Severe acute respiratory syndrome (SARS)—associated coronavirus diagnostics

10948490 · 2021-03-16

Assignee

Inventors

Cpc classification

International classification

Abstract

The invention relates to the diagnosis of a SARS-associated coronavirus, such as a SARS CoV-2 infection and SARS-CoV infection, using the SARS-CoV and SARS-CoV-2 nucleocapsid proteins and antibodies binding to these proteins. The invention encompasses reagents, methods and kits for the detection of a SARS-associated coronavirus.

Claims

1. A method for the detection of a severe acute respiratory syndrome (SARS) associated coronavirus infection in a biological sample comprising: providing a severe acute respiratory syndrome-associated coronavirus 2 (SARS-CoV-2) nucleocapsid (N) protein expressed and purified from E. coli strain BL21 (DE3) pDIA17 transformed with recombinant plasmid pETM11/N-nCov E. coli 3-(His)6-Nter or pETM11/N-nCov E. coli 4-(His)6-Nter deposited at the Collection Nationale de Cultures de Microorganismes (CNCM) at the Institut Pasteur, 25, Rue du Docteur Roux, 75724 Paris, FR, on May 11, 2020, under the deposit numbers CNCM 1-5510 and CNCM 1-5511, respectively; providing a biological sample from an individual or a patient suspected to be infected with a severe acute respiratory syndrome-associated coronavirus (SARS-CoV) coronavirus; contacting said SARS-CoV-2 N protein with said biological sample; and visualizing the antigen-antibody complexes formed.

2. The method of claim 1, wherein it comprises detection of IgG or IgM or IgA.

3. The method of claim 1, wherein it comprises detection of IgG, IgM and IgA.

4. The method of claim 1, comprising an ELISA, lateral flow immunoassays, bead based immunoassays, or multiplex bead based immunoassays.

5. The method of claim 1, wherein the SARS-CoV-2 N protein comprises the sequence of SEQ ID NO:1.

6. The method of claim 1, wherein the SARS-CoV-2 N protein consists of the sequence of SEQ ID NO:1.

7. A method for the detection of a SARS-associated coronavirus infection in a biological sample comprising: providing a SARS-CoV-1 N protein and a SARS-CoV-2 N protein, wherein said SARS-CoV-2 N protein is expressed and purified from E. coli strain BL21 (DE3) PDIA17 transformed with recombinant plasmid PETM11/N-nCov E. coli 3-(His)6-Nter or pETM11/N-nCov E. coli 4-(His)6-Nter deposited at the Collection Nationale de Cultures de Microorganismes (CNCM) at the Institut Pasteur, 25, Rue du Docteur Roux, 75724 Pars, FR, on May 11, 2020, under the deposit numbers CNCM I-5510 and CNCM 1-5511, respectively: providing a biological sample from an individual or a patient suspected to be infected with a coronavirus: contacting said SARS-CoV-1 N and SARS-CoV-2 N proteins with said biological sample; and visualizing the antigen-antibody complexes formed.

8. The method of claim 7, comprising an ELISA, lateral flow immunoassays, bead based immunoassays, or multiplex bead based immunoassays.

9. The method of claim 7, wherein it comprises detection of IgG or IgM or IgA.

10. The method of claim 7, wherein it comprises detection of IgG, IgM and IgA.

11. A kit for the detection of a SARS-CoV coronavirus infection in a biological sample comprising a SARS-CoV-2 N protein expressed and purified from E. coli BL21 (DE3) pDIA17 transformed with recombinant plasmid pETM11/N-nCov E. coli 3-(His)6-Nter or pETM11/N-nCov E. coli 4-(His)6-Nter deposited at the Collection Nationale de Cultures de Microorganismes (CNCM) at the Institut Pasteur, 25, Rue du Docteur Roux, 75724 Paris, FR, on May 11, 2020, under the deposit numbers CNCM 1-5510 and CNCM 1-5511, respectively.

12. The kit of claim 11, comprising serum from an animal immunized with a SARS-CoV-2 N protein.

13. The kit of claim 11, comprising a SARS-CoV-1 N protein.

14. The kit of claim 13, comprising serum from an animal immunized with a SARS-CoV-2 N protein.

15. A method for producing a SARS-CoV-2 N protein comprising the following steps: Culturing a bacterium transformed with a recombinant plasmid encoding for a SARS-CoV-2 N protein deposited at the Collection Nationale de Cultures de Microorganismes (CNCM) at the Institut Pasteur, 25, Rue du Docteur Roux, 75724 Paris, FR, on May 11, 2020, under the deposit number CNCM 1-5510 or the deposit number CNCM 1-5511 in a suitable bacterial growth medium; inducing the production of SARS-CoV-2 N protein; recovering and purifying SARS-CoV-2 N protein.

16. The method of claim 15, wherein recovering of SARS-CoV-2 N protein is performed by pelleting and breakage of bacteria.

17. The method of claim 16, wherein purifying of SARS-CoV-2 N protein is performed by metal chelate affinity chromatography, and/or gel filtration.

18. The method of claim 17, wherein purifying of SARS-CoV-2 N protein is performed by metal chelate affinity chromatography, and/or gel filtration.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1A-E illustrates the purification of the recombinant N protein of SARS-CoV-2. A. SDS PAGE analysis of fractions collected from 1st PURIFICATION STEP: AFFINITY MAC (AKTAPure) according to example 1. Peak of the fractions from A5 to C12 are boxed (Estimated quantity on unicom 162 mg). B to E. 2ND PURIFICATION STEP: Hiload 16/60 Superdex 200 pg column filtration gel according to example 1. Selection of peaks on histograms and integration of peaks for estimation of protein quantity (B and C). SDS-Page Fraction Removal and Deposition on SDS-Page Gel. GEL FILTRATION 3 on AKTA 1 (D). GEL FILTRATION 6 on AKTA 2 (E).

(2) FIG. 2A-B shows the binding on SARS-CoV-2 nucleoprotein (N) of serum and plasma (A) and purified anti-SARS-CoV-2 N polyclonal antibodies (B) from SARS-CoV-2 nucleoprotein (N) immunized alpaca.

(3) FIG. 3A-C shows the comparison of SARS-CoV-2 N and SARS-CoV-1 N indirect ELISA for detection of SARS-CoV-2 infection in patients sera COVID-01 and COVID-02: 2 COVID patients hospitalized with confirmed SARS-CoV 2 infection (severe cases). Sympt-01 to Sympt-20: 20 symptomatic patients with mild COVID-like symptoms, sampled during symptoms or after symptoms disappearance (NOT tested for viral RNA). Neg Ad-01 and Neg Ad-02: 2 prepandemic adults. The assay was performed with various serum dilutions: 1/200 and 1/800 (A); 1/3200 (B): 1/12800 (C).

(4) FIG. 4A-C shows the comparison of SARS-CoV-2 N and SARS-CoV-1 N indirect ELISA for detection of anti-SARS-CoV-1 antibodies. A. Various dilutions of a first rabbit hyperimmune serum against SARS-CoV-1 virions (serum 1 or P36027) were tested with 1 g of SARS-CoV-2 N (N2) or 1 g, 1.5 g or 2 g of SARS-CoV-1 N (N1). B. various dilutions of a second rabbit hyperimmune serum against SARS-CoV-1 virions (serum 2 or P38136)) were tested with 1 g of SARS-CoV-2 N (N2) or 1 g, 1.5 g or 2 g of SARS-CoV-1 N (N1). C. Various dilutions of first serum (S+1) and second (S+2) anti-SARS-CoV-1 were tested with 1 g of SARS-CoV-2 N (N2) or 1 g, 1.5 g or 2 g of SARS-CoV-1 N (N1). Rabbit pre-immune (pi) and anti-HPV E1 (S) sera were used as negative controls.

(5) FIG. 5 shows a whisker-plot of ELISA on IgG specific of N protein of SARS-CoV-2 (Whiskers min max; boxes: 2nd and 3rd quartiles separated by a median).

(6) FIG. 6 shows a whisker-plot of ELISA on IgG specific of S protein of SARS-CoV-2.

(7) FIG. 7 shows the correlation between the titration of IgG specific of N protein of SARS-CoV-2 versus IgG specific of S protein of SARS-CoV-2 in serum from APHP-Cochin (n=20) and EFS (n=4).

(8) FIG. 8 shows the correlation between the titration of IgG specific of N protein of SARS-CoV-1 versus IgG specific of N protein of SARS-CoV-2 in serum from APHP-Cochin (n=20) and EFS (n=4).

(9) FIG. 9 shows the correlation between the titration of IgG specific of N protein of SARS-CoV-2 in the quick test (5 min) versus the routine test (120 min)-mean of the values in duplicate.

DETAILED DESCRIPTION OF THE INVENTION

(10) The invention encompasses compositions, kits, uses, and methods for the detection and diagnosis of SARS CoV-2 and SARS and SARS-CoV-2 and SARS infections.

(11) The indirect ELISA test was used with serum from COVID-19 patients with confirmed infections, as well as from various symptomatic patients (untested for SARS CoV-2 RNA) and presumptively negative patients.

(12) The test was able to detect anti-SARS CoV-2 antibodies in the serum of all of COVID-19 patients with confirmed infections, as well as in the serum of many of the symptomatic patients (untested for SARS CoV-2 RNA). Anti-SARS CoV-2 antibodies were not detected in the serum of presumptively negative patients. These experiments showed that the N protein of SARS-CoV (N_SARS1) was able to bind to antibodies present in the serum of SARS CoV-2 infected individuals. Thus, the antibodies generated against the N protein of SARS CoV-2 (N_SARS2) by the patients could bind to the N_SARS1 protein. This allows the use of the N_SARS1, for example using an indirect ELISA, for the detection of SARS CoV-2 via immunoassay.

(13) The N_SARS2 protein of SARS CoV-2 was produced recombinantly in E. coli strain BL21 (DE3) pDIA17. To achieve expression. DNA encoding the N_SARS2 was codon optimized for expression in bacteria and modified to express a Hiss N-terminal label. The DNA was transformed into E. coli and the protein produced was purified using a nickel column.

(14) An indirect ELISA was used to compare plates coated with N_SARS2 to plates coated with N_SARS1 using serum from COVID-19 patients with confirmed infections, as well as from various symptomatic patients (untested for SARS CoV-2 RNA) and presumptively negative patients. Both N_SARS2 and N_SARS1 were able to detect anti-SARS CoV-2 antibodies in the serum of all of COVID-19 patients with confirmed infections, as well as in the serum of many of the symptomatic patients (untested for SARS CoV-2 RNA). Anti-SARS CoV-2 antibodies were not detected in the serum of presumptively negative patients. The difference between the two proteins was an increased sensitivity with the N_SARS2 protein (about 25%). These results were surprising.

(15) Rabbit hyper immune serum against N_SARS1 and N_SARS2 proteins was generated. Rabbit hyper immune serum against N_SARS1 and N_SARS2 proteins could bind to both the N_SARS1 and N_SARS2 proteins.

(16) Alpaca were immunized with N_SARS2. Binding of plasma and serum VHH from the immunized alpaca to N_SARS2 protein was also detected.

(17) These results allow for the use of the N_SARS1 and N_SARS2 proteins and antibodies generated against these proteins for the detection of SARS-CoV and SARS CoV-2 via immunoassay. The high correlation of immunoassay tests with N_SARS1 and N_SARS2 proteins with low cross-reactivity and high sensitivity indicates that these proteins can be used for immunodiagnostics of patients with of SARS-CoV and SARS CoV-2. The invention provides expression vectors, proteins, antibodies, and methods and kits containing these reagents.

(18) Expression Vectors

(19) The invention encompasses a recombinant vector for expression of N protein of SARS-CoV or of N protein of SARS-CoV-2. The recombinant vector can be a vector for eukaryotic or prokaryotic expression, such as a plasmid, a phage for bacterium introduction, a YAC able to transform yeast, a viral vector and especially a retroviral vector, or any expression vector. An expression vector as defined herein is chosen to enable the production of an N protein or polyepitope, either in vitro or in vivo.

(20) Preferably, the expression vector expressing the N_SARS1 protein is one of the expression vectors described in U.S. Pat. No. 8,343,718, which is hereby incorporated by reference.

(21) In one embodiment, the recombinant vector expressing the N_SARS1 protein comprises an N cDNA cloned into the Expression Vector pIVEX2.3 or pIVEX2.4, as described in U.S. Pat. No. 8,343,718.

(22) In one embodiment, the expression vector is pIV2.3N, particularly as contained in the bacteria transformed with pIV2.3N. These bacteria pIV2.3N/DH5|alpha| were deposited under the terms of the Budapest Treaty at the Collection Nationale de Culture de Microorganismes (CNCM) on Oct. 23, 2003, under the number I-3117.

(23) In one embodiment, the recombinant vector for expression of N-SARS2 is pETM11/N-nCov E. coli 3-(His)6-Nter as contained in the bacteria strain Bacterium_N-Cov_Ecoli_PETM11_coli3 deposited at the CNCM on May 11, 2020, under the number I-5510. In another embodiment, the recombinant vector for expression of N-SARS2 is pETM11/N-nCov E. coli 4-(HIS)6-Nter as contained in the bacteria strain Bacterium_N-Cov_Ecoli_PETM11_coli4 deposited at the CNCM on May 11, 2020, under the number I-5511.

(24) In one embodiment, the expression vector encodes a protease cleavage site, such as TEV cleavage site, inserted between N protein coding sequence and a protein purification Tag, such as polyHis tag. In a preferred embodiment, the expression vector encodes a His tag. In one embodiment, a protease cleavage site is positioned to remove the His tag, for example, after purification.

(25) The expression vector can comprise transcription regulation regions (including promoter, enhancer, ribosome binding site (RBS), polyA signal), a termination signal, a prokaryotic or eukaryotic origin of replication and/or a selection gene. The features of the promoter can be easily determined by the man skilled in the art in view of the expression needed, i.e., constitutive, transitory or inducible (e.g. IPTG), strong or weak, tissue-specific and/or developmental stage-specific promoter. The vector can also comprise sequence enabling conditional expression, such as sequences of the Cre/Lox system or analogue systems.

(26) In various embodiments, the expression vector is a plasmid, a phage for bacterium introduction, a YAC able to transform yeast, a viral vector, or any expression vector. An expression vector as defined herein is chosen to enable the production of a protein or polyepitope, either in vitro or in vivo.

(27) The nucleic acid molecules according to the invention can be obtained by conventional methods, known per se, following standard protocols such as those described in Current Protocols in Molecular Biology (Frederick M. AUSUBEL, 2000, Wiley and son Inc., Library of Congress, USA). For example, they may be obtained by amplification of a nucleic sequence by PCR or RT-PCR or alternatively by total or partial chemical synthesis.

(28) The vectors are constructed and introduced into host cells by conventional recombinant DNA and genetic engineering methods which are known per se. Numerous vectors into which a nucleic acid molecule of interest may be inserted in order to introduce it and to maintain it in a host cell are known per se; the choice of an appropriate vector depends on the use envisaged for this vector (for example replication of the sequence of interest, expression of this sequence, maintenance of the sequence in extrachromosomal form or alternatively integration into the chromosomal material of the host), and on the nature of the host cell.

(29) N_SARS1 & N_SARS2 Proteins

(30) Preferably, the N_SARS2 protein comprises the amino acid sequence of the SARS CoV-2 protein of GenBank/NCBI accession number QHO62884.1 accessed on Jul. 29, 2020, which is hereby incorporated by reference.

(31) Preferably, the N_SARS1 protein comprises the amino acid sequence of the SARS-CoV N protein of GenBank/NCBI accession number NP_828858.1 accessed on Jun. 2, 2020 or YP_009825061.1 accessed on Jul. 18, 2020, which is hereby incorporated by reference.

(32) Preferably, the N_SARS2 protein comprises the following amino acid sequence.

(33) TABLE-US-00001 (SEQIDNO:1) 1MKHHHHHHPMSDYDIPTTENLYFQGAMSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSG 61ARSKQRRPQGLTNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRI 121RGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANN 181AAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNG 241GDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAF 301GRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYT 361GAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVLL 421LPAADLDDFSKQLQQSMSSADSTQA**.

(34) Preferably, the N_SARS1 protein is one of the N proteins described in U.S. Pat. No. 8,343,718, particularly SEQ ID NO:37, which is hereby incorporated by reference.

(35) In one embodiment, the N_SARS1 protein is produced by bacteria pIV2.3N/DH5|alpha| transformed with pIV2.3N, which were deposited under the terms of the Budapest Treaty at the Collection Nationale de Culture de Microorganismes (CNCM) on Oct. 23, 2003, under the number I-3117. The address of CNCM is: Collection Nationale de Culture de Microorganismes, Institut Pasteur, 28 rue du Dr Roux, 75724 Paris CEDEX 15, France.

(36) In one embodiment, the N_SARS2 protein is produced by bacteria transformed with the expression vector pETM11/N-nCov E. coli 3-(His)6-Nter or with the expression vector pETM11/N-nCov E. coli 4-(His)6-Nter. These two strains (Bacterium_N-Cov_Ecoli_PETM11_coli3 and Bacterium_N-Cov_Ecoli_PETM11_coli4) were deposited under the terms of the Budapest Treaty at the Collection Nationale de Culture de Microorganismes (CNCM) on May 11, 2020, under the numbers I-5510 and I-5511 respectively.

(37) In one embodiment the expression vector is contained within one of the following bacterial strains:

(38) Escherichia coli B BL21 (DE3) pDIA17 pLA13 (insert:NAD kinase Bacillus subtilis): I-2722

(39) Escherichia coli B BL21 (DE3) pDIA17 pLA134 (insert:NAD kinase Bacillus subtilis): I-2723

(40) Escherichia coli B BL21 (DE3) pDIA17 pLA63 (insert:NAD kinase Neisseria meningitidis NMA): I-2724

(41) Escherichia coli B BL21 (DE3) pDIA17 pLA634 (insert:NAD kinase Neisseria meningitidis NMA): I-2725

(42) Escherichia coli B BL21 (DE3) pDIA17 pLA131 (insert:NAD kinase Bacillus subtilis): I-2830.

(43) These strains were deposited under the terms of the Budapest Treaty at the Collection Nationale de Culture de Microorganismes (CNCM) on Oct. 9, 2001, under the numbers I-2722, I-2723, I-2724, and I-2725 on 9 Oct. 2001 and I-2830 on 2 Apr. 2002.

(44) The invention encompasses isolated or purified N_SARS1 & N_SARS2 proteins. The terms isolated or purified mean modified by the hand of humans from the natural state: in other words if an object exists in nature, it is said to be isolated or purified if it is modified or extracted from its natural environment or both. For example, a polynucleotide or a protein/peptide naturally present in a living organism is neither isolated nor purified: on the other hand, the same polynucleotide or protein/peptide separated from coexisting molecules in its natural environment, obtained by cloning, amplification and/or chemical synthesis is isolated for the purposes of the present invention. Furthermore, a polynucleotide or a protein/peptide which is introduced into an organism by transformation, genetic manipulation or by any other method, is isolated even if it is present in said organism. The term purified as used in the present invention means that the proteins/peptides according to the invention are essentially free of association with the other proteins or polypeptides, as is for example the product purified from the culture of recombinant host cells or the product purified from a non-recombinant source. Various techniques can be used to obtain purified protein according to the invention as for example metal chelate binding chromatography and gel filtration.

(45) Methods for Making N_SARS1 & N_SARS2

(46) Production of the N_SARS1 & N_SARS2 proteins can be achieved by any technique known to the skilled artisan, for example, as detailed in the examples or as described in in U.S. Pat. No. 8,343,718.

(47) In one embodiment, a method for producing SARS-CoV-2 N protein comprises the following steps: Culturing a bacterium transformed with a recombinant plasmid encoding for SARS-CoV-2 N protein deposited at the Collection Nationale de Cultures de Microorganismes (CNCM) at the Institut Pasteur, 25, Rue du Docteur Roux, 75724 Paris. FR, on May 11, 2020, under the deposit number CNCM I-5510 or the deposit number CNCM I-5511 in a suitable bacterial growth medium such as a medium supplemented with kanamycin and chloramphenicol, in particular with 50 microgram/mL kanamycin and 30 microgram/mIL chloramphenicol; inducing the production of SARS-CoV-2 N protein; recovering and purifying SARS-CoV-2 N protein.

(48) Preferably, the bacterium is E. coli.

(49) Preferably, inducing the production of SARS-CoV-2 N protein is performed by adding IPTG.

(50) Preferably, recovering the SARS-CoV-2 N protein is performed by pelleting and breakage of bacteria (bacteria cells). More preferably, recovering the SARS-CoV-2 N protein is performed by pelleting and breakage of bacteria, and further recovering the soluble fraction of broken bacteria.

(51) Preferably, purifying SARS-CoV-2 N protein is performed by metal chelate affinity chromatography, and/or gel filtration.

(52) Preferably, the SARS-CoV-2 N protein made by the method disclosed herein is soluble.

(53) The invention also encompasses an N_SARS2 protein made by the processes disclosed herein, particularly in Example 1.

(54) Antibodies Against N_SARS1 or N_SARS2 (N1 or N2)

(55) In one embodiment, polyclonal or monoclonal antibodies are generated in rabbits or mice.

(56) In one embodiment VHH antibodies are generated, for example in alpaca.

(57) The invention encompasses a polyclonal or monoclonal antibody or fragment thereof directed against N_SARS1 or N_SARS2 protein.

(58) In one embodiment, antibodies can be obtained by immunization of an animal with a N_SARS1 or N_SARS2 protein.

(59) The antibodies can serve as reagents to bind native N_SARS1 & N_SARS2 proteins of patients in immunoassays.

(60) The antibodies can serve as positive control reagents to bind isolated and purified N_SARS1 & N_SARS2 proteins in immunoassays of patients.

(61) The antibodies can be used to determine and adjust the concentration of SARS-CoV-2 N bound to the ELISA plates for serum dilution.

(62) The invention encompasses the polyclonal antibodies, monoclonal antibodies, chimeric antibodies, and fragments thereof (e.g., Fab, Fv, scFv) directed against the N protein.

(63) For the purposes of the present invention, the expression chimeric antibody is understood to mean, in relation to an antibody of a particular animal species or of a particular class of antibody, an antibody comprising all or part of a heavy chain and/or of a light chain of an antibody of another animal species or of another class of antibody.

(64) In some embodiments, purified proteins are used to produce antibodies by conventional techniques. In some embodiments, recombinant or synthetic proteins or peptides are used to produce antibodies by conventional techniques.

(65) Antibodies can be synthetic, semi-synthetic, monoclonal, or polyclonal and can be made by techniques well known in the art. Such antibodies specifically bind to proteins and polypeptides via the antigen-binding sites of the antibody (as opposed to non-specific binding). Purified or synthetic proteins and peptides can be employed as immunogens in producing antibodies immunoreactive therewith. The proteins and peptides contain antigenic determinants or epitopes that elicit the formation of antibodies.

(66) These antigenic determinants or epitopes can be either linear or conformational (discontinuous). Linear epitopes are composed of a single section of amino acids of the polypeptide, while conformational or discontinuous epitopes are composed of amino acids sections from different regions of the polypeptide chain that are brought into close proximity upon protein folding (C. A. Janeway, Jr. and P. Travers, Immuno Biology 3:9 (Garland Publishing Inc., 2nd ed. 1996)). Because folded proteins have complex surfaces, the number of epitopes available is quite numerous; however, due to the conformation of the protein and steric hinderances, the number of antibodies that actually bind to the epitopes is less than the number of available epitopes (C. A. Janeway, Jr. and P. Travers, Immuno Biology 2:14 (Garland Publishing Inc., 2nd ed. 1996)). Epitopes can be identified by any of the methods known in the art Such epitopes or variants thereof can be produced using techniques well known in the art such as solid-phase synthesis, chemical or enzymatic cleavage of a polypeptide, or using recombinant DNA technology.

(67) Antibodies are defined to be specifically binding if they bind proteins or polypeptides with a Ka of greater than or equal to about 10.sup.7 M.sup.1. Affinities of binding partners or antibodies can be readily determined using conventional techniques, for example those described by Scatchard et al., Ann. N.Y. Acad. Sci., 51:660 (1949).

(68) Polyclonal antibodies can be readily generated from a variety of sources, for example, horses, cows, goats, sheep, dogs, chickens, alpaca, camels, rabbits, mice, or rats, using procedures that are well known in the art. In general, a purified protein or polypeptide that is appropriately conjugated is administered to the host animal typically through parenteral injection. The immunogenicity can be enhanced through the use of an adjuvant, for example, Freund's complete or incomplete adjuvant. Following booster immunizations, small samples of serum are collected and tested for reactivity to proteins or polypeptides. Examples of various assays useful for such determination include those described in Antibodies: A Laboratory Manual, Harlow and Lane (eds.), Cold Spring Harbor Laboratory Press, 1988: as well as procedures, such as countercurrent immuno-electrophoresis (CIEP), radioimmunoassay, radio-immunoprecipitation, enzyme-linked immunosorbent assays (ELISA), dot blot assays, and sandwich assays. See U.S. Pat. Nos. 4,376,110 and 4,486,530.

(69) Monoclonal antibodies can be readily prepared using well known procedures. See, for example, the procedures described in U.S. Pat. Nos. RE 32,011, 4,902,614, 4,543,439, and 4,411,993; Monoclonal Antibodies, Hybridomas. A New Dimension in Biological Analyses, Plenum Press, Kennett, McKeam, and Bechtol (eds.), 1980.

(70) For example, the host animals, such as mice, can be injected intraperitoneally at least once and preferably at least twice at about 3 week intervals with isolated and purified proteins or conjugated polypeptides, for example a peptide comprising or consisting of the specific amino acids set forth above. Mouse sera are then assayed by conventional dot blot technique or antibody capture (ABC) to determine which animal is best to fuse. Approximately two to three weeks later, the mice are given an intravenous boost of the protein or polypeptide. Mice are later sacrificed, and spleen cells fused with commercially available myeloma cells, such as Ag8.653 (ATCC), following established protocols. Briefly, the myeloma cells are washed several times in media and fused to mouse spleen cells at a ratio of about three spleen cells to one myeloma cell. The fusing agent can be any suitable agent used in the art, for example, polyethylene glycol (PEG). Fusion is plated out into plates containing media that allows for the selective growth of the fused cells. The fused cells can then be allowed to grow for approximately eight days. Supernatants from resultant hybridomas are collected and added to a plate that is first coated with goat anti-mouse Ig. Following washes, a label, such as a labeled protein or polypeptide, is added to each well followed by incubation. Positive wells can be subsequently detected. Positive clones can be grown in bulk culture and supernatants are subsequently purified over a Protein A column (Pharmacia).

(71) The monoclonal antibodies of the invention can be produced using alternative techniques, such as those described by Alting-Mees et al., Monoclonal Antibody Expression Libraries: A Rapid Alternative to Hybridomas, Strategies in Molecular Biology 3:1-9 (1990), which is incorporated herein by reference. Similarly, binding partners can be constructed using recombinant DNA techniques to incorporate the variable regions of a gene that encodes a specific binding antibody. Such a technique is described in Larrick et al., Biotechnology, 7:394 (1989).

(72) Antigen-binding fragments of such antibodies, which can be produced by conventional techniques, are also encompassed by the present invention. Examples of such fragments include, but are not limited to, Fab and F(ab)2 fragments. Antibody fragments and derivatives produced by genetic engineering techniques are also provided.

(73) The monoclonal antibodies of the present invention include chimeric antibodies, e.g., humanized versions of murine monoclonal antibodies. Such humanized antibodies can be prepared by known techniques, and offer the advantage of reduced immunogenicity when the antibodies are administered to humans. In one embodiment, a humanized monoclonal antibody comprises the variable region of a murine antibody (or just the antigen binding site thereof) and a constant region derived from a human antibody. Alternatively, a humanized antibody fragment can comprise the antigen binding site of a murine monoclonal antibody and a variable region fragment (lacking the antigen-binding site) derived from a human antibody. Procedures for the production of chimeric and further engineered monoclonal antibodies include those described in Riechmann et al. (Nature 332:323, 1988), Liu et al. (PNAS 84:3439, 1987), Larrick et al. (Bio/Technology 7:934, 1989), and Winter and Harris (TIPS 14:139, May. 1993). Procedures to generate antibodies transgenically can be found in GB 2,272,440, U.S. Pat. Nos. 5,569,825 and 5,545,806.

(74) Antibodies produced by genetic engineering methods, such as chimeric and humanized monoclonal antibodies, comprising both human and non-human portions, which can be made using standard recombinant DNA techniques, can be used. Such chimeric and humanized monoclonal antibodies can be produced by genetic engineering using standard DNA techniques known in the art, for example using methods described in Robinson et al. International Publication No. WO 87/02671; Akira, et al. European Patent Application 0184187; Taniguchi, M., European Patent Application 0171496: Morrison et al. European Patent Application 0173494: Neuberger et al. PCT International Publication No. WO 86/01533: Cabilly et al. U.S. Pat. No. 4,816,567; Cabilly et al. European Patent Application 0125023; Better et al., Science 240:1041 1043, 1988; Liu et al., PNAS 84:3439 3443, 1987; Liu et al., J. Immunol. 139:3521 3526, 1987; Sun et al. PNAS 84:214 218, 1987; Nishimura et al., Canc. Res. 47:9991005, 1987; Wood et al., Nature 314:446 449, 1985: and Shaw et al., J. Natl. Cancer Inst. 80:1553 1559, 1988); Morrison, S. L., Science 229:1202 1207, 1985; Oi et al., BioTechniques 4:214, 1986: Winter U.S. Pat. No. 5,225,539; Jones et al., Nature 321:552 525, 1986; Verhoeyan et al., Science 239:1534, 1988, and Beidler et al., J. Immunol. 141:4053 4060, 1988.

(75) In connection with synthetic and semi-synthetic antibodies, such terms are intended to cover but are not limited to antibody fragments, isotype switched antibodies, humanized antibodies (e.g., mouse-human, human-mouse), hybrids, antibodies having plural specificities, and fully synthetic antibody-like molecules.

(76) In one embodiment, the invention encompasses single-domain antibodies (sdAb), also known as NANOBODIES. A sdAb is a fragment consisting of a single monomeric variable antibody domain that can bind selectively to a specific antigen.

(77) In one embodiment, the sdAbs are from heavy-chain antibodies found in camelids (VHH fragments), or cartilaginous fishes (VNAR fragments), or are obtained by splitting dimeric variable domains into monomers.

(78) Methods for Detection and Diagnosis

(79) The N_SARS2 and N_SARS1 proteins and the peptides derived from these proteins and antibodies generated against them, can be used for the detection and diagnosis of a SARS-associated coronavirus infection (serological diagnosis (detection of specific antibodies) or virological diagnosis (detection of viral nucleocapsid (N) protein), in particular by an immunoassay, such as an immunoenzymatic method (e.g., ELISA).

(80) The invention encompasses methods for identifying a patient infected with a SARS-associated coronavirus, comprising providing a serum sample from the patient, contacting the serum with an N_SARS2 or N_SARS1 protein, and visualizing the antigen-antibody complexes. Preferably, the antigen-antibody complexes are visualized by EIA, ELISA, RIA, or by immunofluorescence. In a preferred embodiment, the SARS-associated coronavirus infection is identified as SARS CoV-2 infection. In some embodiments, the patient has been shown to be infected by SARS-CoV or SARS CoV-2 by a nucleic acid detection test, such as a PCR or other nucleic acid amplification test In some embodiments, the patient has been identified as being infected with a SARS-associated coronavirus, but lacks detection of the virus by PCR or another nucleic acid amplification technique.

(81) The invention encompasses a composition comprising an N_SARS1 protein or the use of an N_SARS1 protein for detection of antibodies against a SARS CoV-2 coronavirus and diagnosis of a SARS CoV-2 coronavirus infection in a biological sample.

(82) The invention encompasses a composition comprising an N_SARS2 protein or the use of an N_SARS2 protein for detection of antibodies against a SARS coronavirus and diagnosis of a SARS coronavirus infection, in a biological sample. Preferably the SARS coronavirus is a SARS CoV-2 coronavirus.

(83) The ability of N_SARS2 to bind with high affinity to antibodies directed against a SARS-CoV allows its use in such methods, particularly for diagnostics of a SARS-CoV infection. Preferably the SARS CoV is a SARS-CoV-1 (SARS-CoV) coronavirus or SARS-CoV-2 coronavirus.

(84) The ability of N_SARS1 to bind with high affinity to anti-SARS CoV-2 antibodies allows its use in such methods, particularly for diagnostics of a SARS CoV-2 infection.

(85) The antibodies and antibody fragments according to the invention, in particular those directed to N_SARS2 and N_SARS1 proteins and the derived peptides, are useful for the direct detection and diagnosis of a SARS-associated coronavirus infection and for the detection of a SARS-CoV in a biological sample; the detection of the N protein of a SARS coronavirus is carried out by an appropriate technique, in particular EIA, ELISA, RIA, immunofluorescence, in a biological sample collected from an individual likely to be infected.

(86) Preferably, the patient has been shown to be infected by SARS-CoV or SARS CoV-2 by a nucleic acid detection test, such as a PCR or other nucleic acid amplification test.

(87) In one embodiment, the invention comprises a method for the detection of a SARS-associated coronavirus, from a biological sample, which method is characterized in that it comprises contacting a biological sample from a patient infected with a SARS-CoV coronavirus with an anti-N_SARS2 antibody, and visualizing the antigen-antibody complexes formed. Preferably, the antigen-antibody complexes are visualized by EIA, ELISA, RIA, or by immunofluorescence.

(88) In one embodiment, the invention comprises a method for the detection of a SARS-associated coronavirus, from a biological sample, which method is characterized in that it comprises contacting a biological sample from a patient infected with a SARS CoV-2 coronavirus with an anti-N_SARS1 antibody, and visualizing the antigen-antibody complexes formed. Preferably, the antigen-antibody complexes are visualized by EIA, ELISA, RIA, or by immunofluorescence.

(89) In one embodiment, the invention comprises a method for the detection of a SARS-associated coronavirus, from a biological sample, which method is characterized in that it comprises contacting a biological sample from a patient infected with a SARS-CoV or SARS CoV-2 coronavirus with an anti-N_SARS2 antibody and an anti-N_SARS1 antibody, and visualizing the antigen-antibody complexes formed. Preferably, the antigen-antibody complexes are visualized by EIA. ELISA, RIA, or by immunofluorescence using a detection reagent.

(90) In one embodiment, the N_SARS2 and N_SARS1 protein is attached to an appropriate support, in particular a microplate or a bead.

(91) In one embodiment, the method comprises bringing a biological sample from a subject, preferably a human, infected with a SARS-CoV or SARS CoV-2 coronavirus into contact with an N_SARS2 and/or N_SARS1 protein, which is attached to an appropriate support, in particular a microplate or bead, to allow binding to occur; washing the support to remove unbound antibodies; adding a detection reagent that binds to the immunoglobulins bound to N_SARS2 and/or N_SARS1 protein; and detecting the N_SARS2 and/or N_SARS1 protein-antibody complexes formed.

(92) In one embodiment, the method for the detection of antibodies directed to a SARS-associated coronavirus in a biological sample comprises providing a N_SARS2 protein: providing a biological sample from a patient infected with a SARS-CoV coronavirus; contacting said N_SARS2 protein with said biological sample; and visualizing the antigen-antibody complexes formed. Preferably, the method comprises an ELISA. Preferably, the N_SARS2 protein comprises or consists of the sequence of SEQ ID NO:1. Preferably the patient is infected with a SARS-CoV-2 coronavirus.

(93) In one embodiment, the method for the detection of antibodies against a SARS-associated coronavirus in a biological sample comprises providing a N_SARS1 protein; providing a biological sample from a patient infected with a SARS CoV-2 coronavirus; contacting said N_SARS1 protein with said biological sample: and visualizing the antigen-antibody complexes formed. Preferably, the method comprises an ELISA.

(94) Preferably, the protein-antibody complexes are detected with an antibody or an antibody fragment that binds to human immunoglobulins.

(95) Preferably, the detection reagent comprises a label is selected from a chemiluminescent label, an enzyme label, a fluorescence label, and a radioactive (e.g., iodine) label. Most preferably, the detection reagent is a labeled antibody or antibody fragment that binds to human immunoglobulins.

(96) Preferred labels include a fluorescent label, such as FITC, a chromophore label, an affinity-ligand label, an enzyme label, such as alkaline phosphatase, horseradish peroxidase, luciferase or galactosidase, an enzyme cofactor label, a hapten conjugate label, such as digoxigenin or dinitrophenyl, a Raman signal generating label, a magnetic label, a spin label, an epitope label, such as the FLAG or HA epitope, a luminescent label, a heavy atom label, a nanoparticle label, an electrochemical label, a light scattering label, a spherical shell label, semiconductor nanocrystal label, wherein the label can allow visualization with or without a secondary detection molecule.

(97) Preferred labels include suitable enzymes such as horseradish peroxidase, alkaline phosphatase, beta-galactosidase, luciferase or acetylcholinesterase; members of a binding pair that are capable of forming complexes such as streptavidin/biotin, avidin/biotin or an antigen/antibody complex including, for example, rabbit IgG and anti-rabbit IgG; fluorophores such as umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, tetramethyl rhodamine, eosin, green fluorescent protein, erythrosin, coumarin, methyl coumarin, pyrene, malachite green, stilbene, lucifer yellow, Cascade Blue, Texas Red, dichlorotriazinylamine fluorescein, dansyl chloride, phycoerythrin, fluorescent lanthanide complexes such as those including Europium and Terbium, cyanine dye family members, such as Cy3 and Cy5, molecular beacons and fluorescent derivatives thereof, as well as others known in the art; a luminescent material such as luminol: light scattering or plasmon resonant materials such as gold or silver particles or quantum dots; or radioactive material include .sup.14C, .sup.123I, .sup.124I, .sup.125I, .sup.32P, .sup.33P, .sup.35S, or .sup.3H.

(98) In one embodiment, the antibody or an antibody fragment that binds to human immunoglobulins binds specifically to IgG, IgA, and IgM. In one embodiment, the antibody or an antibody fragment that binds to human immunoglobulins binds specifically to IgG, IgA, or IgM.

(99) The term antibodies is meant to include polyclonal antibodies, monoclonal antibodies, fragments thereof, such as F(ab)2 and Fab fragments, single-chain variable fragments (scFvs), single-domain antibody fragments (VHHs or Nanobodies), bivalent antibody fragments (diabodies), as well as any recombinantly and synthetically produced binding partners.

(100) In a preferred embodiment, the antibody is a VHH, preferably an alpaca serum.

(101) Preferably, the method comprises comparing the results obtained with a patient serum to positive and negative controls.

(102) Positive controls can include: Serum from animals (e.g., rabbit, alpaca, etc.) immunized with N_SARS2 or N_SARS1 protein as described above N_SARS2 or N_SARS1 protein as described above.

(103) The method can comprise the use of N_SARS2 and N_SARS1 proteins to detect novel coronaviruses that do not cross-react with seasonal (non-pathogenic) coronaviruses.

(104) Preferably, the N_SARS2 protein comprises the amino acid sequence of the SARS CoV-2 N protein of GenBank/NCBI accession number QHO62884.1 accessed on Jul. 29, 2020.

(105) Preferably, the N_SARS1 protein comprises the amino acid sequence of the SARS-CoV N protein of GenBank/NCBI accession number NP_828858.1 accessed on Jun. 2, 2020 or YP_009825061.1 accessed on Jul. 18, 2020.

(106) In one embodiment, the N_SARS2 protein comprises or consists of the amino acid sequence of SEQ ID NO:1.

(107) In one embodiment, the N_SARS1 protein is one of the N proteins described in U.S. Pat. No. 8,343,718, particularly that of SEQ ID NO:37.

(108) In one embodiment, the method comprises an immunocapture method.

(109) In one embodiment, the method comprises attaching a first monoclonal or polyclonal antibody or a fragment thereof, directed against the N_SARS2 or N_SARS1 protein (capture antibody), incubating the antibody with a biological sample containing a N_SARS2 or N_SARS1 protein, and detecting the antigen-antibody complexes formed, preferably with a monoclonal antibody (visualizing antibody).

(110) In one embodiment, the biological sample is mixed with the visualizing monoclonal antibody prior to its being brought into contact with the capture antibody. According to one embodiment of said test, the antibody used for the capture of the N_SARS2 protein is the monoclonal antibody mAb87, produced by the hybridoma SRAS N1-87 A13 A16 A24 30 Nov. 2004 deposited at the CNCM on Dec. 1, 2004 under the number I-3328 or the monoclonal antibody mAb86, produced by the hybridoma SRAS N3-86 A17 A1 A1 30 Nov. 2004 deposited at the CNCM on Dec. 1, 2004 under the number I-3329.

(111) In the immunocapture tests according to the invention, it is possible to use, for visualizing the N_SARS2 or N_SARS1 protein, the monoclonal antibody mAb57, produced by the hybridoma SRAS N3-57 A6 A1 A5 30 Nov. 2004 deposited at the CNCM on Dec. 1, 2004 under the number I-3330, said antibody being conjugated with a visualizing molecule or particle.

(112) In accordance with said immunocapture test, a combination of the antibodies mAb57 and mAb87, conjugated with a visualizing molecule or particle, is used for the visualization of the N_SARS2 or N_SARS1 protein.

(113) A visualizing molecule may be a radioactive atom, a dye, a fluorescent molecule, a fluorophore, an enzyme: a visualizing particle may be for example: colloidal gold, a magnetic particle or a latex bead.

(114) The subject of the present invention is also a method for the detection of a SARS-associated coronavirus infection, from a biological sample, by indirect IgG ELISA using the N_SARS2 or N_SARS1 protein, which method is characterized in that the plates are sensitized with an N_SARS2 or N_SARS1 protein solution at a concentration of between 0.5 and 4 g/ml, preferably to 2 g/ml, in a 10 mM PBS buffer pH 7.2, phenol red at 0.25 ml/l.

(115) In one embodiment, microtiter plates are coated by incubation overnight at 4 C. with 5 g/ml of N proteins. Plates are washed with 0.1% Tween 20 in PBS buffer. Serum or purified Igs are diluted in PBS containing 0.5% gelatin and 0.1% Tween. After 1 h incubation at 37 C., plates are washed again. The bound antibodies are detected by adding a rabbit polyclonal anti-IgGs (obtained by immunizing rabbits with IgGs isolated on protein A and protein G columns) followed by Alkaline Phosphatase labeled goat anti-rabbit immunoglobulins. Enzymatic activity is quantified using pNPP (para-NitroPhenylPhosphate, SigmaAldrich) substrate according to the manufacturer's protocol.

(116) According to one variant of the tests for detecting SA RS-associated coronaviruses, these tests combine an ELISA using the N protein, and another ELISA using the S protein.

(117) The subject of the present invention is also an immune complex formed of a polyclonal or monoclonal antibody or antibody fragment as defined above, and of a N_SARS2 or N_SARS1 protein.

(118) Kits Containing N_SARS2 and N_SARS1 Proteins

(119) The invention encompasses a SARS-associated coronavirus detection kit, characterized in that it comprises a N_SARS2 and N_SARS1 protein, as described above, and/or antibodies generated against them.

(120) Preferably, the N_SARS2 protein comprises the amino acid sequence of the SARS CoV-2 N protein of GenBank/NCBI accession number QHO62884.1 accessed on Jul. 29, 2020.

(121) Preferably, the N_SARS1 protein comprises the amino acid sequence of the SARS-CoV N protein of GenBank/NCBI accession number NP_828858.1 accessed on Jun. 2, 2020 or YP_009825061.1 accessed on Jul. 18, 2020.

(122) In one embodiment, the invention comprises a kit for the detection of a SARS-CoV coronavirus infection, which kit contains a N_SARS2 protein and reagents for detection of antigen-antibody complexes.

(123) Preferably, the kit contains a serum of an animal immunized with N_SARS2 and/or N_SARS1 proteins.

(124) Most preferably, the serum is a rabbit or alpaca serum from an animal immunized with N_SARS2 and/or N_SARS1 proteins.

(125) In one embodiment, the invention comprises a kit for the detection of a SARS CoV-2 coronavirus infection, which kit contains a N_SARS1 protein and reagents for detection of antigen-antibody complexes.

(126) Preferably, the kit contains a serum of an animal immunized with N_SARS2 and/or N_SARS1 proteins.

(127) Most preferably, the serum is a rabbit or alpaca serum from an animal immunized with N_SARS2.

(128) Preferably, the kit of the invention comprises an N_SARS2 protein comprising the amino acid sequence of the SARS CoV-2 N protein of GenBank/NCBI accession number QHO62884.1 accessed on Jul. 29, 2020.

(129) Preferably, the kit of the invention comprises an N_SARS1 protein comprising the amino acid sequence of the SARS-CoV N protein of GenBank/NCBI accession number NP_828858.1 accessed on Jun. 2, 2020 or YP_009825061.1 accessed on Jul. 18, 2020.

(130) Preferably, the kit of the invention comprises an N_SARS2 protein that comprises or consists of the amino acid sequence of SEQ ID NO:1.

(131) Preferably, the kit of the invention comprises an N_SARS1 protein that is one of the N proteins described in U.S. Pat. No. 8,343,718, particularly that of SEQ ID NO:37.

(132) In one embodiment, the kit comprises both N_SARS1 and N_SARS2 proteins and an N_SARS1 (N1) and/or N_SARS2 (N2) immune serum.

(133) In one embodiment, the kit is a Simple/Rapid test designed for use where a preliminary screening test result is required. The tests can be a test based on agglutination, immuno-dot, immuno-chromatographic and/or immuno-filtration techniques. Preferably, the test is quick and easy to perform, preferably from about 10 minutes to about 2 hours, and requires little or no additional equipment.

(134) Preferably, the kit can be stored at room temperature for extended period of time.

EXAMPLES

Example 1: Production and Purification of SARS-CoV-1 and SARS-CoV-2 Recombinant N Protein

(135) SARS-CoV-1 recombinant N protein (N_SARS1) was produced using E. coli strain BL21 (DE3) pDIA17 transformed with the expression vector pIV2.3N deposited under at the Collection Nationale de Cultures de Microorganismes (CNCM) at the Institut Pasteur, 25, Rue du Docteur Roux, 75724 Paris, FR, on Oct. 23, 2003, under the deposit number CNCM I-3117 and purified as previously disclosed in U.S. Pat. No. 8,343,718 (see in particular the protocol disclosed in example 2).

(136) cDNAs encoding the native nucleoprotein antigen (N_SARS2) from 2019-nCoV (SARS-CoV-2) was designed base on the Genbank MN908947 sequence publicly available from NBCBI on 20 Jan. 2020. This sequence was then processed to generate an optimized nucleotide sequences for high expression in E coli. Optimization process includes codon adaptation, mRNA de novo synthesis and stability, transcription and translation efficiency. Bsa1 and Xho1/EcoR1/Not1 restriction sites were then added at the 5 and 3 ends, respectively, of the nucleotide sequences. The resulting optimised cDNA named N-Ecoli optimized gene was synthesized. The Bsa1-Xho1 fragment of the N-Ecoli optimized gene has been inserted into Nco1/Xho1-digested pETM-11 vector and the resulting pETM11-Necoli_2019-nCoV (=pETM11/N-nCov E. coli) has been used to produce a fusion polypeptide between the SARS-CoV-2 protein and a N-terminally located poly-histidine tag (6 histidine), separated by a TEV cleavage site.

(137) The resulting His6-N_2019-nCoV (N_SARS2) polypeptide has the sequence:

(138) TABLE-US-00002 (SEQIDNO:1) 1MKHHHHHHPMSDYDIPTTENLYFQGAMSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSG 61ARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRI 121RGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANN 181AAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNG 241GDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAF 301GRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYT 361GAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTL 421LPAADLDDFSKQLQQSMSSADSTQA**

(139) Nucleoprotein coding sequences (WT-CoV-2 SARS DNA and E. coli optimized CoV-2 SARS DNA) are cloned into pETM11 vector (EMBL; Dmmler et al (2005), Microb Cell Fact 13; 4:34) or pIVEX2-3 (Roche vector) vectors. The N-recombinant Nucleoprotein of CoV-2-SARS is produced in E. coli BL21 (DE3) pDA17 as a fusion protein comprising an N- or C-terminal (His).sub.6 polyhistidine label. Concerning the production of N-recombinant Nucleoprotein with a (His).sub.6 N-terminal label, the following recombinant vectors are used for the transformation of E. coli strain BL21 (DE3) pDIA17: pETM11/N-nCov WT4-(His).sub.6-Nter pETM11/N-nCov WT6-(His).sub.6-Nter pETM11/N-nCov E. coli 3-(His).sub.6-Nter pETM11/N-nCov E. coli 4-(His).sub.6-Nter pIVEX/nCov WT-(His).sub.6-Nter Clone 1 pIVEX/nCov WT-(His).sub.6-Nter Clone 2

(140) E. coli strain BL21 (DE3) pDIA17 transformed with recombinant plasmid pETM11/N-nCov E. coli 3-(His).sub.6-Nter or pETM11/N-nCov E. coli 4-(His).sub.6-Nter (Bacterium_N-Cov_Ecoli_PETM11_coli3 and Bacterium_N-Cov_Ecoli_PETM11_coli4) were deposited at the Collection Nationale de Cultures de Microorganismes (CNCM) at the Institut Pasteur, 25, Rue du Docteur Roux, 75724 Paris, FR, on May 11, 2020, under the deposit numbers CNCM 1-5510 and CNCM 1-5511, respectively.

(141) Cultures in Thomson Flasks Shaken in LB Medium (IPTG Induction) and NZytech Medium (Self-Inducible) of E. coli BL21 (DE3) pDIA17 Strains Transformed by the pETM11 Vector or by the pIVEX 2.3 Vector.

(142) The Thomson flasks are 2.5 L notched flasks allowing cultures of 1 litre of medium to be aerated under good aeration conditions in stirrers.

(143) Production in LB Environment (IPTG Induction)

(144) The 4 strains of E. coli BL21 (DE3) pDIA17 transformed by the pETM11 vector (DMSO no. 1535, 1536, 1537, 1538) are spread on an agar LB Petri dish containing 50 g/ml kanamycin and 30 g/ml chloramphenicol. The 2 strains of E. coli BL21 (DE3) pDIA17 transformed by the vector pIVEX2.3 (DMSO n 1539, 1540) are spread on an agar LB Petri dish containing 100 g/ml ampicillin and 30 g/ml chloramphenicol. All plates of LB Agar Petri LB are incubated overnight at 37 C. in an oven.

(145) From each of the 6 Petri LB agar plates are inoculated with a platinum handle, 6 pre-cultures of 500 ml of LB medium in 2.5 L Thomson flasks (LB medium plus antibiotics appropriate to each recombinant vector pETM11 and pIVEX2.3). These pre-cultures are shaken at 180 rpm in a Multitron Infors shaker for 15 h at 30 C.

(146) From the 4 LB pre-cultures of BL21 (DE3) pDIA17 strains transformed by the pETM11 vector (DMSO No. 1535, 1536, 1537, 1538) are seeded at an initial cell density equivalent to DOA600=0.2, cultures of 1 L of LB medium containing 50 g/ml kanamycin and 30 g/ml chloramphenicol.

(147) From the 2 LB pre-cultures of BL21 (DE3) pDIA17 strains transformed by the pIVEX 2.3 vector (DMSO No. 1539, 1540) are seeded at an initial cell density equivalent to DOA600=0.2, cultures of 1 L of LB medium containing 100 g/ml ampicillin and 30 g/ml chloramphenicol.

(148) All these cultures in LB medium are placed under agitation at 180 rpm and 30 C. When the cell density, equivalent to DOA600=0.8 is reached the cultures are induced by addition of 1 mM IPTG and the temperature is maintained at 30 C.

(149) After 2 hours at 30 C. in the presence of the inducer the cultures are stopped. A 10 ml sample of each culture is centrifuged and will be used for analysis on SDS-Page of the total soluble and insoluble protein fractions. The remainder of each culture is centrifuged (15 min at 6000 rpm) and the pellets stored at 80 C.

(150) Production in NZvtech Medium (Self-Inducible)

(151) From the 4 LB pre-cultures of BL21 (DE3) pDIA17 strains transformed by the pETM11 vector (DMSO No. 1535, 1536, 1537, 1538) are seeded at an initial cell density equivalent to DOA600=0.2, 1 L cultures in NZytech (self-inducible) medium containing 50 g/ml kanamycin and 30 g/ml chloramphenicol.

(152) From the 2 LB pre-cultures of BL21 (DE3) pDIA17 strains transformed by the pIVEX 2.3 vector (DMSO No. 1539, 1540) are seeded at an initial cell density equivalent to DOA600=0.2, 1 L cultures in NZytech (self-inducible) medium containing 100 g/ml ampicillin and 30 g/ml chloramphenicol.

(153) Cultures in NZytech medium (self-inducible) are carried out at 37 C. with stirring at 180 rpm.

(154) After 4 hours at 37 C., the cultures are placed at 18 C.

(155) After 15 hours of culture at this temperature of 18 C., the bacterial cultures are stopped. A 10 ml sample of each culture is centrifuged and will be used for analysis on SDS-Page of the total soluble and insoluble protein fractions. The remainder of each culture is centrifuged (15 min at 6000 rpm) and the pellets stored at 80 C.

(156) Cultures in BioPod F200 Microfermenters in High Cell Density HDM Medium (IPTG Induction) of E. coli BL21 (DE3) pDIA17 Strains Transformed by the pETM11 Vector or by the pIVEX 2.3 Vector:

(157) The HDM medium is a complex culture medium developed by our Platform specifically designed for the large production of E. coli biomass in a bioreactor during batch culture. This buffered medium does not require a regulation of the pH value in culture.

(158) Microfermenters are miniaturized bioreactors allowing to realize 100 ml cultures in high density medium (HDM medium). These micro-fermenters are equipped with mass flow meters and sinter allowing a very efficient micro-bubbling by air progressively enriched with oxygen according to the bacterial growth. These bioreactors are also equipped with Peltier system and PT1000 probe which allow a very reliable regulation of the growth temperature and fast passages from 37 C. to 16 C. during the induction phase. This system of miniaturized bioreactors is a tool for optimizing the culture conditions allowing with a high rate of reliability a scale-up of 100 ml cultures to larger volume reactors (4 L and 16 L in our Platform).

(159) The 2 strains of E. coli BL21 (DE3) pDIA17 transformed by the pETM11 vector (DMSO n 1535 and 1537) are spread on an agar LB Petri dish containing 50 g/ml kanamycin and 30 g/ml chloramphenicol.

(160) The 2 strains of E. coli BL21 (DE3) pDIA17 transformed by the vector pIVEX2.3 (DMSO no. 1539, 1540) are spread on an agar LB Petri dish containing 100 g/ml ampicillin and 30 g/ml chloramphenicol. All LB agar plates are incubated overnight at 37 C. in an oven.

(161) About 1.5 ml of antibiotic-free LB medium is deposited on each of the agar plates. The bacterial mat of each LB plate is scraped off with a sterile rake. Each bacterial suspension collected is used to inoculate a micro-fermentor containing 100 ml of HDM medium plus antibiotics appropriate for E. coli BL21 (DE3) pDIA17 strains transformed by the recombinant pETM11 or pIVEX2.3 vectors. The initial cell density of the bioreactors is equivalent to .sub.A600=0.8 to 1.

(162) The cultures are grown at a temperature of 37 C., and aeration is set at 0.5 WM. When the cell density equivalent to DOA600=18 to 20 is reached, the temperature is lowered to 16 C. and IPTG (1 mM) is added to the cultures.

(163) After 15 hours of culture at 16 C. in the presence of the inducer, the bacterial cultures are stopped. A 1 ml sample of each culture is centrifuged and will be used for analysis on SDS-Page of the total soluble and insoluble protein fractions. The remainder of each culture is centrifuged (15 min at 6000 rpm) and the pellets stored at 80 C.

(164) Purification from pETM11/N-nCov E. coli-(his).sub.6-Nter/NZytech Cultures

(165) Data prot param: MW=48.7 KDa pI=9.9 Ext. coefficient Abs 0.1% (=1 g/l): 0.961
Bacterial Pellet Breakage

(166) Take the 9 g pellet with 50 ml buffer A: 50 mM phosphate, 300 mM NaCl, 20 mM imidazole pH8 with 1 Roche EDTA free protease tablet and 5 l benzonase in the blender/wait incubation at room temperature for approx. 20 min. 1) Cold breaking with the Cell D 1.3 kbar Cell Disrupter. 2) Addition of eNASR A (250 l to 10 mg/ml or 2.5 mg). Incubation at room temperature for about 20 min. 3) Centrifugation 19000 rpm rotor SS341 hour 4 C. 4) Recovery of the soluble fraction=supernatant for affinity purification on nickel resin.
Treatment of the Soluble Fraction

(167) 1st STEP OF PURIFICATION: AFFINITY IMAC (AKTAPure): 1 column Nickel 5 ml 1 New 5 ml Protino Ni-NTA column (Macherey Nagel) mounted on AKTA Pure (room temperature) Washing of the column in .sub.H2O: 10CV Column equilibration buffer: Phosphate 50 mM, NaCl 300 mM, imidazole 20 mM pH8: 10 CV Loading the 60 ml crude extract onto the 5 ml IMAC column at a rate of 1 ml/min with the AKTA pump Flow rate: 1 ml/min Washing with Phosphate buffer 50 mM, NaCl 300 mM, imidazole 20 mM, pH8: 10CV Elution: Elution Buffer Phosphate 50 mM, NaCl 300 mM, imidazole 250 mM pH8 Gradient from 20 to 250 mM imidazole=100% buffer B at 2 ml/min on 10 HP. Fractions of 1.5 ml were recovered Histogram peak integration for protein quantity estimation
Peak of the fractions from A5 to C12, i.e. 48 ml at 3.3 mg/ml. Estimated quantity on unicorn162 mg Fraction analysis at this stage on SDS-Page (FIG. 1A)

(168) TABLE-US-00003 Well 1 2 3 4 5 6 7 8 9 Fraction PM EB FT LAV A5 A6 A8 A10 Al2 Qty 28 l 28 l 28 l 28 l 28 l 28 l 28 l 28 l

(169) TABLE-US-00004 Well 10 11 12 13 14 15 16 17 18 Fraction B4 B6 B8 B12 C3 C6 C9 C12 D5 Qty 28 l 28 l 28 l 28 l 28 l 28 l 28 l 28 l 28l
DO280 nm Measurement at 1/10 of the A5 to C9 Pool

(170) DO280=0.364. For 1 g/l, the OD is 0.96 3.64/0.96=3.7 mg/m. Either for 42 ml: 42 ml3.7 mg/ml=159 mg total

(171) The elution volume will be injected in 85 ml on 2 gel filtration columns with 5 ml loops. The columns are installed on the 2 pure AKTAs.

(172) 4 runs of gel filtration will be performed per column.

(173) 2ND PURIFICATION STEP: Hiload 16/60 Superdex 200 g (120 ml) column filtration gel

(174) Equilibration of the columns with 50 mM Phosphate buffer, 500 mM NaCl pH8

(175) Flow rate 0.5 ml/min

(176) Protein injection with 5 ml and 10 ml loops.

(177) Elution volume for each run 1.4 column volume. Fractions of 1.8 ml.

(178) Selection of peaks on histograms and integration of peaks for estimation of protein quantity (FIGS. 1B and 1C)
SDS-Page Fraction Removal and Deposition on SDS-Page Gel

(179) Gel Filtration 3 on AKTA 1 (FIG. 1D)

(180) TABLE-US-00005 Well 1 2 3 4 5 6 7 8 9 Fraction PM pool 2H1 2H3 2H4 2H5 2H6 2H7 2H8 Qty 28 l 28 l 28 l 28 l 28 l 28 l 28 l 28 l

(181) TABLE-US-00006 Well 10 11 12 13 14 15 16 17 18 Fraction 2H9 2H10 2H11 2H12 3A1 3A5 3A8 3A10 3B1 Qty 28 l 28 l 28 l 28 l 28 l 28 l 28 l 28 l 28 l

(182) Gel Filtration 6 on AKTA 2 (FIG. 1E)

(183) TABLE-US-00007 Well 1 2 3 4 5 6 7 8 9 Fraction pool PM 1H4 1H6 1H7 1H8 1H9 1H10 1H11 Qty 28 l 28 l 28 l 28 l 28 l 28 l 28 l 28 l

(184) TABLE-US-00008 Well 10 11 12 13 14 15 16 17 18 Fraction 1H12 2A1 2A2 2A3 2A4 2A5 2A9 2Al2 2B2 Qty 28 l 28 l 28 l 28 l 28 l 28 l 28 l 28 l 28l

(185) Formation of the Gel Fraction Pool Filtration

(186) GF 1: 1B TO 1B8

(187) GF 2: 2A6 TO 2A12

(188) GF 3: 2H6 TO 2H12

(189) GF 4: 3G6 TO 3G12

(190) GF 5: 1A11 TO 1B6

(191) GF 6: 1H8 TO 2A2

(192) GF 7: 2G5 TO 2G11

(193) GF 8: 3F2 TO 3F8

(194) 280 nm OD measurement of the pool

(195) DO280=0.597. For 1 g/1, the OD is 0.96. 0.597/0.96=0.62 mg/ml. Either for 100 ml: 100 ml0.6 mg/ml=60 mg total

(196) Purification and Storage Balance

(197) N_SARS2 purified protein (concentration 0.62 mg/ml in phosphate 50 mM NaCl 500 mM pH8). Pool gel filtration 80 ml split into 4 parts: 20 ml filtered without antiproteases 37 aliquots of 0.5 ml stored at +4 C. (box in cold room; 20 ml filtered with antiproteases 36 aliquots of 0.5 ml stored at +4 C. (box in cold room); 20 ml unfiltered 40 aliquots of 0.5 ml stored at 80 C. (box in freezer room); 20 ml unfiltered+glycerol 50% final 42 aliquots of 1 ml stored at 20 C. (box in freezer room).

(198) E. coli optimized CoV-2 SARS DNA cloned into pETM-11 expression vector gave highest protein production yields in E. coli. Unexpectedly, the clones pETM11/N-nCov E. coli 3-(His)6-Nter and pETM11/N-nCov E. coli 4-(His)6-Nter were able to achieve high level production without protein aggregation.

Example 2: Preparation of Monospecific Polyclonal Antibodies Directed Against SARS-CoV-1 and SARS-CoV-2 Recombinant N Proteins

(199) The preparation of monospecific polyclonal antibodies directed against SARS-CoV-1 recombinant N protein (N1 protein) has been disclosed previously in U.S. Pat. No. 8,343,718 (see in particular the rabbit immunization protocol disclosed in example 4). Monospecific polyclonal antibodies directed against SARS-CoV-2 recombinant N protein (N2 protein) were prepared in alpaca (Lama pacos) according to the following protocol.

(200) Monospecific polyclonal antibodies directed against SARS-CoV-1 and SARS-CoV-2 recombinant N proteins are useful as positive controls in SARS-CoV immunodiagnostic assays.

(201) 1. Material and Methods

(202) 1.1 Immunization

(203) 125 g of SARS-CoV-2 recombinant Nucleoprotein (N) prepared according to example 1, in a total volume of 250 l was mixed with 250 l of Freund complete adjuvant for the first immunization, and with 250 l of Freund incomplete adjuvant for the following immunizations. One young adult alpaca (Lama pacos) named ANU was immunized at days 1, 19 and 26 with the immunogen. The alpaca was bled at day 33. The immune response was monitored by titration of serum and plasma samples by ELISA on coated Nucleoprotein as disclosed below.

(204) 1.2 Purification of Anti-N Alpaca Polyclonal Antibodies

(205) Five mgs of SARS-CoV-2 recombinant N protein were bound on Cyanogen Bromide-activated sepharose 4B (GE Healthcare Life science) according to the manufacturer's instructions. Twenty ml of plasma were incubated with the beads for 2 hours, the beads were washed extensively with PBS until the OD280=0. Then Glycine/HCl 0.1M pH 2.8 was added and the OD280 was monitored. Each fractions of 1 ml were neutralized with 100 l of Tris 2M. The positive fractions were pooled and dialysed against PBS. An ELISA was performed by coating the Nucleoprotein as disclosed below.

(206) 1.3 ELISA

(207) Microtiter plates were coated by incubation overnight at 4 C. with 5 g/ml of SARS-CoV-2 recombinant N protein. Plates were washed with 0.1% Tween 20 in PBS buffer. Serum or purified Igs were diluted in PBS containing 0.5% gelatin and 0.1% Tween. After 1 h incubation at 37 C., plates were washed again. The bound alpaca antibodies were detected by adding a rabbit polyclonal anti-alpaca IgGs (obtained by immunizing rabbits with alpaca IgGs isolated on protein A and protein G columns) followed by Alkaline Phosphatase labeled goat anti-rabbit immunoglobulins. Enzymatic activity was quantified using pNPP (para-NitroPhenylPhosphate, SigmaAldrich) substrate according to the manufacturer's protocol.

(208) 2. Results

(209) FIG. 2A shows the binding of serum and plasma of alpaca ANU and FIG. 2B the binding of purified anti-N2 polyclonal antibodies on SARS-CoV-2 nucleoprotein (N2 protein). The titer of the serum is very high (about 1/243000) and as low as 4 g of polyclonal Ig can detect the bound SARS-CoV-2 nucleoprotein. The lecture was performed after 15 min.

Example 3: Comparison of SARS-CoV-2 N and SARS-CoV-1 N Indirect ELISA for Detection of SARS-CoV-2 Infection in Patients Sera

(210) 1. Material and Methods

(211) Plates are coated with 50 l of SARS-CoV-2 N protein at 1 g/ml or SARS-CoV-1 N protein at 1 g/ml on PBS1 over-night at 4 C. Plates are washed 4 times with 300 l PBS Tween 0.1% (PBST), blocked with 50 l PBST 3% fat-free milk (PBSTL) for 1 h at 37 C. and blocking solution is removed. 50 l of patient test serum diluted in PBSTL, at varying dilutions (1/200 generally) is then added and incubated for 1 hr at 37 C. Plates are washed 3 times with 300 l PBST. 50 l peroxidase-conjugated anti-human Ig (Ig total, IgG specific, IgM specific or IgA specific) diluted according to manufacturer's instructions in PBSTL is then added and incubated for 1 h at 37 C. Plates are washed 3 times with 300 l PBST. 50 l TMB substrate prepared according to manufacturer's instructions is then added and incubated for 10 minutes RT in the dark. 50 l H3PO4 are then added on the plate are read at 450 nm and 620 nm.

(212) 2. Results

(213) Human serum samples were tested in indirect ELISA using SARS-CoV-2 N protein compared to SARS-CoV-1 N protein.

(214) Tested samples were from the following groups:

(215) 2 COVID patients (COVID-01 and COVID-02): hospitalized patients with confirmed SARS-CoV 2 infection (severe cases) 20 symptomatic (Sympt-01 to Sympt-20): patients with mild COVID-like symptoms, sampled during symptoms or after symptoms disappearance (NOT tested for viral RNA) 2 prepandemic adults (Neg Ad-01 and Neg Ad-02).

(216) Various serum dilutions were tested (1/200; 1/800; 1/3200; 1/12800).

(217) The results presented in FIG. 3A to 3C show that both SARS-CoV-2 N and SARS-CoV-1 N can detect SARS-CoV 2 infection with good sensitivity and specificity in patients with mild or severe SARS CoV-2 infection. SARS-CoV-1 N which has already been confirmed to have no cross reactivity with other seasonal coronaviruses is unexpectedly able to cross react with serum of patients with mild or severe SARS-CoV-2 (COVID) infection.
The robustness of the indirect ELISA assay was confirmed using SARS-CoV-2 N protein on cohorts of 180 COVID patients and 200 negative individuals (Table 1).

(218) TABLE-US-00009 TABLE 1 Indirect ELISA assay using SARS-CoV-2 N on COVID patients cohort Positivity Percentile threshold negative Negative > Patients > (OD) cohort threshold threshold 1.788 99% 2 (1%) 139 (76%) 0.97 95%-96% 9 (4%) 147 (80%) Number of 203 183 tested sera

(219) The indirect ELISA assays allows the detection of 80% of the COVID patients with a good specificity.

Example 4: Comparison of SARS-CoV-2 N and SARS-CoV-1 N Indirect ELISA for Detection of Anti SARS-CoV-1 Antibodies

(220) Rabbit hyperimmune monospecific polyclonal antibodies directed against SARS-CoV-1 virions were tested in the indirect ELISA assay disclosed in example 3 using 1 g/ml, 1.5 g/ml or 2 g/ml of SARS-CoV-1 or 1 g/ml of SARS-CoV-2 recombinant N protein. The results presented in FIGS. 4A to 4C shows that SARS-CoV-2 N is unexpectedly able to cross react with 10 anti SARS-CoV-1 antibodies and can detect anti SARS-CoV-1 antibodies with a good sensitivity and a good specificity.

Example 5: Detection of IgG Specific of Protein N and S of SARS-CoV-2 by IgG Luciferase Immunosorbent Assay Protocol

(221) White 96- or 384-well plates with flat bottom (Fluoronunc C96 Maxisorp, Nunc) were coated by adsorption with either 1 g/mL of Nucleoprotein produced as in Example 1, or Spike protein, in 50 L/well of phosphate buffer saline pH 7.4 (Sigma) for 2 hours at room temperature or overnight at 4 C. Adsorption on Maxisorp plates favours charge interaction. Alternatives to adsorption are covalent binding of targets through carboxylic, amine or sulfhydryl moieties or glycosylation at the functionalized well surface or coating with poly-lysine. Wells were emptied eventually but not necessarily neutralize with BSA (1 mg/mL) or skimmed milk 3%. Wells were washed 3 to 6 times with 100 L of PBS/Tween 20 0.1%. Dilutions of serum (typically 1/200), plasma or body fluid were incubated from 30 min to 1 hour at room temperature in their respective antigen-coated wells, 50 L/well in phosphate buffer saline with eventually skimmed milk 3%, bovine serum albumin 1 mg/mL, bovine serum 1-3% and/or Tween 20 0.1%. Wells were washed three to six times with 100 L PBS/Tween 20 0.1%. Purified anti-IgG nanobody-nanoKAZ fusion protein at 1 ng/mL (5.107 RLU.s-1.mL-1) in phosphate buffer saline with eventually skimmed milk 3%, bovine serum albumin 1 mg/mL or bovine serum 1-3% and/or Tween 20 0.1%, was loaded (50 L/well) and incubated 20-30 min at room temperature. Wells were washed four times with 100 L of PBS/Tween 20 0.1%. Plates can be stored at this step in PBS until measurements. Just before reading, each wells were emptied and loaded with 50 L of furimazine (8-benzyl-2-(furan-2-ylmethyl)-6-phenylimidazo[1,2-a]pyrazin-3(7H)-one) at 27 M. The plate was orbitally shaked for 5 seconds and the light emission intensity was integrated 0.5-1 sec per well using a multi-well plate luminometer (LB960 Centro, Berthold).

(222) IgGs specific of protein N of SARS-CoV-2 have been titrated by luciferase linked immunosorbent assay in serums of the CORSER cohort (n=164; IcareB), in serums of the observation and monitoring protocol of the Intensive Medicine and Resuscitation service of Assistance Publique des Hopitaux de Paris (APHP) Cochin (n=20) in longitudinal follow-up and in serums and plasma of healthy donors of Etablissement Franais du Sang (EFS) sampled in December 2019 (frozen plasmas n=20, frozen serums n=20). Results are shown in FIG. 5.

(223) IgGs specific of protein Spike (S) of SARS-CoV-2 have been titrated in serums from the observation and monitoring protocol of the Intensive Medicine and Resuscitation service of Assistance Publique des Hopitaux de Pans (APHP) Cochin (n=20) and in frozen serums from healthy donors of EFS (n=4). Results are shown in FIG. 6.

(224) The correlation between the titration of IgG specific of protein N of SARS-CoV-2 and IgG specific of protein S of SARS-CoV-2 in serum from APHP-Cochin (n=20) and EFS (n=4) is shown in FIG. 7.

(225) Then it was compared the IgG of serums from patients (APHP-Cochin n=20) and frozen serums of healthy donors (EFS n=4) which were specific for SARS-CoV-1 N protein and SARS CoV-2 N protein. Results are shown in FIG. 8.

(226) An emergency test on a 96 well-plate which may be performed in 5 minutes has been assayed on serum from APHP-Cochin (n=20) and EFS (n=4) in duplicate by reducing the incubations time: 3 minutes for the incubation of sera at room temperature or even better at 37 C., 17 seconds per washing step (plate washer Zoom HT, Berthold) and 1 minute for the incubation of the anti-IgG VHH-nanoKAZ. The coefficient of determination R2 was 0.75. Results are shown in FIG. 9.