Construction and application of engineering bacteria capable of secreting and expressing diacetylchitobiose deacetylase

Abstract

The disclosure herein relates to construction and application of engineering bacteria capable of secreting and expressing diacetylchitobiose deacetylase, and belongs to the technical field of fermentation engineering. Firstly, recombinant B. subtilis capable of heterologously secreting and expressing a diacetylchitobiose deacetylase gene is constructed, and a signal peptide fragment yncM is added into the recombinant vector for the first time. The signal peptide can secrete the target protein diacetylchitobiose deacetylase outside the cells of the recombinant B. subtilis, and a mutant of the 5-end untranslated region is acquired, thereby significantly increasing the expression level of the target protein, and greatly simplifying the subsequent enzyme separation and purification steps. When the acquired diacetylchitobiose deacetylase is fermented and cultured in a fermentation medium for 50-60 h, the enzyme activity reaches a maximum of 1,548.7 U/mL, and the maximum yield of the diacetylchitobiose deacetylase is about 620 mg/L. Simultaneously, the method has the advantages of low production cost, mild production conditions, simple purification process steps, safe production operation and the like.

Claims

1. A genetically engineered bacterium, comprising an expression vector encoding a diacetylchitobiose deacetylase gene fused downstream to a yncM signal peptide, wherein the diacetylchitobiose deacetylase gene harbors a DNA fragment comprising SEQ ID NO:3 in a 5-untranslated region of the diacetylchitobiose deacetylase gene.

2. The bacterium according to claim 1, wherein the diacetylchitobiose deacetylase GenBank accession number is PH0499.

3. The bacterium according to claim 1, wherein an amino acid sequence of the yncM signal peptide is SEQ ID NO:5.

4. The bacterium according to claim 3, wherein a nucleotide sequence that encodes the yncM signal peptide is SEQ ID NO:1.

5. The bacterium according to claim 1, wherein the expression vector is p43NMK.

6. The bacterium according to claim 1, wherein the bacterium is B. subtilis.

7. The bacterium according to claim 6, wherein the B. subtilis is strain WB600.

8. A method of producing diacetylchitobiose deacetylase, comprising: inserting into a host bacterium an expression vector encoding a diacetylchitobiose deacetylase gene fused downstream to a yncM signal peptide, wherein the diacetylchitobiose deacetylase gene harbors a DNA fragment comprising SEQ ID NO:3 in a 5-untranslated region of the diacetylchitobiose deacetylase gene, inoculating a fermentation culture with the bacterium, incubating the culture under conditions that favor expression of the diacetylchitobiose deacetylase, and obtaining diacetylchitobiose deacetylase from the culture.

9. The method according to claim 8, wherein inoculating the bacterium into the fermentation culture comprises inoculating a concentration of 2-5% of the bacterium into the culture, and wherein incubating is performed under conditions of 35 to 37 C. and shaking at 200 to 220 rpm for 14 to 96 hours.

10. The method according to claim 8, wherein wherein incubating is performed under conditions of 35 to 37 C. and shaking at 200 to 220 rpm for 10 to 15 hours.

11. The method according to claim 8, wherein the fermentation culture per liter comprises: 12 grams of peptone, 24 grams of yeast powder, 10 grams NaCl, 4 mL glycerol, 2.31 grams KH.sub.2PO.sub.4 and 12.54 grams K.sub.2HPO.sub.4.

12. The method according to claim 8, wherein the fermentation culture per liter comprises: 10 grams peptone, 5 grams yeast powder, and 10 grams NaCl.

13. A method of preparing glucosamine, comprising: providing a genetically engineered bacterium comprising an expression vector encoding a diacetylchitobiose deacetylase gene downstream of a yncM signal peptide, and harboring a DNA fragment comprising SEQ ID NO:3 in a 5-untranslated region of the diacetylchitobiose deacetylase gene, inoculating a fermentation culture with the bacterium, and incubating the culture under conditions sufficient to express diacetylchitobiose deacetylase, thereby producing diacetylchitobiose deacetylase, and incubating the diacetylchitobiose deacetylase with acetylglucosamine to produce glucosamine.

14. The method according to claim 13, which further comprises adding the glucosamine to a composition comprising a drug.

15. The method according to claim 13, which further comprises adding the glucosamine to a dietary supplement.

Description

BRIEF DESCRIPTION OF FIGURES

(1) FIG. 1 is a recombinant plasmid construction diagram.

(2) FIG. 2 is a comparison diagram of the sequence of a 5-untranslated region before and after mutation; a is the sequence of the 5-untranslated region of a plasmid pP43NMK-yncM-Dac before mutation (SEQ ID NO:17); b is the sequence of the 5-untranslated region of the mutant plasmid pP43mut-yncM-Dac acquired after sequence insertion (SEQ ID NO:18); Insertion sequence (73 bp) corresponds to SEQ ID NO:3.

(3) FIG. 3 is an enzyme activity curve and a thallus growth curve of diacetylchitobiose deacetylase at different fermentation stages.

(4) FIG. 4 is a bar diagram of the activity of diacetylchitobiose deacetylase containing different signal peptides, wherein 1 is free of Dac gene; 2 contains Dac gene but is free of signal peptide; 3 contains Dac gene and yncM signal peptide; 4 contains Dac gene and bpr signal peptide; 5 contains Dac gene and ywbN signal peptide; 6 contains Dac gene and ansZ signal peptide; 7 contains Dac gene and yvgO signal peptide; 8 contains Dac gene and amyE signal peptide; 9 contains Dac gene and oppA signal peptide; 10 contains Dac gene and vpr signal peptide; 11 contains Dac gene and lipA signal peptide; 12 contains Dac gene and wapA signal peptide; 13 contains Dac gene and Epr signal peptide; 14 contains Dac gene and yclQ signal peptide.

(5) FIG. 5 is a comparison diagram of extracellular enzyme before and after mutation of a 5-untranslated region, wherein FIG. 5A is the difference of extracellular enzyme activity before and after mutation of the 5-untranslated region; FIG. 5B is a protein gel diagram of extracellular enzyme content in fermentation supernatant before and after mutation of the 5-untranslated region; M is molecular weight protein standard; 1 is pP43NMK-yncM-Dac; 2 is pP43mut-yncM-Dac.

DETAILED DESCRIPTION

(6) (1) Bacterial Strains and Vectors

(7) The plasmid is replicated by using Escherichia coli JM109 as a host strain, and the expression of deacetylase and fermentation of the strain are carried out by B. subtilis WB600. The plasmid pP43NMK is a commercial plasmid.

(8) (2) Reagents, Enzymes and Related Kits

(9) Antibiotics (kanamycin sulfate and ampicillin) are purchased from Sangon Biotech (Shanghai) Co., Ltd.

(10) All kinds of chemical reagents are of analytical grade and are purchased from Shanghai Sinopharm Group.

(11) All kinds of restrictive enzymes and DNA ligases are purchased from Takara.

(12) 1 kb DNA Ladder and a plasmid miniprep kit are purchased from Sangon Biotech (Shanghai) Co., Ltd. A gel recovery kit is purchased from Fermentas.

(13) (3) Media

(14) The composition of a seed medium per 100 mL comprises: peptone 1 g, yeast powder 0.5 g, and NaCl 1 g.

(15) The composition of a fermentation medium per 100 mL comprises: peptone 1.2 g, yeast powder 2.4 g, glycerol 0.4 mL, KH.sub.2PO.sub.4 0.23 g, and K.sub.2HPO.sub.4 1.25 g.

(16) (4) HPLC Determination Method

(17) Preparation of an HPCL sample to be tested: 1 mL of reaction solution is taken, precipitate in the reaction is removed by centrifugation, and an appropriate amount of the supernatant is taken, diluted properly with deionized water, and filtered through a membrane with a pore size of 0.22 m. The filtrate is subjected to analysis by high performance liquid chromatography.

(18) Determination of acetylglucosamine content: an Agilent 1260 high performance liquid chromatograph (with a differential detector) and an HPX-87H column (Bio-Rad, Hercules, Calif.) are used; 0.5 mM dilute sulfuric acid is used as a mobile phase; the flow rate is 0.6 mL/min; the sample size is 10 L; the column temperature is 40 C.; isocratic elution is carried out. Detection is carried out by the differential detector.

(19) Determination of glucosamine content: an Agilent 1260 high performance liquid chromatograph (with a UV-visible detector) and an Agilent ODS (250 mm4.6 mm, 5 m) chromatographic column are used; a derivatization reagent is OPA (o-phthaldialdehyde); a mobile phase A is prepared by weighing 3.02 g of anhydrous sodium acetate in a beaker, adding deionized water to dissolve the anhydrous sodium acetate and dilute to 1 L, then adding 200 L of triethylamine, adjusting the PH to 7.200.05 with 5% acetic acid, and after suction filtration, adding 5 ml of tetrahydrofuran and carrying out mixing for later use; a mobile phase B is prepared by weighing 3.02 g of anhydrous sodium acetate in a beaker, adding deionized water to dissolve the anhydrous sodium acetate and enabling the constant volume to be 200 mL, adjusting the pH to 7.200.05 with 5% acetic acid, and after suction filtration, adding 400 mL of acetonitrile and 400 mL of methanol to the solution and carrying out mixing for later use; the flow rate is 1.0 mL/min; the sample size is 20 L; the column temperature is 40 C.; gradient elution is carried out. Detection is carried out by the UV detector at a detection wavelength of 330 nm.

(20) (5) Definition and Determination Method of Enzyme Activity Unit

(21) At 40 C., with 50 mM pH 8.0 PB as a buffer, the enzyme amount, which can convert 1 mol of substrate acetylglucosamine to 1 mol of product glucosamine in 1 h, is called an enzyme activity unit, i.e., 1 U=1 mol/h.

(22) Determination method of enzyme activity of diacetylchitobiose deacetylase:

(23) 5 mL of acetylglucosamine solution is accurately sucked and added into clean test tubes 1# and 2# with stoppers respectively, and preheated for 5 minutes in a 40 C. water bath kettle; 5 mL of crude enzyme solution is added to the test tube 2# (the enzyme solution is appropriately diluted with a pH 8.0 PB buffer, and the dilution factor is N), and 5 mL of PB solution is added to the test tube 1#; the mixed solutions are shaken intermittently for 2 min in a 40 C. constant temperature water bath; after taking out, 1 mL of 1 M dilute hydrochloric acid solution is immediately added to each of the test tubes 1# and 2# to terminate the reaction. The mixed solutions are subjected to external standard detection analysis by liquid chromatography.

(24) Drawing of a standard curve: an acetylglucosamine standard (with accuracy of 0.0001 g) is accurately weighed to prepare 1 g/L, 2 g/L, 3 g/L, 4 g/L and 5 g/L acetylglucosamine solutions, liquid phase detection is carried out and a standard curve is drawn.

(25) Calculation of enzyme activity:

(26) $X=\frac{\left(A-B\right)1.1\left(5+5\right)}{215.625}{10}^{3}N60$

(27) where XEnzyme activity, U/mL;

(28) 5Volume of an enzyme solution, mL;

(29) 5Volumic number of a substrate solution (100 g/L acetylglucosamine solution), mL;

(30) AGlucosamine content of reaction liquid, g/L;

(31) BGlucosamine content of blank liquid, g/L;

(32) NDilution rate of the enzyme solution;

(33) 1.1Dilution rate of a sample after a terminator is added;

(34) 215.6Molar mass of standard sample glucosamine hydrochloride, g/mol;

(35) 5Volumic number of a substrate solution (100 g/L acetylglucosamine solution), mL;

(36) 2Reaction time, min;

(37) 601 h is 60 min.

(38) Biochemical techniques used in the disclosure are all conventional techniques in the art.

Example 1 Construction of Recombinant Plasmids which Secrete and Express Diacetylchitobiose Deacetylase

(39) A gene encoding a signal peptide yncM (with the nucleotide sequence as shown in SEQ ID NO. 1) and a gene encoding diacetylchitobiose deacetylase Dac (with the nucleotide sequence as shown in SEQ ID NO. 2), namely two target genes are inserted into an expression vector pP43NMK by seamless cloning (the insertion sites are KpnI and PstI), and a recombinant plasmid pP43NMK-yncM-Dac is constructed (as shown in FIG. 1).

Example 2 Acquisition of 5-Untranslated Region Mutants

(40) In the process of constructing the recombinant plasmid pP43NMK-yncM-Dac in Example 1, a 5-untranslated region mutant is acquired and found to have a 73 bp base insertion at the 5-end by sequencing and analyzing (as shown in FIG. 2), and the mutated recombinant plasmid is named pP43mut-yncM-Dac (with the nucleotide sequence as shown in SEQ ID NO. 4).

Example 3 Construction of Recombinant B. subtilis

(41) The recombinant plasmid pP43mut-yncM-Dac acquired in Example 2 is transformed into a cloning host E. coli JM109, and single colonies growing on an LB kanamycin resistant plate are picked for colony PCR identification; positive clones are cultured for extracting plasmids and the plasmids are subjected to double enzyme digestion identification, correct digestion bands are selected for sequencing, and the recombinant plasmid with a correct sequencing result is transformed into an expression host B. subtilis WB600.

Example 4 Secretion and Expression of Diacetylchitobiose Deacetylase Encoding Gene in B. subtilis WB600

(42) The recombinant B. subtilis bacterial strain acquired in Example 3 is inoculated into a seed medium containing kanamycin antibiotics (10 mg/L) at 37 C., and cultured overnight at 220 rpm with shaking. Transferring is carried out to a fresh fermentation medium containing kanamycin antibiotics (10 mg/L) according to an inoculum concentration (v/v) of 4%, and cultured for 14-80 h at 37 C. at 220 rpm with shaking. The enzyme activity reaches a maximum of 1,548.7 U/mL during fermentation, and the yield of diacetylchitobiose deacetylase reaches a maximum of 620 mg/L.

Example 5 Growth of Recombinant B. subtilis

(43) The recombinant B. subtilis bacterial strain acquired in Example 3 is inoculated into a seed medium containing kanamycin antibiotics (10 mg/L) at 37 C., and cultured overnight at 220 rpm with shaking. Transferring is carried out to a fresh fermentation medium containing kanamycin antibiotics (10 mg/L) according to an inoculum concentration (v/v) of 4%, and cultured at 37 C. at 220 rpm with shaking. Samples are taken every 2-8 h and diluted appropriately with deionized water, and OD.sub.600 is measured with an ultraviolet spectrophotometer to plot the growth curve of the thallus. As shown in FIG. 3, after 12 h, the growth of the thallus enters an equilibrium phase, the concentration of the thallus reaches the highest at 14 h (OD.sub.600=23.3), and begins to decrease at around 18 h, and then the growth of the thallus enters a decline phase.

Example 6 Detection of Enzyme Activity of Diacetylchitobiose Deacetylase in B. subtilis WB600 at Different Stages

(44) Samples are taken from different fermentation stages and centrifuged at 8,000g, the thallus is discarded, and the supernatant is obtained, which is the crude enzyme solution. The enzyme activity is determined according to the above enzyme activity detection method. The degradation rate of acetylglucosamine is controlled at 10% or below in the detection process. Otherwise, the enzyme solution needs to be appropriately diluted with a pH 8.0 PB buffer with a concentration of 50 mM, and then the enzyme activity is determined as described above. A curve of enzyme activity over time is plotted based on the determination results. As shown in FIG. 3, the diacetylchitobiose deacetylase in the fermentation supernatant has only weak enzyme activity in earlier stages of a lag phase and a log phase, and is detected to have obvious extracellular enzyme activity when entering a balancer; when the growth enters a decline phase, the activity of diacetylchitobiose deacetylase in the fermentation supernatant increases significantly; after 48 h, the extracellular enzyme activity increases slowly, reaches the peak at 60 h (1,548.7 U/mL), and then basically stabilizes.

(45) Control 1

(46) Plasmids fused with different signal peptides (yncM, bpr, ywbN, ansZ, yvgO, amyE, oppA, vpr, lipA, wapA, Epr and yclQ, with amino acid sequences shown in Table 1) are used as controls, and other conditions are the same as those in Examples 1-6. In the fermentation process, the plasmids fused with different signal peptides have enzyme activity ranging from 0 U/mL to 18.6 U/mL, and extracellular enzyme activity is as high as 18.6 U/mL, as shown in FIG. 4.

(47) TABLE-US-00001 TABLE1 Sequencesofsignalpeptides Aminoacidsequencesof SEQID Name signalpeptides NO: yncM MAKPLSKGGILVKKVLIAGAVGTAVLFGTLSSGIPG 5 LPAADAQVAKA bpr MRKKTKNRLISSVLSTVVISSLLFPGAAGA 6 ywbN MSDEQKKPEQIHRRDILKWGAMAGAAVA 7 ansZ MKKQRMLVLFTALLFVFTGCSHS 8 yvgO MKRIRIPMTLALGAALTIAPLSFASA 9 amyE MFAKRFKTSLLPLFAGFLLLFHLVLAGPAAASA 10 oppA MKKRWSIVTLMLIFTLVLSA 11 vpr MKKGIIRFLLVSFVLFFALSTGITGVQA 12 lipA MKFVKRRIIALVTILMLSVTSLFALQPSAKA 13 wapA MKKRKRRNFKRFIAAFLVLALMISLVPADVLA 14 Epr MKNMSCKLVVSVTLFFSFLTIGPLAHA 15 yclQ MKKFALLFIALVTAVVISACGNQSTSSKG 16

(48) Control 2

(49) The recombinant plasmid pP43NMK-yncM-Dac which is not mutated in the 5-untranslated region is used as a control, and other conditions are the same as those in Examples 1-6. The enzyme activity reaches a maximum of 18.6 U/mL during fermentation, and the yield of diacetylchitobiose deacetylase reaches a maximum of 12 mg/L, as shown in FIG. 5.