with AdV-DCT and boosted with FMT virus with GFP encoded instead of DCT (FMT-GFP) and PBS control (mean frequency 9.4% of all CD8 T cells vs 0.9% and 0.6% for control groups, P=0.0070, mean number 2.810.sup.4 cells vs 0.110.sup.4 cells and 0.0510.sup.4 cells for control groups, P=0.0076; see FIG. 1C). Immunization against m38, a mCMV-derived (foreign) antigen with ACT-m38 and FMT-m38 as prime and boost, respectively, induced high magnitude increase in m38-specific CD8 T cells frequencies (mean 40.3% vs 0.1%, P=0.0119; see FIG. 1D) and numbers (mean 3.610.sup.5 cells vs 0.00210.sup.5 cells, P=0.0119; see FIG. 1D) compared with group that received only prime.

[0126] Next, the authors of the present disclosure assessed the ability of FMT virus to boost immune response against tumour-derived neo-epitopes. The authors of the present disclosure generated FMT virus expressing Adpgk, Dpagt1 and Reps1 (FMT-MC-38)neo-epitopes derived from MC-38 murine colon carcinoma cell line and used it in combination with peptide-based prime. Importantly, this FMT-MC-38 virus expressed only the peptide fragments that constitute the CD8 T cell epitopes, not the whole antigens as FMT-DCT and FMT-m38. Compared to control group that received only prime, prime combined with FMT-MC-38 boost elevated the frequencies and numbers of CD8 T cells specific for each peptide (FIG. 1E): Adpgk (mean frequency 5.1% vs 0.06%, mean number 3.110.sup.4 cells vs 0.0210.sup.4 cells, P>0.05), Dpagt1 (mean frequency 1.6% vs 0.09%, mean number 110.sup.4 cells vs 0.0410.sup.4 cells, P>0.05) and Reps1 (mean frequency 11.1% vs 0.06%, mean number 6.510.sup.4 cells vs 0.0310.sup.4 cells, P<0.001).

[0127] This demonstrates that FMT virus can be applied for immunization against different classes of antigens. Moreover, it is feasible to use engineered FMT virus for immune stimulation against one or more epitopes of interest without the necessity of expressing the whole antigen(s).

Experiment 3. Immune Response Induced by an FMT Virus Boost can be Sustained Over Prolonged Periods of Time

[0128] The numbers of antigen-specific effector T cells contract within days following antigen stimulation, remaining a small pool of memory T cells that upon re-stimulation with the same antigen expand in numbers and differentiate to perform effector functions. Therefore, the authors of the present disclosure examined whether the immune response induced by a boosting Farmington virus according to the present disclosure can be re-stimulated again following the contraction phase and using the same boost.

[0129] To address this, the authors of the present disclosure immunized mice against m38 antigen using FMT-m38 virus combined with ACT-m38 or m38 peptide prime and waited 120 days before boosting them again with FMT-m38 to minimize the risk of the virus being cleared by neutralizing antibodies before inducing any effect. As observed in the previous experiments, the first boost with FMT-m38 induced high m38-specific immune responses (see FIG. 2A, time point 5 days). The frequencies and numbers contracted within 112 days by over 95% in both ACT-m38- and m38 peptide-primed groups (from 1.710.sup.5 cells to 0.01210.sup.5 cells in ACT-m38-primed mice, P<0.0001 and from 1.25710.sup.6 cells to 0.02710.sup.6 cells in m38 peptide-primed mice, P<0.0001; see FIG. 2A, 2B).

[0130] Each treatment group was then divided into mice receiving FMT-m38 for the second time and mice receiving PBS instead. Second boost with FMT-m38, but not PBS, resulted in an expansion of frequencies and numbers of m38-specific CD8 T cells compared to the residual pool before the second boost (in m38 primed mice: 1.910.sup.5 vs 0.210.sup.5 cells, P=0.0079 for FMT-m38 2nd boost and 7.410.sup.4 vs 3.610.sup.4 cells, P=0.49 for PBS 2nd boost control; in ACT-m38 primed mice 1.810.sup.4 vs 0.110.sup.4 cells, P=0.056 for FMT-m38 2nd boost and 1238 vs 1066 cells, P=0.60 for PBS 2nd boost control, FIG. 2C).

[0131] Surprisingly, even though the m38-specific CD8 T cell response underwent slow contraction (as evident by numbers of CD8+ IFN+ cells (FIG. 2A)), the difference between early and late time point post 2nd boost (5 vs 152 days) was not statistically significant and both the frequencies and amounts of m38-specific CD8 T cells in the m38 peptide primed mice were still significantly higher than in the PBS control, even in the group that received only one boost (FIG. 2A, D) and higher compared to before 2nd boost for mice primed with m38-peptide and boosted twice with FMT-m38 (FIG. 2E).

[0132] To further confirm the observations described above, the authors of the present disclosure immunostimulated mice against three MC-38-derived neo-epitopes: Adpgk, Dpagt1 and Reps1. Mice were primed with either all 3 long mutant peptides or with each peptide separately and all were boosted with FMT-MC-38 virus. For control, mice were primed with all 3 peptides and boosted with PBS (prime only control). Each immunostimulation expanded the frequencies and numbers of CD8 T cells specific to each epitope compared to prime only group (FIG. 2F, 2G, time point 5 days). The authors of the present disclosure first attempted to reduce the time interval between boosts and thus applied second FMT-MC-38 boost 35 days after the first boost while the immune response was still undergoing contraction (FIG. 2F, 2G). However, no expansion of antigen-specific CD8 T cells was detected (FIG. 2F, 2G). Therefore, the authors of the present disclosure repeated the boost 124 days later to resemble the time interval applied previously in anti-m38 immunostimulation experiment. The third boost with FMT-MC-38 resulted in the increased frequencies and numbers of CD8 T cells specific to each epitope in each treatment group, except Dpagt1 prime group, compared to measurement taken a week before 3rd boost, however, the difference was statistically significant only in Reps1 prime group (P=0.0159) and 3 peptides prime group for Dpagt1-specific CD8 T cells (P=0.0079) (mean cell numbers after vs before boost in mice primed with single peptides: 1.610.sup.4 vs 0.710.sup.4, 414 vs 500, and 2.010.sup.4 vs 0.610.sup.4 of Adpgk-, Dpagt1- and Reps1-specific CD8 T cells, respectively; and in mice primes with all 3 peptides: 4621 vs 1524, 7268 vs 374, and 7126 vs 1785 of Adpgk-, Dpagt1- and Reps1-specific CD8 T cells, respectively (FIG. 2H)). As in previous experiment, the immune response was sustained over long period of time as illustrated by antigen-specific CD8 T cell numbers at 190 days post 3rd boost compared to prime only control (FIG. 2I), however, at this time point as well as 98 days post 3rd boost it was at the same level as before 3rd boost.

[0133] The authors of the present disclosure thus conclude that FMT-based boost has the ability to induce long-lasting antigen-specific immune responses. It is also feasible to re-stimulate the CD8 T cells in a homologous setting provided long time interval (min. 120 days in mice) is applied between the boosts. Importantly, this can be achieved for both foreign antigen and neo-epitopes, and when boosted against whole antigen or one or more epitopes.

Experiment 4. Treatment with an Exemplary Prime:Boost Therapy According to the Present Disclosure Improves Animals' Survival

[0134] In order to determine the anti-tumour efficacy of FMT-based prime:boost treatment in vivo, the authors of the present disclosure treated tumour-bearing immunocompetent mice with a prime:boost therapy. First the authors focused on targeting CMV antigen in glioma mouse model, as the safety profile of FMT virus makes it a particularly promising tool for targeting brain tumours. For this purpose, the authors engineered murine glioma CT2A cells to express m38 antigen and generated a stable CT2A-m38 cell line. Tumour cells extracted from mice 21 days after intracranial implantation of CT2A-m38 cells expressed major histocompatibility complex class I (MHC I) allele that presents the m38 epitope (FIG. 9B).

[0135] Interestingly, the authors observed that these tumour cells were more aggressive in vivo than the wild type CT2A cells as illustrated by MRI imaging (FIG. 9A). The prime:boost treatment with AdV-m38 and FMT-m38 (administered first intravenously and 2 days later intracranially) significantly increased the frequencies (5.2% vs 2.35% and 0.01%, P<0.0001 for prime:boost, prime only, and PBS respectively (FIG. 3A)) and numbers (4.210.sup.4 cells vs 0.610.sup.4 cells and 0.0410.sup.4 cells, P<0.0001 for prime:boost, prime only, and PBS respectively) of m38-specific CD8 T cells, and extended survival (40 days vs 25 and 24 days, P<0.0001, 6/30 (20%) mice were cured in the treatment group) of mice orthotopically implanted with CT2A-m38 cells compared to prime only and PBS controls.

[0136] In the next experiment the authors replaced AdV-m38 with ACT-m38 and reduced the number of CT2A-m38 cells from 110.sup.4 to 310.sup.3 cells. Despite greater immunostimulatory efficiency (frequency of m38-specific T cells: 25.3% vs 0.41% and 0.078% for prime only and PBS control, respectively, P=0.0003, number of m38-specific T cells: 1.310.sup.5 cells vs 820 and 28 cells for prime only and PBS control, respectively, P=0.0003 (FIG. 3B)), similar anti-tumour efficacy was achieved (median survival: 47 days vs 25 and 22 days for prime only and PBS control, respectively, P=0.0008, 1/10 (10%) mice was cured in the treatment group (FIG. 3B)).

[0137] Additionally, the authors tested the efficacy of the combination of m38 peptide prime with FMT-m38 (administered only intravenously) in mice implanted with 310.sup.3 CT2A-m38 cells. This treatment regimen resulted in high increase in frequencies (43.0% vs 0.09%, P=0.0079) and numbers (8.110.sup.5 vs 258 cells, P=0.0079) of m38-specific CD8 T cells and modest survival benefit (32 vs 21 days, P=0.0027) compared to PBS control (FIG. 3C). This suggests that direct injection of FMT virus into the tumour may contribute to anti-tumour efficacy by a mechanism different than inducing high numbers of tumour-specific cytotoxic T cells, however, the impact of chosen prime method on survival cannot be excluded.

[0138] Furthermore, the authors of the present disclosure investigated the efficiency of FMT-MC-38 virus in MC-38 subcutaneous mouse tumour model. Tumour-bearing mice were primed with Adpgk and Reps1 long mutant peptides with adjuvant, with adjuvant only or with PBS and boosted with FMT-MC-38 or PBS. Treatment with FMT-MC-38 virus only (with PBS instead of prime) resulted in the highest expansion of Adpgk-specific CD8 T cells (42.9% vs 17.1%, 15.6%, 0.11% and 0.13% in adjuvant+boost, prime+boost, prime only and PBS groups, respectively, P<0.01), and delayed tumour progression (FIG. 3D). FMT-MC-38 was able to boost Adpgk-specific response without prime. On the other hand, a boost of Reps1-specific T cells was only observed when Reps1 peptide prime was used, yet it had no impact on tumour progression and animals' survival (FIG. 3D), suggesting that Reps1 may not be the tumour-rejection antigen.

[0139] To summarize, the authors demonstrated in two different in vivo models that a FMT virus-based boost according to the present disclosure generates an immune response against a tumour specific antigen in tumour-bearing mice and extends their survival.

Experiment 5. TSA-Specific CD8 T Cells Greatly Enhance Efficacy of a FMT Virus-Based Anti-Tumour Treatment

[0140] The authors of the present disclosure hypothesized that expansion of tumour specific antigen (TSA)-specific effector T cells contributed greatly to the anti-tumour efficacy of a prime:boost therapy according to the present disclosure. To test this hypothesis, the authors designed an experiment where CT2A-m38 tumour-bearing mice (i) received a prime:boost treatment against m38, or against chicken ovalbumin (OVA)an irrelevant antigenor (ii) were adoptively transferred with m38-specific memory T cells, but boosted with FMT virus expressing GFP (FMT-GFP) instead of m38.

[0141] As in previous experiments, a prime:boost treatment using m38 as the shared antigenic peptide induced high frequencies and numbers of m38-specific CD8 T cells and significantly extended animals' survival (FIG. 4A). In contrast, a prime:boost treatment using OVA as the shared antigenic peptide did not provide any survival benefit despite expanding OVA-specific CD8 T cells to high amounts (FIG. 4A), confirming that TSA-specific T cells, but not other T cells, can mediate anti-tumour efficacy. Mice adoptively transferred with m38-specific memory T cells did not benefit from FMT-GFP treatment, as virus without relevant antigen was not able to trigger T cells' differentiation from memory into effector cells (FIG. 4A). These results show that tumour cells killing by TSA-specific effector T cells is a major mechanism contributing to the efficacy of a prime:boost therapy according to the present disclosure.

Experiment 6. Increasing the Numbers of TSA-Specific CD8 T Cells Improves Therapeutic Efficacy

[0142] The authors of the present disclosure aimed to determine whether the T cell-dependency of a prime:boost therapy according to the present disclosure is dose-dependent. For this purpose, the authors primed CT2A-m38 tumour-bearing mice with different doses of ACT-m38 ranging from 10.sup.3 to 10.sup.6 cells and boosted with FMT-m38 virus. All treatments expanded the frequencies and numbers of m38-specific CD8 T cells in a dose-dependent manner (FIG. 4B). ACT-m38 at the lowest dose of 10.sup.3 cells resulted in minimal survival benefit compared to PBS control (28 vs 21 days, P=0.0035; FIG. 4B). Increasing the amount of m38-specific CD8 T cells with higher prime doses further extended the animals' survival compared to PBS control and lowest prime dose group (median survival: 44 days, (20%) mouse cured, 47 days, (40%) mice cured and 45 days at 10.sup.4, 10.sup.5 and 10.sup.6 cells dose groups, respectively, P=0.0035 and P=0.0016 when compared to PBS and 10.sup.3 cells dose group, respectively; FIG. 4B). Thus, the numbers of antigen-specific effector T cells directly correlated with anti-tumour efficacy. However, these data also suggest that a saturating treatment dose may have been reached in mice, as no more cures were observed at the prime dose of 10.sup.6 cells.

Experiment 7. Anti-Tumour Efficacy Against Glioma can be Achieved with Intravenous FMT Virus Administration

[0143] Additionally, the authors of the present disclosure investigated different routes of administration of FMT virus and their effects on anti-tumour efficacy. The authors hypothesized that the intravenous injection would be superior for expanding TSA-specific effector T cells in peripheral blood, especially over the intracranial injection as brain is considered an immune-privileged organ. However, virus injected into the tumour could contribute directly to tumour eradication by oncolytic virus-mediated tumour cell lysis or indirectly by inducing local inflammation, modifying tumour microenvironment and increasing recruitment of cytotoxic T cells into the tumour.

[0144] The authors first examined the distribution of FMT virus in the brain and spleen in nave mice injected intravenously (iv) or intracranially (ic). As expected, more virus was found in the brain following ic injection (mean 1.410.sup.7 pfu that is 40% more than injected dose) compared with iv group (mean 110.sup.4 pfu that is 0.003% of the injected dose) and spleens of iv injected mice contained more virus (mean 1.510.sup.7 pfu that is 5% of the injected dose) than mice receiving virus by ic route (mean 4.9510.sup.4 pfu that is 0.5% of the injected dose) (FIG. 4C).

[0145] Next, the authors studied the impact of different routes of FMT-m38 administration: 1) ic, 2) iv and 3) iv followed by ic (iv+ic) on the survival of CT2A-m38 tumour-bearing mice primed with ACT-m38. Each treatment induced expansion of m38-specific CD8 T cells (frequencies 3.7%, 30.0% and 34.1% in ic, iv and iv+ic groups, respectively, vs 0.02% in PBS control, P>0.05, P<0.01 and P<0.01, respectively (FIG. 4C)) and extended animals' survival (median survival 34, 83 and 49 days in ic, iv and iv+ic groups, respectively, vs 22 days in PBS control, P=0.0021, P=0.0019 and P=0.0019, respectively (FIG. 4C)). Noteworthy, iv and iv+ic boosting regimens were superior to ic injection (P=0.0073 and P=0.0015, respectively) and resulted in 20% cure rate ( mice). No significant difference was observed between iv and iv+ic groups. Summarizing, an FMT-based boost according to the present disclosure administered intravenously induces antigen-specific response of higher magnitude and results in prolonged survival compared to intracranial injection, mainly due to higher amounts of infectious viral particles migrating to the spleen resulting in enhanced TSA presentation to memory T cells. However, these data do not rule out the possible benefit of injecting FMT-m38 virus directly into the tumour in addition to intravenous prime:boost treatment.

Experiment 8. Pre-Existing Immunity Against a TSA Extends Survival of Mice Challenged with Tumour, but is not Sufficient for Complete Tumour Rejection

[0146] In order to assess whether a pre-existing pool of TSA-specific CD8 effector T cells would prevent the tumour progression following tumour cell implantation, the authors of the present disclosure injected CT2A-m38 intracranially in the mice previously treated with the prime:boost therapy in the experiment, discussed above, entitled Immune response induced by an FMT virus boost can be sustained over prolonged periods of time at 281/161 days post 1st/2nd boost (presented in FIG. 2A-2E).

[0147] The amount of m38-specific CD8 T cells was similar before and after tumour challenge, however, varied between groups with different treatment regime (FIG. 5A-5D). All prime:boost treated mice survived significantly longer than PBS control group (median survival: 32, 34.5, 35, 35 days for mice receiving m38 peptide prime with two FMT-m38 boosts, m38 peptide prime with one FMT-m38 boost, ACT-m38 prime with two FMT-m38 boosts, ACT-m38 prime with one FMT-m38 boost, respectively, vs 21 days for PBS control group, P<0.05 (FIG. 5E)). However, all mice eventually succumbed to tumour regardless of the amount of pre-existing m38-specific CD8 T cells and the median survival of prime:boost treated mice was very similar to the outcomes of mice treated with FMT-m38 in most of the therapeutic experiments the authors have conducted. These results suggest either an inefficient recruitment of effector T cells to the tumour, their reduced functionality (exhaustion), or inefficiency without adjuvant therapy.

Experiment 9. Intracranial Injection of FMT-m38 Virus Promotes Anti-Tumour Immune Response within the Brain Tumour Microenvironment

[0148] To examine the impact of an exemplary boost according to the present disclosure on the tumour microenvironment, the authors harvested the tumour tissue from mice bearing CT2A-m38 tumours primed with m38 peptide and boosted with FMT-m38 virus intracranially or intravenously.

[0149] Blood sample was collected 6 days after boost, just before the tumour tissue harvest, in order to confirm the expansion of peripheral m38-specific CD8 T cells (FIG. 10). Compared to control PBS group, the ic injection of FMT-m38 virus increased the recruitment of lymphocytes, including T cells, into the tumour, while the amounts of macrophages and microglia remained unchanged (FIG. 6A). Unexpectedly, the authors detected decreased T cell infiltration in the iv injection group (FIG. 6A). Interestingly, the authors observed reduced expression of CD11 b in the macrophage population (illustrated as CD11b.sup.low macrophage population in FIG. 6A) in the iv injection group compared to both ic injection group and PBS control. Both treatment regimens diminished the numbers of macrophages expressing CD206one of the markers of M2-polarization, while the expression level of CD86 co-stimulatory molecule remained the same as in the control group (FIG. 6B). Among tumour-infiltrating lymphocytes (TILs), the authors observed increased amounts of both CD4 and CD8 T cells (defined as CD8.sub.low in FIG. 6C) in the ic injection group compared to control and iv injection groups (FIG. 6C). In each group, including control, over 90% of CD8 T cells expressed CD137a marker of activation induced by TCR stimulation.

[0150] Additionally, in a separate experiment, the authors compared the cytokine and chemokine profiles of tumour microenvironment following wild-type FMT virus ic or iv injection. Tumours harvested from mice injected with FMT virus by ic route had increased concentration of IL-7 cytokine (P<0.05) important for maintenance of memory T cell pools and pro-inflammatory cytokines IL-6 and TNF (not statistically significant) compared to tumours from iv injected mice (FIG. 6D). On the other hand, the authors also observed higher level of IL-13 cytokine that inhibits Th1-type T cell responses in both ic and iv (P<0.05) injection groups compared to PBS controls (FIG. 6D). Compared to PBS controls, both injection groups also manifested with elevated expression of granulocyte-colony stimulating factor (G-CSF) supporting the proliferation and differentiation of neutrophils (FIG. 6D). Moreover, ic injection of FMT virus induces granulocyte-attracting chemokine environment (FIG. 6E) as illustrated by increased concentration of Eotaxin (P<0.05 compared to PBS control), CXCL5 (P<0.01 compared to iv group), CXCL1 (P<0.05 compared to PBS control) and MIP-2 (P<0.01 compared to PBS control). Interestingly, iv virus injection resulted in decreased level of MIGa molecule attracting Th1 cells and of RANTESa chemokine recruiting whole spectrum of immune cells: NK cells, T cells, DCs, basophils, eosinophils and monocytes (FIG. 6E).

[0151] Taken together, these results emphasize that injecting an FMT-based boost directly into the tumour in addition to intravenous immunization induces changes within the tumour microenvironment favourable for anti-tumour immune response as demonstrated by increased infiltration of activated CD8 T cells, reduced numbers of CD206+ macrophages and pro-inflammatory cytokine secretion.

[0152] Animal Studies

[0153] All C57Bl/6 and C57Bl/6-Ly5.1 mice were purchased from Charles River Laboratories.

[0154] Generating Cellular Product for Adoptive Cell Transfer (ACT)

[0155] Male transgenic C57BL/6N-Tg(Tcra, Tcrb)329Biat (Maxi-m38) micekindly provided by Dr Annette Oxenius (ETH Zurich, Switzerland) were paired with C57Bl/6-Ly5.1 female mice to establish a colony. Female OT-1 mice were purchased from Jackson Laboratories.

[0156] To generate cellular product for adoptive cell transfer (ACT), spleens from female Maxi-m38 or OT-1 mice were extracted and spleenocytes were isolated and cultured in RPMI medium supplemented with 10% FBS, non-essential amino acids, 55 mM 2-mercaptoethanol, HEPES buffer (Stem Cell), Penicillin-Streptomycin and central memory T cell (Tcm) enrichment cocktail kindly provided by Dr Yonghong Wan (McMaster University, Hamilton, Canada) for 6-7 days.

[0157] Peptides: m38 or chicken ovalbumin (OVA) immunodominant epitope were added only at the start of culture at 1 g/ml. The cells were passaged once or twice depending on the density. For ACT cells were harvested by pipetting, washed 2 with DPBS counted using hematocytometer with Trypan blue staining and re-suspended in DPBS. Part of the cellular product was put aside for phenotyping by flow cytometry the same day or the day after ACT. The memory phenotype was confirmed by staining with fluorochrome-conjugated antibodies: CD8-PE, CD127-PE-Cy7, CD27-PerCP-Cy5.5, KLRG1-BrilliantViolet605, CD62L-AlexaFluor700 and CCR7(CD197)-BrilliantViolet786. Fixable eFluor450 viability dye (eBioscience) was used to exclude dead cells. Over 95% of cells were CD8+ T cells and the frequency of Tcm cells defined as CD127+CD62L+ cells ranged from 40 to 60% (FIG. 7).

[0158] Vaccination Studies in Nave Mice

[0159] 7-10 weeks old female C57Bl/6 mice were primed at day 0 with:

[0160] 1) 110.sup.8 plaque forming units (pfu) of adenovirus (AdV) expressing DCT (AdV-DCT) or m38 (AdV-m38) by bilateral intramuscular injection,

[0161] 2) adoptive cell transfer (ACT) of m38- or OVA-specific CD8 memory T cells (ACT-m38 or ACT-OVA) at the dose of 110.sup.5 cells intravenously (iv) or 3) intraperitoneally (ip) with 50 g of one or more peptides (Biomer Technology,) with adjuvant: 30-50 g of anti CD40 antibody (BioXCell) and 10-100 g of poly I:C.

[0162] Mice were boosted intravenously 9-14 days later with 310.sup.8 pfu FMT virus expressing m38 (FMT-m38), DCT (FMT-DCT), GFP (FMT-GFP) or MC-38-derived neo-epitopes Adpgk, Dpagk1 and Reps1 (FMT-MC-38). The blood was collected 5-7 days after boost and in some cases at later time points for quantification of antigen-specific T cells by ex vivo peptide stimulation and intracellular cytokine staining (ICS) assay. In one experiment mice were given 310.sup.8 pfu FMT-m38 virus for the 2nd time 120 days following the 1st boost. In another one, mice received 310.sup.8 pfu FMT-MC-38 virus for the 2nd time 35 days after 1st boost and for the 3rd time 124 days post 2nd boost.

[0163] Efficacy Experiments in Brain Tumour-Bearing Mice

[0164] For brain tumour efficacy studies, 7-10 weeks old female C57Bl/6 mice were injected intracranially (ic) at day 0 with CT2A-m38 cells and re-suspended in serum-free DMEM medium at a position 2.5 mm to the right and 0.5 mm anterior to bregma, 3.5 mm deep, using Hamilton syringe and infusion pump attached to stereotaxic frame. In the experiments presented in FIG. 3A and discussed with regard to Experiment 4, above, the authors of the present disclosure injected 110.sup.4 cells, in all other experiments, they injected 310.sup.3 cells. Mice were primed at day 3 with 110.sup.9 pfu of AdV-m38 or with 50 g m38 peptide with adjuvant: 30 g of anti CD40 antibody (BioXCell) and 10 g of poly I:C. Alternatively, mice were primed at day 11 with ACT-OVA at 110.sup.6 cells or ACT-m38 at doses: 110.sup.6 cells in the experiment presented in FIG. 4A (Experiment 5, discussed above), or 110.sup.5 cells in other experiments except the dose response study (FIG. 4B; Experiment 6). FMT-m38, FMT-OVA or FMT-GFP were administered either ic at day 12 at a dose of 110.sup.7 pfu at the same position but 2.5 mm deep or iv at day 14 at a dose of 310.sup.8 pfu, or both.

[0165] Blood was collected 5 days after ic boost or 7 days after iv boost (day 19 post tumour implantation) for quantification of antigen-specific CD8 T cells. Mice were monitored daily for the onset of symptoms like piloerection, facial grimace, hunched back, respiratory distress or neurological symptoms (head tilt, circling, seizure) and euthanized when reached endpoint. Visible head tumours frequently occurred, however, there was always also intracranial tumour as well evident upon dissection post mortem. Whenever the cause of endpoint was in doubt, mice were dissected post mortem to confirm the presence of intracranial tumour. No virus-related acute toxicities were observed after either iv or ic FMT-m38 injection. Mice would frequently lose weight after immunization with FMT virus, however, never more than 15% and they would regain the baseline body mass within a week.

[0166] Efficacy Experiments in MC-38 Tumour-Bearing Mice

[0167] 8 weeks old female C571316 mice were injected subcutaneously at day 0 with 110.sup.5 MC-38 cells re-suspended in serum-free DMEM medium. Next day (day 1) mice were primed with 50 g of Adpgk and Reps1 long mutant peptides with adjuvant: 30 g of anti CD40 antibody (BioXCell) and 10 g of poly I:C, with adjuvant alone or with PBS. On day 9 tumour were measured and only mice with tumour size 80-130 mm.sup.3 were included in the study. On day 10 mice were injected with 310.sup.8 pfu FMT-MC-38 virus (one peptide-primed group, adjuvant-primed group and one PBS-primed group) or PBS (one peptide primed group and one PBS primed group). Tumours were measured next day and twice a week until mice reached endpoint: tumour size above 1000 mm.sup.3 or bleeding ulcers. Tumour volume was calculated with formula: (lengthwidthdepth)/2. No virus-related acute toxicities were observed following FMT-MC-38 injection.

[0168] PBMC Isolation, Stimulation, and Intracellular Cytokine Staining (ICS) Assay

[0169] Blood was collected from mice into heparinized blood collection tubes by puncturing the saphenous vein. The blood volume was measured and blood was transferred into 15 ml conical tubes for erythrocyte lysis with ACK lysis buffer. The PBMCs were re-suspended in RPMI medium supplemented with 10% FBS, non-essential amino acids, 55 mM 2-mercaptoethanol, HEPES buffer (Stem Cell) and Penicillin-Streptomycin and transferred to 96 well round-bottom plates. Each sample was split into either 3 wells (antigen stimulation, FMT-derived epitope stimulation and no-stimulation control) or 4 wells in experiments with MC-38 derived epitopes (1 for each epitope separately and unstimulated control). For unstimulated control, 0.1-0.4% DMSO (Sigma) in RPMI was added as the peptides stock solutions were made in DMSO. Blood samples from nave mice were used for extra controls of peptide stimulation, for staining-negative controls and for PMA and lonomycin stimulated (at 100 ng/ml and 1 g/ml, respectively) positive controls. The peptides were added at a concentrations 0.5 g/ml, 1 g/ml, 1 g/ml or 5 g/ml for OVA, m38, FMT or MC-38 peptides, respectively. Following 1 h incubation at 37 C., 5% CO.sub.2, GolgiPlug (BD Biosciences) was added to each well at 0.2 l per well and incubated for 4 h more. Cells were then washed, transferred to 96 well v-bottom plates (EverGreen) and stored overnight at 4 C. Next day ICS assay was performed. Briefly, cells were washed with FACS buffer (0.5% BSA in PBS), stained with CD8-PE, TCR-BrilliantViolet711 and CD45.1-PerCP-Cy5.5 antibodies and Fixable eFluor450 viability dye (eBioscience), washed with FACS buffer, fixed and permeabilized with Fixation and permeabilization kit (BD Bioscienses), stained with IFN-AlexaFluor647, TNF-PE-Cy7 and IL-2-BrilliantViolet605 antibodies and re-suspended in FACS buffer. Data were acquired on BD LSR Fortessa X20 flow cytometer with HTS unit (BD Biosciences) and data were analysed using FlowJo (TriStar) software. The debris and doublets were excluded by gating on FSC vs SSC and FSC-A vs FSC-H, respectively. Viable cells were gated based on viability dye stain. Next, CD8-positive and TCR-positive cells were gated and within this population the expression of IFN, TNF and IL-2 was examined. Cell numbers were calculated with the following formula:

[00001]$N\left[\mathrm{cell}.Math..Math.\mathrm{number}.Math.\text{/}.Math.\mathrm{ml}\right]=\frac{\mathrm{Ns}-\mathrm{Nu}}{\left(\frac{\mathrm{Vm}}{W}\right)*\mathrm{Vf}}*1000$

[0170] where Nresulting positive cell number per 1 ml of blood, Nsnumber of positive cells in the well containing peptide, Nunumber of positive cells in unstimulated control, Vmtotal blood volume collected from animal, Wnumber of wells the blood sample was distributed into, Vffraction of sample volume used for data acquisition by flow cytometry i.e. 80 l out of 130 l.

[0171] Characterization of Tumour Microenvironment

[0172] Phenotyping of Tumour-Infiltrating Immune Cells

[0173] 7 weeks old female C57Bl/6 mice were injected intracranially (ic) at day 0 with 310.sup.3 CT2A-m38 cells and re-suspended in serum-free DMEM medium at a position 2.5 mm to the right and 0.5 mm anterior to bregma, 3.5 mm deep, using Hamilton syringe and infusion pump attached to stereotaxic frame. At day 3, mice were primed with 50 g m38 peptide with adjuvant: 30 g of anti CD40 antibody (BioXCell) and 10 g of poly I:C or with PBS. 9 days later mice were boosted with either 110.sup.7 pfu FMT-m38 injected ic at the same position but 2.5 mm deep, with 310.sup.8 pfu FMT-m38 iv, or with PBS ic. 6 days after boost blood was collected to confirm the presence of m38-specific CD8 T cells in peripheral blood and afterwards mice were euthanized and tumour tissue was collected. The tumour tissue was dissociated with Neural Tissue Dissociation kit (Miltenyi Biotech) and the cells purified with Percoll gradient method. Cells were then kept overnight at 4 C. The next day, cells were washed with FACS buffer and stained with fluorochrome-conjugated antibodies: CD11b-BrilliantViolet421, CD4-BrilliantViolet510, CD86-BrilliantViolet605, CD3-BrilliantViolet650, F4/80-BrilliantViolet711, CD137-BrilliantViolet785, CD8-AlexaFluor488, CD45-PerCP-Cy5.5, NKp46-PE, CD206-PE-Cy7 and with m38-tetramer-APC. Fixable near-IR viability dye (eBioscience) was used to exclude dead cells. Data were acquired using BS LSR Fortessa X20 flow cytometer (BD Biosciences) and analysed with FlowJo (TriStar) software.

[0174] Statistics

[0175] Kaplan-Meier survival curves were generated in GraphPad version 5.0f (Prism) software and compared using Log-rank (Mantel-Cox) test. P value below 0.05 was considered significant. Frequencies and numbers of immune cells, cytokine and chemokine concentrations were compared across treatment groups in GraphPad version 5.0f (Prism) software using statistical test indicated in the figure legend. P value below 0.05 was considered significant.

[0176] In the preceding description, for purposes of explanation, numerous details are set forth in order to provide a thorough understanding of the examples. However, it will be apparent to one skilled in the art that these specific details are not required. Accordingly, what has been described is merely illustrative of the application of the described examples and numerous modifications and variations are possible in light of the above teachings.

[0177] Since the above description provides examples, it will be appreciated that modifications and variations can be effected to the particular examples by those of skill in the art. Accordingly, the scope of the claims should not be limited by the particular examples set forth herein, but should be construed in a manner consistent with the specification as a whole.