METHODS AND COMPOSITIONS FOR TREATING, INHIBITING, AND/OR PREVENTING HETEROTOPIC OSSIFICATION
20210047413 ยท 2021-02-18
Inventors
Cpc classification
A61K39/395
HUMAN NECESSITIES
C07K16/2875
CHEMISTRY; METALLURGY
C07K2317/76
CHEMISTRY; METALLURGY
A61K38/16
HUMAN NECESSITIES
International classification
C07K16/28
CHEMISTRY; METALLURGY
A61K38/16
HUMAN NECESSITIES
Abstract
Disclosed are methods and compositions for treating, inhibiting, and/or preventing heterotopic ossification in a subject in need thereof. Particularly disclosed are methods for treating, inhibiting, and/or preventing heterotopic ossification in a subject in need thereof by administering to the subject a therapeutic agent such as an immune checkpoint inhibitor and/or Fetuin-A or a variant thereof. Also disclosed are pharmaceutical compositions and pharmaceutical kits comprising an immune checkpoint inhibitor and/or Fetuin-A or a variant thereof for treating, inhibiting, and/or preventing heterotopic ossification in a subject in need thereof.
Claims
1. A method for treating, inhibiting, and/or preventing heterotopic ossification in a subject in need thereof, the method comprising administering to the subject an effective amount of an immune checkpoint inhibitor to treat, inhibit, and/or prevent heterotopic ossification in the subject.
2. The method of claim 1, wherein the subject has experienced traumatic injury prior to administering to the subject the effective amount of an immune checkpoint inhibitor to treat, inhibit, and/or prevent heterotopic ossification in the subject.
3. The method of claim 1, wherein the subject has undergone surgery prior to administering to the subject the effective amount of an immune checkpoint inhibitor to treat, inhibit, and/or prevent heterotopic ossification in the subject.
4. The method of claim 1, wherein the immune checkpoint inhibitor is selected from the group consisting of an anti CD152, an anti PD-1 antibody, an anti PD-L1 antibody, an anti IDO-1 antibody, an anti IDO-2 antibody, an anti KIR antibody, an anti CD70 antibody, an anti LAG-3 antibody, an anti B7-H3 antibody, an anti B7-H4 antibody, an anti TIM3 antibody, and combinations thereof.
5. The method of claim 1, wherein the immune checkpoint inhibitor is an anti CD152 antibody.
6. The method of claim 1, wherein the immune checkpoint inhibitor is an anti PD-1 antibody.
7. The method of claim 1, wherein the immune checkpoint inhibitor is an anti PD-L1 antibody.
8. A method for treating, inhibiting, and/or preventing heterotopic ossification in a subject in need thereof, the method comprising administering to the subject an effective amount of Fetuin-A or a variant thereof to treat, inhibit, and/or prevent heterotopic ossification in the subject.
9. The method of claim 8, wherein the subject has experienced traumatic injury prior to administering to the subject the effective amount of an immune checkpoint inhibitor to treat, inhibit, and/or prevent heterotopic ossification in the subject.
10. The method of claim 8, wherein the subject has undergone surgery prior to administering to the subject the effective amount of an immune checkpoint inhibitor to treat, inhibit, and/or prevent heterotopic ossification in the subject.
11. The method of claim 8, wherein the Fetuin-A comprises an amino acid sequence of any of SEQ ID NOs:1-4, a processed form of any of SEQ ID NOs:1-4 lacking amino acids 1-18, or a variant of any of SEQ ID NOs:1-4 or a processed form of any of SEQ ID NOs:1-4 lacking amino acids 1-18, wherein the variant has at least about 80% sequence identity to any of SEQ ID NOs:1-4 or a processed form of any of SEQ ID NOs:1-4 lacking amino acids 1-18.
12. A method for treating, inhibiting, and/or preventing heterotopic ossification in a subject in need thereof, the method comprising: (i) administering to the subject an effective amount of an immune checkpoint inhibitor to treat, inhibit, and/or prevent heterotopic ossification in the subject; and (ii) administering to the subject an effective amount of Fetuin-A or a variant thereof to treat, inhibit, and/or prevent heterotopic ossification in the subject, wherein the effective amount of the immune checkpoint inhibitor is administered to the subject before, concurrently with, or after the effective amount of the Fetuin-A is administered to the subject.
13. The method of claim 12, wherein the subject has experienced traumatic injury prior to administering to the subject the effective amount of the immune checkpoint inhibitor to treat, inhibit, and/or prevent heterotopic ossification in the subject; and/or wherein the subject has experienced traumatic injury prior to administering to the subject the effective amount of the Fetuin-A or the variant thereof to treat, inhibit, and/or prevent heterotopic ossification in the subject.
14. The method of claim 12, wherein the subject has undergone surgery prior to administering to the subject the effective amount of the immune checkpoint inhibitor to treat, inhibit, and/or prevent heterotopic ossification in the subject; and/or wherein the subject has undergone surgery prior to administering to the subject the effective amount of the Fetuin-A or the variant thereof to treat, inhibit, and/or prevent heterotopic ossification in the subject.
15. The method of claim 12, wherein the immune checkpoint inhibitor is an anti CD152 antibody.
16. The method of claim 12, wherein the immune checkpoint inhibitor is an anti PD-1 antibody.
17. The method of claim 12, wherein the immune checkpoint inhibitor is an anti PD-L1 antibody.
18. The method of claim 12, wherein the Fetuin-A or the variant thereof comprises an amino acid sequence of any of SEQ ID NOs:1-4, a processed form of any of SEQ ID NOs:1-4 lacking amino acids 1-18, or a variant of any of SEQ ID NOs:1-4 or a processed form of any of SEQ ID NOs:1-4 lacking amino acids 1-18, wherein the variant has at least about 80% sequence identity to any of SEQ ID NOs:1-4 or a processed form of any of SEQ ID NOs:1-4 lacking amino acids 1-18.
19. A pharmaceutical composition for treating, inhibiting, and/or preventing heterotopic ossification in a subject in need thereof, the pharmaceutical composition comprising: (i) an effective amount of an immune checkpoint inhibitor to treat, inhibit, and/or prevent heterotopic ossification in the subject and/or an effective amount of Fetuin-A or a variant thereof to treat, inhibit, and/or prevent heterotopic ossification in the subject; and (ii) a pharmaceutical carrier.
20. A pharmaceutical kit for treating, inhibiting, and/or preventing heterotopic ossification in a subject in need thereof, the pharmaceutical kit comprising: (i) an effective amount of an immune checkpoint inhibitor to treat, inhibit, and/or prevent heterotopic ossification in the subject; and (ii) an effective amount of Fetuin-A or a variant thereof to treat, inhibit, and/or prevent heterotopic ossification in the subject.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
DETAILED DESCRIPTION
[0024] Disclosed are methods and compositions for treating, inhibiting, and/or preventing heterotopic ossification. The methods and compositions are described herein using several definitions, as set forth below and throughout the application.
[0025] As used in this specification and the claims, the singular forms a, an, and the include plural forms unless the context clearly dictates otherwise. For example, a therapeutic agent should be interpreted to mean one or more therapeutic agents unless the context clearly dictates otherwise. As used herein, the term plurality means two or more.
[0026] As used herein, about, approximately, substantially, and significantly will be understood by persons of ordinary skill in the art and will vary to some extent on the context in which they are used. If there are uses of the term which are not clear to persons of ordinary skill in the art given the context in which it is used, about and approximately will mean up to plus or minus 10% of the particular term and substantially and significantly will mean more than plus or minus 10% of the particular term.
[0027] As used herein, the terms include and including have the same meaning as the terms comprise and comprising. The terms comprise and comprising should be interpreted as being open transitional terms that permit the inclusion of additional components further to those components recited in the claims. The terms consist and consisting of should be interpreted as being closed transitional terms that do not permit the inclusion of additional components other than the components recited in the claims. The term consisting essentially of should be interpreted to be partially closed and allowing the inclusion only of additional components that do not fundamentally alter the nature of the claimed subject matter.
[0028] The presently disclosed methods and compositions relate to therapeutic treatment of subjects in need thereof. As used herein, the term subject, which may be used interchangeably with the terms patient or individual, refers to one who receives medical care, attention or treatment and may encompass a human patient.
[0029] As used herein, the term subject is meant to encompass a person who has heterotopic ossification or is at risk for developing heterotopic ossification. A subject may include a subject who has heterotopic ossification or is at risk for developing heterotopic following tissue damage. A subject may include a subject who has acquired heterotopic ossification or is at risk for developing heterotopic following tissue damage, which is triggered by traumatic brain injury, spinal cord injury, total hip arthroplasty, wartime trauma and/or other traumatic injuries.
[0030] As used herein, the phrase effective amount shall mean that drug dosage that provides the specific pharmacological response for which the drug is administered in a significant number of subject in need of such treatment. An effective amount of a drug that is administered to a particular subject in a particular instance will not always be effective in treating the conditions/diseases described herein, even though such dosage is deemed to be a therapeutically effective amount by those of skill in the art.
[0031] As used herein, the term inhibit means decreasing or blocking biological activity, for example inhibiting or blocking one or more biological components of an immune checkpoint.
[0032] The disclosed methods and compositions relate to treating, inhibiting, and/or preventing heterotopic ossification in a subject in need thereof. In some embodiments, the disclosed methods and compositions relate to treating, inhibiting, and/or preventing heterotopic ossification in a subject in need thereof by administering to the subject a therapeutic agent that comprises an immune checkpoint inhibitor or blocker.
[0033] As such, the disclosed methods may utilize and/or the disclosed composition may comprise one or more immune checkpoint inhibitors or blockers. Immune checkpoint inhibitors and blockers are known in the art. In some embodiments, the immune checkpoint inhibitor or blocker of the disclosed methods and composition is selected from the group consisting of, but not limited to, an anti CD152 antibody (i.e., an CTLA-4 antibody)(e.g., Ipilimumab or Tremelimumab), an anti PD-1 antibody (MDX-1106, BMS-936558, MK3475, CT-011, AMP-224), an anti PD-L1 antibody (e.g., MDX-1105), an anti IDO-1 antibody, an anti IDO-2 antibody, an anti MR antibody, an anti CD70 antibody, an anti LAG-3 antibody (e.g., IMP321), an anti B7-H3 antibody (e.g., MGA271), an anti B7-H4 antibody, an anti TIM3 antibody, and combinations thereof.
[0034] In some embodiments, the disclosed methods and compositions relate to treating and/or inhibiting heterotopic ossification in a subject in need thereof by administering to the subject a therapeutic agent that comprises Fetuin A. Fetuin A may alternatively be referred to as alpha-2-HS glycoprotein. Four human isoforms of Fetuin A are known and are expressed as preproteins which are processed to produce the mature isoforms:
TABLE-US-00001 Isoform1preprotein(SEQIDNO:1); 1 mksivlllclaqlwgchsaphgpgliyrqpncddpeteeaalvaidyinqnlpwgykhtl 61 nqidevkvwpqqpsgelfeieidtlettchvldptpvarcsvrqlkehavegdcdfqllk 121 ldgkfsvvyakcdsspadsaedvrkvcqdcpllaplndtrvvhaakaalaafnaqnngsn 181 fqleeisraqlvplppstyveftvsgtdcvakeateaakcnllaekqygfckatlseklg 241 gaevavtcmvfqtqpvssqpqpeganeavptpvvdpdappspplgapglppagsppdshv 301 llaappghqlhrahydlrhtfmgvvslgspsgevshprktrtvvqpsvgaaagpvvppcp 361 grirhfkv Isoform2preprotein(SEQIDNO:2) 1 mkslvlllclaqlwgchsaphgpgliyrqpncddpeteeaalvaidyinqnlpwgykhtl 61 nqidevkvwpqqpsgelfeieidtlettchvldptpvarcsvrqlkehavegdcdfqllk 121 ldgkfsvvyakcdsspdsaedvrkvcqdcpllaplndtrvvhaakaalaafnaqnngsnf 181 qleeisraqlvplppstyveftvsgtdcvakeateaakcnllaekqygfckatlseklgg 241 aevavtcmvfqtqpvssqpqpeganeavptpvvdpdappspplgapglppagsppdshvl 301 laappghqlhrahydlrhtfmgvvslgspsgevshprktrtvvqpsvgaaagpvvppcpg 361 rirhfkv Isoform3preprotein(SEQIDNO:3) 1 mkslvlllclaqlwgchsaphgpgliyrqpncddpeteeaalvaidyinqnlpwgykhtl 61 nqidevkvwpqpsgelfeieidtlettchvldptpvarcsvrqlkehavegdcdfqllkl 121 dgkfsvvyakcdsspdsaedvrkvcqdcpllaplndtrvvhaakaalaafnaqnngsnfq 181 leeisraqlvplppstyveftvsgtdcvakeateaakcnllaekqygfckatlseklgga 241 evavtcmvfqtqpvssqpqpeganeavptpvvdpdappspplgapglppagsppdshvll 301 aappghqlhrahydlrhtfmgvvslgspsgevshprktrtvvqpsvgaaagpvvppcpgr 361 irhfkv Isoform4preprotein(SEQIDNO:4) 1 mkslvlllclaqlwgchsaphgpgliyrqpncddpeteeaalvaidyinqnlpwgykhtl 61 nqidevkvwpqqpsgelfeieidtlettchvldptpvarcsvrqlkehavegdcdfqllk 121 ldgkfsvvyakcdsspdsaedvrkvcqdcpllaplndtrvvhaakaalaafnaqnngsnf 181 qleeisraqlvplppstyveftvsgtdcvakeateaakcnllaekpvssqpqpeganeav 241 ptpvvdpdappspplgapglppagsppdshvllaappghqlhrahydlrhtfmgvvslgs 301 psgevshprktrtvvqpsvgaaagpvvppcpgrirhfkv
[0035] The disclosed methods may utilize and the disclosed compositions may comprise any suitable isoform of Fetuin A, optionally in its full-length or processed form, for example, in which amino acids 1-18 are removed from the preprotein. The disclosed method may utilize and the disclosed compositions may comprise variant forms of Fetuin A, for example a variant having at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to any of full-length SEQ ID NOs:1-3, which variant may include a fragment having at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to any of full-length SEQ ID NOs:1-3. Methods and algorithms for determining sequence identity are available at public databases including the database for the National Center for Biotechnology Information (NCBI) of the National Institutes of Health (NIH), and its Basic Local Alignment Search Tool (BLAST). Optionally, the Fetuin-A variants exhibit one or more biological activities of wild-type Fetuin-A. Optionally, the Fetuin-A and variants of Fetuin A administered in the disclosed methods and present in the disclosed compositions may function to bind, carry, and transport free fatty acids in circulation of a subject that has been administered the Fetuin-A or variants thereof.
ILLUSTRATED EMBODIMENTS
[0036] The following Embodiments are illustrative and should not be interpreted to limit the scope of the claimed subject matter.
[0037] Embodiment 1. A method for treating, inhibiting, and/or preventing heterotopic ossification in a subject in need thereof, the method comprising administering to the subject an effective amount of an immune checkpoint inhibitor to treat, inhibit, and/or prevent heterotopic ossification in the subject.
[0038] Embodiment 2. The method of embodiment 1, wherein the subject has experienced traumatic injury prior to administering to the subject the effective amount of the immune checkpoint inhibitor to treat, inhibit, and/or prevent heterotopic ossification in the subject.
[0039] Embodiment 3. The method of embodiment 1, wherein the subject has undergone surgery prior to administering to the subject the effective amount of the immune checkpoint inhibitor to treat, inhibit, and/or prevent heterotopic ossification in the subject.
[0040] Embodiment 4. The method of any of the foregoing embodiments, wherein the immune checkpoint inhibitor is selected from the group consisting of an anti CD152 (i.e., an anti CTLA-4 antibody) (e.g., Ipilimumab or Tremelimumab), an anti PD-1 antibody (MDX-1106, BMS-936558, MK3475, CT-011, AMP-224), an anti PD-L1 antibody (e.g., MDX-1105), an anti IDO-1 antibody, an anti IDO-2 antibody, an anti MR antibody, an anti CD70 antibody, an anti LAG-3 antibody (e.g., IMP321), an anti B7-H3 antibody (e.g., MGA271), an anti B7-H4 antibody, an anti TIM3 antibody, and combinations thereof.
[0041] Embodiment 5. The method of any of the foregoing embodiments, wherein the immune checkpoint inhibitor is an anti CD152 antibody (i.e., an anti CTLA-4 antibody).
[0042] Embodiment 6. The method of any of the foregoing embodiments, wherein the immune checkpoint inhibitor is an anti PD-1 antibody.
[0043] Embodiment 7. The method of any of the foregoing embodiments, wherein the immune checkpoint inhibitor is an anti PD-L1 antibody.
[0044] Embodiment 8. A method for treating, inhibiting, and/or preventing heterotopic ossification in a subject in need thereof, the method comprising administering to the subject an effective amount of Fetuin-A or a variant thereof to treat, inhibit, and/or prevent heterotopic ossification in the subject.
[0045] Embodiment 9. The method of embodiment 8, wherein the subject has experienced traumatic injury prior to administering to the subject the effective amount of the Fetuin-A or the variant thereof to treat, inhibit, and/or prevent heterotopic ossification in the subject.
[0046] Embodiment 10. The method of embodiment 8, wherein the subject has undergone surgery prior to administering to the subject the effective amount of the Fetuin-A or the variant thereof to treat, inhibit, and/or prevent heterotopic ossification in the subject.
[0047] Embodiment 11. The method of any of embodiments 8-10, wherein the Fetuin-A or the variant thereof comprises an amino acid sequence of any of SEQ ID NOs:1-4, a processed form of any of SEQ ID NOs:1-4 lacking amino acids 1-18, or a variant of any of SEQ ID NOs:1-4 or a processed form of any of SEQ ID NOs:1-4 lacking amino acids 1-18, wherein the variant has at least about 80% sequence identity to any of SEQ ID NOs:1-4 or a processed form of any of SEQ ID NOs:1-4 lacking amino acids 1-18.
[0048] Embodiment 12. A method for treating, inhibiting, and/or preventing heterotopic ossification in a subject in need thereof, the method comprising: (i) administering to the subject an effective amount of an immune checkpoint inhibitor to treat, inhibit, and/or prevent heterotopic ossification in the subject; and (ii) administering to the subject an effective amount of Fetuin-A or a variant thereof to treat, inhibit, and/or prevent heterotopic ossification in the subject, wherein the effective amount of the immune checkpoint inhibitor is administered to the subject before, concurrently with, or after the effective amount of the Fetuin-A is administered to the subject.
[0049] Embodiment 13. The method of embodiment 12, wherein the subject has experienced traumatic injury prior to administering to the subject the effective amount of the immune checkpoint inhibitor to treat, inhibit, and/or prevent heterotopic ossification in the subject; and/or wherein the subject has experienced traumatic injury prior to administering to the subject the effective amount of the Fetuin-A or the variant thereof to treat, inhibit, and/or prevent heterotopic ossification in the subject.
[0050] Embodiment 14. The method of embodiment 12, wherein the subject has undergone surgery prior to administering to the subject the effective amount of the immune checkpoint inhibitor to treat, inhibit, and/or prevent heterotopic ossification in the subject; and/or wherein the subject has undergone surgery prior to administering to the subject the effective amount of the Fetuin-A or the variant thereof to treat, inhibit, and/or prevent heterotopic ossification in the subject.
[0051] Embodiment 15. The method of any of embodiments 12-14, wherein the immune checkpoint inhibitor is selected from the group consisting of an anti CD152 (i.e., an anti CTLA-4 antibody) (e.g., Ipilimumab or Tremelimumab), an anti PD-1 antibody (MDX-1106, BMS-936558, MK3475, CT-011, AMP-224), an anti PD-L1 antibody (e.g., MDX-1105), an anti IDO-1 antibody, an anti IDO-2 antibody, an anti MR antibody, an anti CD70 antibody, an anti LAG-3 antibody (e.g., IMP321), an anti B7-H3 antibody (e.g., MGA271), an anti B7-H4 antibody, an anti TIM3 antibody, and combinations thereof.
[0052] Embodiment 16. The method of any of embodiments 12-15, wherein the immune checkpoint inhibitor is an anti CD152 antibody (i.e., an anti CTLA-4 antibody).
[0053] Embodiment 17. The method of any of embodiments 12-15, wherein the immune checkpoint inhibitor is an anti PD-1 antibody.
[0054] Embodiment 18. The method of any of embodiments 12-15, wherein the immune checkpoint inhibitor is an anti PD-L1 antibody.
[0055] Embodiment 19. The method of any of embodiments 12-18, wherein the Fetuin-A or the variant thereof comprises an amino acid sequence of any of SEQ ID NOs:1-4, a processed form of any of SEQ ID NOs:1-4 lacking amino acids 1-18, or a variant of any of SEQ ID NOs:1-4 or a processed form of any of SEQ ID NOs:1-4 lacking amino acids 1-18, wherein the variant has at least about 80% sequence identity to any of SEQ ID NOs:1-4 or a processed form of any of SEQ ID NOs:1-4 lacking amino acids 1-18.
[0056] Embodiment 20. A pharmaceutical composition for treating, inhibiting, and/or preventing heterotopic ossification in a subject in need thereof, the pharmaceutical composition comprising: (i) an effective amount of an immune checkpoint inhibitor to treat, inhibit, and/or prevent heterotopic ossification in the subject; and (ii) a pharmaceutical carrier.
[0057] Embodiment 21. The pharmaceutical composition of embodiment 20, wherein the immune checkpoint inhibitor is selected from the group consisting of an anti CD152 (i.e., an anti CTLA-4 antibody) (e.g., Ipilimumab or Tremelimumab), an anti PD-1 antibody (MDX-1106, BMS-936558, MK3475, CT-011, AMP-224), an anti PD-L1 antibody (e.g., MDX-1105), an anti IDO-1 antibody, an anti IDO-2 antibody, an anti MR antibody, an anti CD70 antibody, an anti LAG-3 antibody (e.g., IMP321), an anti B7-H3 antibody (e.g., MGA271), an anti B7-H4 antibody, an anti TIM3 antibody, and combinations thereof.
[0058] Embodiment 22. The pharmaceutical composition of embodiment 20 or 21, wherein the immune checkpoint inhibitor is an anti CD152 antibody (i.e., an anti CTLA-4 antibody).
[0059] Embodiment 23. The pharmaceutical composition of embodiment 20 or 21, wherein the immune checkpoint inhibitor is an anti PD-1 antibody.
[0060] Embodiment 24. The pharmaceutical composition of embodiment 20 or 21, wherein the immune checkpoint inhibitor is an anti PD-L1 antibody.
[0061] Embodiment 25. A pharmaceutical composition for treating, inhibiting, and/or preventing heterotopic ossification in a subject in need thereof, the pharmaceutical composition comprising: (i) an effective amount of Fetuin-A or the variant thereof to treat, inhibit, and/or prevent heterotopic ossification in the subject; and (ii) a pharmaceutical carrier.
[0062] Embodiment 26. The pharmaceutical composition of embodiment 25, wherein the Fetuin-A or the variant thereof comprises an amino acid sequence of any of SEQ ID NOs:1-4, a processed form of any of SEQ ID NOs:1-4 lacking amino acids 1-18, or a variant of any of SEQ ID NOs:1-4 or a processed form of any of SEQ ID NOs:1-4 lacking amino acids 1-18, wherein the variant has at least about 80% sequence identity to any of SEQ ID NOs:1-4 or a processed form of any of SEQ ID NOs:1-4 lacking amino acids 1-18.
[0063] Embodiment 27. A pharmaceutical kit for treating, inhibiting, and/or preventing heterotopic ossification in a subject in need thereof, the pharmaceutical kit comprising: (i) an effective amount of an immune checkpoint inhibitor to treat, inhibit, and/or prevent heterotopic ossification in the subject; and (ii) an effective amount of Fetuin-A or a variant thereof to treat, inhibit, and/or prevent heterotopic ossification in the subject.
[0064] Embodiment 28. The pharmaceutical kit of embodiment 27, wherein the immune checkpoint inhibitor is selected from the group consisting of an anti CD152 (i.e., an anti CTLA-4 antibody) (e.g., Ipilimumab or Tremelimumab), an anti PD-1 antibody (MDX-1106, BMS-936558, MK3475, CT-011, AMP-224), an anti PD-L1 antibody (e.g., MDX-1105), an anti IDO-1 antibody, an anti IDO-2 antibody, an anti MR antibody, an anti CD70 antibody, an anti LAG-3 antibody (e.g., IMP321), an anti B7-H3 antibody (e.g., MGA271), an anti B7-H4 antibody, an anti TIM3 antibody, and combinations thereof.
[0065] Embodiment 29. The pharmaceutical kit of embodiment 27 or 28, wherein the immune checkpoint inhibitor is an anti CD152 antibody (i.e., an anti CTLA-4 antibody).
[0066] Embodiment 30. The pharmaceutical kit of embodiment 27 or 28, wherein the immune checkpoint inhibitor is an anti PD-1 antibody.
[0067] Embodiment 31. The pharmaceutical kit of embodiment 27 or 28, wherein the immune checkpoint inhibitor is an anti PD-L1 antibody.
[0068] Embodiment 32. The pharmaceutical kit of any of embodiments 27-31, wherein the Fetuin-A or the variant thereof comprises an amino acid sequence of any of SEQ ID NOs:1-4, a processed form of any of SEQ ID NOs:1-4 lacking amino acids 1-18, or a variant of any of SEQ ID NOs:1-4 or a processed form of any of SEQ ID NOs:1-4 lacking amino acids 1-18, wherein the variant has at least about 80% sequence identity to any of SEQ ID NOs:1-4 or a processed form of any of SEQ ID NOs:1-4 lacking amino acids 1-18.
EXAMPLES
[0069] The following Examples are illustrative and should not be interpreted to limit the scope of the claimed subject matter.
Example 1Inhibition of Immune Checkpoints Prevents Injury-Induced Heterotopic Ossification
[0070] Reference is made to Kan et al., Inhibition of immune checkpoints prevents injury-induced heterotopic ossification, Bone Res. 2019; 7; 33; pages 1-8, published online Nov. 1, 2019, the content of which is incorporated herein by reference in its entirety.
[0071] Abstract
[0072] Heterotopic ossification (HO), true bone formation in soft tissue, is closely associated with abnormal injury/immune responses. We hypothesized that a key underlying mechanism of HO might be injury-induced dysregulation of immune checkpoint proteins (ICs). We found that the earliest stages of HO are characterized by enhanced infiltration of polarized macrophages into sites of minor injuries in an animal model of HO. The non-specific immune suppressants, Rapamycin and Ebselen, prevented HO providing evidence of the central role of the immune responses. We examined the expression pattern of ICs and found that they are dysregulated in HO lesions. More importantly, loss of function of inhibitory ICs (including PD1, PD-L1, and CD152) markedly inhibited HO, whereas loss of function of stimulatory ICs (including CD40L and OX-40L) facilitated HO. These findings suggest that IC inhibitors may provide a therapeutic approach to prevent or limit the extent of HO.
[0073] Applications
[0074] Applications of the disclosed technology may include, but are not limited to: (i) inhibition of heterotopic ossification (HO) in early stages of a subject having HO or at risk for developing HO; and (ii) prevention of potential HO formation that is induced by traumatic injury or surgery intra-operatively or post-operatively, as a phophylaxis, for example, in a medical institution environment.
[0075] Advantages
[0076] Advantages of the disclosed technology may include, but are not limited to: (i) the disclosed methods and compositions utilize immune checkpoint inhibitors or blockers which are mechanism-specific and are approved by the Food and Drug Administration (FDA).
[0077] Description
[0078] The inventors have used a CTLA-4/CD152 blocker and a PD-1/PD-L1 blocker to inhibit heterotopic ossification (HO) that has been induced by traumatic injury and to correct an abnormal injury response. The CTLA-4/CD152 blocker and a PD-1/PD-L1 blocker utilized by the present invention were first described for use in cancer immunotherapy.
[0079] Results
[0080] Evidence of altered immune homeostasis in an HO animal model. The Nse-BMP4 transgenic mouse recapitulates the hallmarks of both aHO and FOP (refs. .sup.11,12,22-25 and
[0081] Non-specific immune suppressors, Rapamycin and Ebselen, inhibit HO. We next tested the causal relationship between the altered immune responses and the subsequent HO. We repeated the injury procedure and then treated the mice with Rapamycin or Ebselen, for 2 weeks. Rapamycin and Ebselen each inhibited local immune cell infiltration (
[0082] Dysregulation of ICs in HO. To directly test the central hypothesis that tissue damage, especially after traumatic injuries, induces IC dysregulation in susceptible mice, we next determined whether ICs are dysregulated in the HO process. We immunostained injury sites for ICs including stimulatory ICs (CD27, CD28, CD278, CD40), and inhibitory ICs (CD152, TIM3, PD1, and PDL1) at different times p.i. (
[0083] Neutralizing Abs against inhibitory ICs block HO. To functionally test the central hypothesis, we treated the mice with neutralizing Abs against stimulatory ICs (
[0084] HO is associated with excessive collagen deposition and with changes in metallopeptidase expression by macrophages. We found that increased deposition of extracellular matrix (ECM) proteins is a consistent feature of the early phases of HO (
[0085] Discussion
[0086] HO typically is preceded by trauma followed by an aggravated early acute injury response, and then persistent low-grade inflammation..sup.26 However, the cascade of events leading to HO is still largely unknown, especially the early triggering event. The predominant view in the field at present is that BMP receptor signaling, mediated by BMP2/4/6/7 and/or activin, initiates the effects of the traumatic insults that lead to HO. The hypothesis underlying our current studies, and our experimental findings, challenge this view. Although BMP receptor signaling clearly plays a central role in HO, we find that BMP signaling is a later rather than early part of the signaling cascade that culminates in HO. Among over a dozen BMP-overexpressing transgenic lines, the Nse-BMP4 line utilized in the current studies is the only one that recapitulates the hallmarks of both aHO and FOP..sup.11,22 This reflects the characteristics of the Nse promoter that drives the transgene construct. In Nse-BMP4 mice, the Nse transgene is induced in M by injury, but the injury-induced expression of BMP4 does not become significant until 3 days p.i. (
[0087] Previous studies have shown that, unlike normal skeletogenesis, both innate and adaptive immunities contribute to HO..sup.11 In particular, M are both abundant and persistent in local HO lesions, and limiting the influx of monocytes/M reduces or prevents experimental HO..sup.11 This suggests an essential early role for M in triggering HO. We found that both stimulatory and inhibitory ICs were expressed by M in HO lesions. In general, the percentage of cells expressing stimulatory ICs was markedly increased in the early stages but decreased at later stages of HO, whereas the percentage of cells expressing inhibitory ICs was more variable with some increased earlier and some later during the HO process. Interfering with the expression of inhibitory ICs resulted in a truly remarkable reduction in HO with almost total prevention of HO even 2 months post-injury in the Nse-BMP4 mice. Conversely, interfering with the expression of stimulatory ICs markedly increased the severity of the HO. These observations highlight the central role of ICs in the altered immune homeostasis that leads to HO.
[0088] The observation that immune suppressants such as Rapamycin and Ebselen suppress HO would seem to suggest that overactive immune responses are responsible for HO. However, the findings that loss of function of stimulatory ICs facilitated HO, whereas loss of function of inhibitory ICs inhibited HO would seem to suggest that depressed immune responses are responsible. What underlies these seemingly contradictory sets of observations? We found that the percentage of CD206+/F4/80+M in lesion sites increased progressively with time. In fact, <1% of the M expressed CD206 at the time of injury while about 90% of the cells expressed CD206 within several weeks. Similarly, there was a conversion in the ICs expressed by the M from stimulatory to inhibitory ones. This suggests a dynamic biphasic process, i.e., overactive early and depressed later immune responses that both are necessary preconditions for the subsequent HO. Thus blocking either phase may be sufficient to prevent HO.
[0089] In earlier studies, we identified dysregulation of local stem/progenitor cells as a common cellular mechanism for HO,.sup.11 and many subsequent studies have characterized both the lineage of the stem cells and the cellular and molecular components of the stem cell niche that presdisposes them to osteogenic differentiation..sup.23,25,27-32 Stem/progenitor cell differentiation is greatly influenced by the ECM in which the cells reside, and increased deposition of ECM proteins is a consistent feature of the early phases of HO..sup.33-37 In view of the central role of M in HO,.sup.38-41 we questioned whether they may alter the ECM during the HO process. We found that expression by F4/80 M of both MMP12 and Adamts19 was reduced after injury in Nse-BMP4 mice, whereas MMP12 increased in WT mice, suggesting a possible mechanism for the increase in ECM proteins in the lesion.
[0090] Although it is always difficult to extrapolate from animal models of disease to humans, the cellular and molecular features of human HO are very similar to what is observed in Nse-BMP4 mice..sup.28 Thus we hypothesize that a BMP-dependent, injury-induced stem cell niche is a common mechanism of HO.sup.28 and that the altered immune homeostasis observed in the animal model are part of the process in humans. Importantly, we specifically used FDA-approved IC inhibitors in these studies to enhance the potential translational implications. Our findings suggest that treatment with IC Abs, in particular those that target inhibitory ICs, may provide a therapeutic approach to this currently untreatable clinical problem.
[0091] Materials and Methods
[0092] Animals and injury models. Nse-BMP4 transgenic mice, described previously,.sup.11,12,22-24 express BMP4 under the control of promoter of Nse. HO was induced by intramuscular injection of cardiotoxin (Sigma), according to previous reports..sup.11,12,23,24 All animal experiments in this study were approved by the Animal Care and Use Committees at Anhui Medical University (Protocol: LLSC20140042) and Northwestern University (Protocol: IS00001002).
[0093] Quantification of local immune cell infiltration after injury. Immunostaining for different markers were performed as previously described..sup.11,25 Briefly, sections were pre-fixed with 4% paraformaldehyde in phosphate-buffered saline (PBS). Nonspecific binding was blocked with 10% normal serum diluted in 1% bovine serum albumin (BSA; Jackson ImmunoResearch Laboratories, West Grove, Pa.) and 0.25% Triton X-100 (Sigma) for 1 h at room temperature. The sections then were incubated with primary Abs diluted with 1% BSA+0.25% Triton X-100 at 4 C. overnight. After washing, the sections were incubated with appropriate secondary Abs (Alexa Fluor 488, Alexa Fluor 594 conjugated Abs, Thermo Fisher Scientific) diluted with 1% BSA+0.25% Triton X-100 in a dark at room temperature for 2 h and counterstained with 4,6-diamidino-2-phenylindole (1:5 000). All fluorescent images were taken using ZEISS Axio Observer (Carl Zeiss, Germany). Signals from all channels were collected separately and overlaid in DPViewer.
[0094] Functional modulation of immune responses with immunosuppressants or IC blockade (neutralizing Abs against ICs). Nes-BMP4 mice (n=4) were treated with Rapamycin (5 mg.Math.kg.sup.1) or Ebselen (1 mg.Math.kg.sup.1), every other day for 2 weeks (8 injections) through intraperitoneal (i.p.) injection starting 1 day p.i. Control Nse-BMP4 mice were treated with vehicle on the same schedule. Every other day, dosing was used to minimize trauma to skin and abdominal muscle so that HO was not triggered by the injections. For IC blockade, the mice were treated with specific neutralizing Abs against stimulatory ICs, including CD40L (BioxCell, at the dosages of 20, 100, and 500 g per injection) and CD134L (BioxCell, at the dosages of 60, 120, and 300 g per injection), and inhibitory ICs, including CTLA-4 (BioxCell, at the dosages of 10, 50, and 250 g per injection), PD1 (BioxCell, at the dosages of 10, 50, and 250 g per injection), and PD-L1 (BioxCell, at the dosages of 24, 120, and 600 g per injection), through the tail vein every other day for 1 week (4 injections) starting 1 day p.i.
[0095] X-ray and micro-CT imaging. For X-ray, mice were anesthetized by 1% pentobarbital (150 L i.p.) and the images of radio-opaque HO were acquired by whole-body X-ray examination at 38 kv, 28 mA, 30 s (Bruker, USA). To quantitatively measure HO volume, micro-CT (PerkinElmer, USA) was used with the setting parameters of 180 rotation, constant 90 kv voltage, and voxel size 72 m, and the 3D images were reconstructed by the software package of the system.
[0096] Western blotting (WB). Lesional tissues or isolated M were lysed with RIPA buffer (Beyotime Biotechnology, China). Protein concentration was assessed by Bradford assay (Bio-Rad laboratories, USA). Protein samples (20 g) were resolved using 8% polyacrylamide gel and electrophoretically transferred to nitrocellulose and then blocked with non-fat milk in 0.1% Tween-20 in PBS for 1 h. Membranes were then incubated with primary Abs at room temperature for 1.5 h, and after washing, the membranes were incubated with horseradish peroxidase-conjugated secondary Abs. The specific signals were detected using the enhanced chemiluminescence western blot detection system (Odyssey, USA) after washing, following the manufacturer's instructions. -Actin was used as the loading control.
[0097] RNA extraction and qRT-PCR analysis. An MirVana miRNA Kit (Takara, China) was used to extract total RNA from lesional tissues and M following the manufacturer's instructions. PrimeScriptRT Reagent Kit (Takara, China) was used to synthesize the first-strand cDNA. Expression of various genes was quantified by the Real-time PCR Mixture assays (Takara, China). -Actin was used as the internal control.
[0098] Study of lesional macrophages. For tissue M, F4/80+M were sorted from injured tissues at different times through a MACS Kit (Miltenyi, USA), according to the manufacturer's instruction, and the F4/80+M were further analyzed by flow cytometry (BD, USA), using CD206 Ab (BD Pharmingen, USA) diluted with flow cytometry buffer (PBS+0.5% BSA+0.09% Sodium Azide). Flow cytometric data were analyzed by the FlowJo software (Tree Star, Inc).
[0099] Statistical analyses. Data are reported as meansstandard deviation. Statistical analyses between two groups were performed using Student's t test via SPSS 16.0 (SPSS Science, Chicago, Ill.). Statistical analyses between multiple groups were performed using one-way analysis of variance (ANOVA) or ANOVA with repeated measures followed by Bonferroni's post hoc test. P<0.05 was considered as statistically significant.
REFERENCES
[0100] 1. Sakellariou V I, Grigoriou E, Mavrogenis A F, Soucacos P N, Papagelopoulos P J. Heterotopic ossification following traumatic brain injury and spinal cord injury: insight into the etiology and pathophysiology. J Musculoskelet Neuronal Interact. 2012; 12(4):230-40. [0101] 2. Xu R, Hu J, Zhou X, Yang Y. Heterotopic ossification: Mechanistic insights and clinical challenges. Bone. 2017. [0102] 3. Pacifici M. Acquired and congenital forms of heterotopic ossification: new pathogenic insights and therapeutic opportunities. Curr Opin Pharmacol. 2018; 40:51-8. [0103] 4. Dey D, Wheatley B M, Cholok D, Agarwal S, Yu P B, Levi B, et al. The traumatic bone: trauma-induced heterotopic ossification. Transl Res. 2017; 186:95-111. [0104] 5. Legosz P, Drela K, Pulik L, Sarzynska S, Maldyk P. Challenges of heterotopic ossification-Molecular background and current treatment strategies. Clin Exp Pharmacol Physiol. 2018; 45(12):1229-35. [0105] 6. Hurlimann M, Schiapparelli F F, Rotigliano N, Testa E, Amsler F, Hirschmann M T. Influence of surgical approach on heterotopic ossification after total hip arthroplastyis minimal invasive better? A case control study. BMC Musculoskelet Disord. 2017; 18(1):27. [0106] 7. Zeckey C, Hildebrand F, Frink M, Krettek C. Heterotopic ossifications following implant surgeryepidemiology, therapeutical approaches and current concepts. Semin Immunopathol. 2011; 33(3):273-86. [0107] 8. Huning I, Gillessen-Kaesbach G. Fibrodysplasia ossificans progressiva: clinical course, genetic mutations and genotype-phenotype correlation. Mol Syndromol. 2014; 5(5):201-11. [0108] 9. Jiang J X. Posttraumatic stress and immune dissonance. Chin J Traumatol. 2008; 11(4):203-8. [0109] 10. Czura C J, Friedman S G, Tracey K J. Neural inhibition of inflammation: the cholinergic anti-inflammatory pathway. J Endotoxin Res. 2003; 9(6):409-13. [0110] 11. Kan L, Liu Y, McGuire T L, Berger D M, Awatramani R B, Dymecki S M, et al. Dysregulation of local stem/progenitor cells as a common cellular mechanism for heterotopic ossification. Stem Cells. 2009; 27(1):150-6. [0111] 12. Kan L, Mutso A A, McGuire T L, Apkarian A V, Kessler J A. Opioid signaling in mast cells regulates injury responses associated with heterotopic ossification. Inflamm Res. 2014; 63(3):207-15. [0112] 13. Ranganathan K, Agarwal S, Cholok D, Loder S, Li J, Sung Hsieh H H, et al. The role of the adaptive immune system in burn-induced heterotopic ossification and mesenchymal cell osteogenic differentiation. J Surg Res. 2016; 206(1):53-61. [0113] 14. Jung K, Choi I. Emerging Co-signaling Networks in T Cell Immune Regulation. Immune Netw. 2013; 13(5):184-93. [0114] 15. Sperk M, Domselaar R V, Neogi U. Immune Checkpoints as the Immune System Regulators and Potential Biomarkers in HIV-1 Infection. Int J Mol Sci. 2018; 19(7). [0115] 16. Riva A, Chokshi S. Immune checkpoint receptors: homeostatic regulators of immunity. Hepatol Int. 2018. [0116] 17. Cicerone C, Nenna R, Pontone S. Th17, intestinal microbiota and the abnormal immune response in the pathogenesis of celiac disease. Gastroenterol Hepatol Bed Bench. 2015; 8(2):117-22. [0117] 18. Kohn J. Abnormal immune response in burns. Postgrad Med J. 1972; 48(560):335-7. [0118] 19. Jasiulionis M G. Abnormal Epigenetic Regulation of Immune System during Aging. Front Immunol. 2018; 9:197. [0119] 20. Qureshi A T, Dey D, Sanders E M, Seavey J G, Tomasino A M, Moss K, et al. Inhibition of Mammalian Target of Rapamycin Signaling with Rapamycin Prevents Trauma-Induced Heterotopic Ossification. Am J Pathol. 2017; 187(11):2536-45. [0120] 21. Wendel A, Kuesters S, Tiegs G. Ebselenan in vivo immune response modifier. Biomed Environ Sci. 1997; 10(2-3):253-9. [0121] 22. Kan L, Hu M, Gomes W A, Kessler J A. Transgenic mice overexpressing BMP4 develop a fibrodysplasia ossificans progressiva (FOP)-like phenotype. Am J Pathol. 2004; 165(4): 1107-15. [0122] 23. Kan L, Lounev V Y, Pignolo R J, Duan L, Liu Y, Stock S R, et al. Substance P signaling mediates BMP-dependent heterotopic ossification. J Cell Biochem. 2011; 112(10):2759-72. [0123] 24. Kan L, Peng C Y, McGuire T L, Kessler J A. Glast-expressing progenitor cells contribute to heterotopic ossification. Bone. 2013; 53(1):194-203. [0124] 25. Kan C, Chen L, Hu Y, Ding N, Li Y, McGuire T L, et al. Glil-labeled adult mesenchymal stem/progenitor cells and hedgehog signaling contribute to endochondral heterotopic ossification. Bone. 2017. [0125] 26. Kraft C T, Agarwal S, Ranganathan K, Wong V W, Loder S, Li J, et al. Trauma-induced heterotopic bone formation and the role of the immune system: A review. J Trauma Acute Care Surg. 2016; 80(1):156-65. [0126] 27. Kan C, Chen L, Hu Y, Ding N, Lu H, Li Y, et al. Conserved signaling pathways underlying heterotopic ossification. Bone. 2017. [0127] 28. Kan C, Ding N, Yang J, Tan Z, McGuire T L, Lu H, et al. BMP-dependent, injury-induced stem cell niche as a mechanism of heterotopic ossification. Stem Cell Res Ther. 2019; 10(1):14. [0128] 29. Kan L, Kessler J A. Evaluation of the cellular origins of heterotopic ossification. Orthopedics. 2014; 37(5):329-40. [0129] 30. Wang H, Shore E M, Pignolo R J, Kaplan F S. Activin A amplifies dysregulated BMP signaling and induces chondro-osseous differentiation of primary connective tissue progenitor cells in patients with fibrodysplasia ossificans progressiva (FOP). Bone. 2017. [0130] 31. Agarwal S, Loder S J, Cholok D, Peterson J, Li J, Breuler C, et al. Scleraxis-Lineage Cells Contribute to Ectopic Bone Formation in Muscle and Tendon. Stem Cells. 2017; 35(3):705-10. [0131] 32. Kaplan, F. S., Pignolo, R. J. & Shore, E. M. Granting immunity to FOP and catching heterotopic ossification in the Act. Semin. Cell Dev. Biol. 49, 30-36 (2016). [0132] 33. Haupt J, Stanley A, McLeod C M, Cosgrove B D, Culbert A L, Wang L, Mourkioti F, Mauck R L, Shore E M. ACVR1R206H FOP mutation alters mechanosensing and tissue stiffness during heterotopic ossification. Mol Biol Cell. 2019; 30(1):17-29 [0133] 34. Rodenberg E, Azhdarinia A, Lazard Z W, Hall M, Kwon S K, Wilganowski N, et al. Matrix metalloproteinase-9 is a diagnostic marker of heterotopic ossification in a murine model. Tissue Eng Part A (2011) 17:2487-96. 10.1089/ten.tea.2011.00. [0134] 35. Crowgey E L, Wyffels J T, Osborn P M, Wood T T, Edsberg L E. A Systems Biology Approach for Studying Heterotopic Ossification: Proteomic Analysis of Clinical Serum and Tissue Samples. Genomics Proteomics Bioinformatics. 2018 June; 16(3):212-220. [0135] 36. Davis E L, Sonnet C, Lazard Z W, Henslee G, Gugala Z, Salisbury E A, Strecker E V, Davis T A, Forsberg J A, Davis A R, Olmsted-Davis E A. Location-dependent heterotopic ossification in the rat model: The role of activated matrix metalloproteinase 9. J Orthop Res. 2016 November; 34(11):1894-1904. [0136] 37. Meyers C, Lisiecki J, Miller S, Levin A, Fayad L, Ding C, Sono T, McCarthy E, Levi B, James A W. Heterotopic Ossification: A Comprehensive Review. JBMR Plus. 2019; 3(4):e10172. [0137] 38. Levesque J P, Sims N A, Pettit A R, Alexander K A, Tseng H W, Torossian F, Genet F, Lataillade J J, Le Bousse-Kerdils M C. Macrophages Driving Heterotopic Ossification: Convergence of Genetically-Driven and Trauma-Driven Mechanisms. J Bone Miner Res. 2018; 33(2):365-366. [0138] 39. Convente M R, Chakkalakal S A, Yang E, Caron R J, Zhang D, Kambayashi T, Kaplan F S, Shore E M Depletion of Mast Cells and Macrophages Impairs Heterotopic Ossification in an Acvr1R206H Mouse Model of Fibrodysplasia Ossificans Progressiva. J Bone Miner Res. 201833(2):269-282. [0139] 40. Kraft C T, Agarwal S, Ranganathan K, Wong V W, Loder S, Li J, Delano M J, Levi B. Trauma-induced heterotopic bone formation and the role of the immune system: A review. J Trauma Acute Care Surg. 2016 January; 80(1):156-65. [0140] 41. Loder S J, Agarwal S, Chung M T, Cholok D, Hwang C, Visser N, Vasquez K, Sorkin M, Habbouche J, Sung H H, Peterson J, Fireman D, Ranganathan K, Breuler C, Priest C, Li J, Bai X, Li S, Cederna P S, Levi B. Characterizing the Circulating Cell Populations in Traumatic Heterotopic Ossification Am J Pathol. 2018; 188(11):2464-2473.
Example 2Use of an Fetuin-A for the Therapeutic Invention of Heterotopic Ossification
[0141] Abstract
[0142] Heterotopic ossification (HO) is characterized by pathological bone formation outside of the normal skeleton, generally following tissue damage, such as traumatic brain injury, spinal cord injury, total hip arthroplasty, wartime trauma or other traumatic injuries. Following the acute injury, these patients typically develop persistent low-grade inflammation, chronic pain, unhealed wounds, restricted joint movement, nerve entrapment and diminished quality of life. Hereditary HO, such as fibrodysplasia ossificans progressiva (FOP), though rare, is much more devastating and life threatening. HO is a tremendous unmet medical need, because currently there is no decisive treatment. Therapies targeting this disorder have not been successful mainly because of lack of efficient way to control the immune response and the subsequent calcification. For the first time, we characterize the use of Fetuin-A in injury induced HO that specifically corrects the abnormal early injury response and the subsequent HO in an animal model of HO. We believe this invention will have direct clinical implications.
[0143] Applications
[0144] Applications of the disclosed technology may include, but are not limited to: (i) inhibition of heterotopic ossification (HO) in indicated outpatients; and (ii) prevention of potential HO formation that is induced by traumatic injury or surgery intra-operatively or post-operatively, as a phophylaxis, for example, in a medical institution environment.
[0145] Advantages
[0146] Advantages of the disclosed technology may include, but are not limited to: (i) the disclosed methods and compositions utilize Fetuin-A which is a mechanism-based treatment for injury-induced heterotopic ossification (HO); (ii) the disclosed methods of administering Fetuin-A are extremely convenient to perform in the scenarios of traumatic injuries and/or surgeries, as a prophylaxis; and (iii) side-effects of exogenous Fetuin-A have not been observed or reported, and as such, the safety profile of the disclosed methods is extremely favorable.
[0147] Description
[0148] The inventors have used exogenous Fetuin-A to treat and inhibit heterotopic ossification (HO) that has been induced by traumatic injury and to correct an abnormal injury response.
[0149] Introduction
[0150] Heterotopic ossification (HO), acquired or hereditary, is characterized by pathological bone formation outside of the normal skeleton, generally following tissue damage. For example, acquired HO (aHO), is commonly triggered by traumatic brain injury, spinal cord injury, total hip arthroplasty, wartime trauma or other traumatic injuries. The incidence of aHO is relatively high (about 11% in TBI, 20% in SCI, 14-35% after major elbow trauma, and 4.7% after hip arthroscopy). Following the acute injury, these patients typically develop persistent low-grade inflammation, chronic pain, unhealed wounds, restricted joint movement, nerve entrapment and diminished quality of life. Hereditary HO, such as fibrodysplasia ossificans progressiva (FOP), though rare, is much more devastating and life threatening. Notably, even though FOP is caused by gain-of-function mutation of the type 1 bone morphogenetic protein (BMP) receptor, ACVR1 (also known as ALK2), the initiation of the HO process in FOP is similarly triggered by abnormal immune responses to minor injuries (also called flare-up) followed by persistent low grade inflammation. In previous studies we found that both innate immune responses and adaptive immunity play key roles in the pathological process of HO. Similarly, recent studies also have shown that disrupted adaptive immune responses are closely associated with HO formation in mice following burn injury and Achilles tenotomy.
[0151] Multifunctional glycoprotein fetuin-A (FA), also known as 2-HS glycoprotein (AHSG), plays prominent roles in numerous physiological and pathophysiological conditions. The fact that FA-deficient mice develop widespread soft-tissue calcification and have malformed skeleton bones proved the decisive role of FA both in ectopic calcification and skeletal bone formation. In addition, FA is also known to 1) be essential for bone formation and remodeling; 2) be a positive or negative acute phase protein (APP) that plays a pro-inflammatory or anti-inflammatory role, context-dependently; 3) be an important metabolic regulator that might modulate different disease process.
[0152] This study will focus mainly on the role of FA in HO, and the practical goal of this study is to find translatable novel interventions that could be viable prophylaxis and therapy for HO. The central hypothesis is that FA is dysregulated in the context of traumatic injuries, which might contribute to HO through multiple mechanisms, i.e., indirectly, FA dysregulation might precondition the disease process via dysregulating the immunometabolic pathways, which in turn, might directly up-regulate the ossification/osteogenesis process and increase the bone turnover.
[0153] To test this hypothesis and explore potential translational applications, this study 1) first determined that FA is closely associated with HO in the lesional tissues through immunohistochemistry (IHC) approach; 2) clarified FA is a highly specific osteogenic biomarker through detailed co-localization study; 3) confirmed that FA level was downregulated in the context of injury induced HO, and 4), functionally tested that injection of exogenous pure FA could inhibit injury induced HO. Overall, our study strongly suggested that FA may potentially provide a practical therapeutic approach to injury induced HO.
[0154] Results
[0155] FA is specifically associated with HO. We stained the lesional sections of both WT and Nse-BMP4 mice at different stages post injury (p.i.). We found specific FA signals only in the lesional tissues in the sections from Nse-BMP4 mice (
[0156] Co-localization study further suggested that FA is a highly specific ossification biomarker. Double staining of FA with OPN (an acidic bone matrix ECM proteins secreted mainly by osteoblasts), MGP (a calcium-binding bone matrix proteins expressed mainly by chondrocytes), OPG (a secreted TNFR related protein expressed mainly by stromal cells and osteoclasts) and Fibronectin (a high-molecular weight glycoprotein of the ECM expressed mainly by fibroblasts) found that, in both HO and skeletal bone, FA was co-localized extensively with OPN (
[0157] Serum FA level was siginificantly decreased in mouse model of HO. We compared the FA levels in circulation in Nse-BMP4 and WT mice p.i. through ELISA and we found that both the absolute and the adjusted FA concentrations were significantly decreased in the Nse-BMP4 mice with HO, comparing with WT mice with the same injury (
[0158] Gain-of-function (GOF) of FA inhibited both the early tissue swelling and the final HO. To directly test the causal relationship, we performed GOF study of FA by injecting pure FA (20 mg/injection) intraperitoneally twice (one at 1 day p.i. and the other at 1 week after first injection). The weekly X-ray imaging demonstrated that both the early tissue swelling and the late HO formation were dramatically inhibited in FA treated mice, comparing to the control mice treated with PBS (
[0159] Materials and Methods
[0160] Animals and injury models. Nse-BMP4 transgenic mice, described previously, express BMP4 under the control of promoter of neural-specific enolase (Nse). HO was induced by intramuscular injection of cardiotoxin (Sigma), according to previous reports. All animal experiments in this study were approved by the Animal Care and Use Committees of Northwestern University (Protocol: IS00001002).
[0161] IHC. Immunostaining for different markers were performed as previously described. Briefly, sections were pre-fixed with 4% paraformaldehyde in PBS. Nonspecific binding was blocked with 10% normal serum diluted in 1% bovine serum albumin (BSA; Jackson ImmunoResearch Laboratories, West Grove, Pa.) and 0.25% Triton X-100 (Sigma) for 1 h in room temperature. The sections then were incubated with primary antibodies diluted with 1% BSA+0.25% Triton X-100 at 4 C. overnight. After washing, the sections were incubated with appropriate secondary antibodies (Alexa Fluor 488, Alexa Fluor 594 conjugated antibodies, Thermo Fisher Scientific) diluted with 1% BSA+0.25% Triton X-100 in a dark at room temperature for 2 h, and counterstained with 4,6-diamidino-2-phenylindole (1:5000). All fluorescent images were taken using ZEISS Axio Observer (Carl Zeiss, Germany). Signals from all channels were collected separately and overlaid in DPViewer.
[0162] ELISA quantification of FA. ELISA kit from R&D (cat #MFTA00) was used to quantify the expression of FA in serum and tissues of Nse-BMP4 and WT mice 4 weeks p.i., according to the manufacturer's instructions.
[0163] Gain-of-function study of FA. Nes-BMP4 (n=5) and WT (n=4) mice were treated with FA (Fetuin from fetal bovine serum, Sigma, F3004) (20 mg/mouse, 0.2 ml at 100 mg/ml) twice through Intraperitoneal (i.p.) injection starting 1 d (day) p.i, and then a week after first injection; sex and age matched control Nse-BMP4 (n=5) and WT (n=4) mice were treated with PBS on the same schedule.
[0164] The sequence of bovine FA (Bos Taurus) is based on NCBI Reference Sequence: NP_776409.1 (SEQ ID NO:5)
TABLE-US-00002 1 mksfvllfclaqlwgchsipldpvagykepacddpdteqaalaavdyinkhlprgykhtl 61 nqidsvkvwprrptgevydieidtlettchvldptplancsvrqqtqhavegdcdihvlk 121 qdgqfsvlftkcdsspdsaedvrklcpdcpllaplndsrvvhavevalatfnaesngsyl 181 qlveisraqfvplpvsvsvefavaatdciakevvdptkcnllaekqygfckgsviqkalg 241 gedvrvtctlfqtqpvipqpqpdgaeaeapsavpdaagptpsaagppvasvvvgpsvvav 301 plplhrahydlrhtfsgvasvesssgeafhvgktpivgqpsipggpvrlcpgriryfki
[0165] The sequence of mouse FA [Mus musculus] based on NCBI Reference Sequence: NP_038493.1 (SEQ ID NO:6)
TABLE-US-00003 1 mkslvlllcfaqlwgcqsapqgtglgfrelacddpeaeqvallavdylnnhllqgfkqvl 61 nqidkvkvwsrrpfgvvyemevdtlettchaldptplancsvrqltehavegdcdfhilk 121 qdgqfrvmhtqchstpdsaedvrklcprcplltpfndtnvvhtvntalaafntqnngtyf 181 klveisraqnvplpvstlvefviaatdctakevtdpakcnllaekqhgfckanlmhnlgg 241 eevsvacklfqtqpqpananavgpvptanaalpadppasvvvgpvvvprglsdhrtyhdl 301 rhafspvasvesasgetlhspkvgqpgaagpvspmcpgrirhfki
[0166] The sequence of human FA [Homo sapiens] is based on NCBI Reference Sequence: NP 001341500.1 (SEQ ID NO:1)
TABLE-US-00004 1 mkslvlllclaqlwgchsaphgpgliyrqpncddpeteeaalvaidyinqnlpwgykhtl 61 nqidevkvwpqqpsgelfeieidtlettchvldptpvarcsvrqlkehavegdcdfqllk 121 ldgkfsvvyakcdsspadsaedvrkvcqdcpllaplndtrvvhaakaalaafnaqnngsn 181 fqleeisraqlvplppstyveftvsgtdcvakeateaakcnllaekqygfckatlseklg 241 gaevavtcmvfqtqpvssqpqpeganeavptpvvdpdappspplgapglppagsppdshv 301 llaappghqlhrahydlrhtfmgvvslgspsgevshprktrtvvqpsvgaaagpvvppcp 361 grirhfkv
[0167] The rationale for choosing only 2 injections was that, based on the reports, the in vivo half life of FA is about several days, and we expected the early intervention would likely prevent the downstream cascade that eventually cause the HO. X-ray images were took 2, 3, 4 weeks p.i. to determine the HO formation. micro-CT were performed 6 weeks p.i. to quantify the HO volume and density.
[0168] X-ray and micro-CT imaging. For X-ray, mice were anesthetized by 1% pentobarbital (150 l i.p) and the images of radio-opaque HO were acquired by whole body x-ray examination at 38 kv, 28 mA, 30 seconds (Bruker, USA). To quantitatively measure HO volume, micro-CT (PerkinElmer, USA) was used with the setting parameters of 180 rotation, constant 90 kv voltage and voxel size 72 m, and the 3D images were reconstructed by the software package of the system.
[0169] Statistical analyses. Data are reported as meansstandard deviation. Statistical analyses between two groups were performed using Student's t-test via SPSS 16.0 (SPSS Science, Chicago, Ill.); statistical analyses between multiple groups were performed using one-way analysis of variance followed by the least significant difference post hoc test. P<0.05 was considered as statistically significant.
[0170] It will be readily apparent to one skilled in the art that varying substitutions and modifications may be made to the invention disclosed herein without departing from the scope and spirit of the invention. The invention illustratively described herein suitably may be practiced in the absence of any element or elements, limitation or limitations which is not specifically disclosed herein. The terms and expressions which have been employed are used as terms of description and not of limitation, and there is no intention in the use of such terms and expressions of excluding any equivalents of the features shown and described or portions thereof, but it is recognized that various modifications are possible within the scope of the invention. Thus, it should be understood that although the present invention has been illustrated by specific embodiments and optional features, modification and/or variation of the concepts herein disclosed may be resorted to by those skilled in the art, and that such modifications and variations are considered to be within the scope of this invention.
[0171] Citations to a number of patent and non-patent references may be made herein. Any cited references are incorporated by reference herein in their entireties. In the event that there is an inconsistency between a definition of a term in the specification as compared to a definition of the term in a cited reference, the term should be interpreted based on the definition in the specification.