INTESTINAL EXPRESSION OF PROGRAMMED DEATH LIGAND 1
20230416337 ยท 2023-12-28
Inventors
- Shauna Marie Dauphinee (Montreal, CA)
- Connor Daniel Alexander McCarthy (Montreal, CA)
- Jeremy Dupaul-Chicoine (Montreal, CA)
- Eric HSU (Vancouver, CA)
- Ghania Chikh (Ottawa, CA)
- Anthony CHEUNG (Montreal, CA)
Cpc classification
A61P1/04
HUMAN NECESSITIES
A61P1/06
HUMAN NECESSITIES
A61P1/00
HUMAN NECESSITIES
A61K31/711
HUMAN NECESSITIES
A61K9/5161
HUMAN NECESSITIES
A61P37/06
HUMAN NECESSITIES
C07K2319/30
CHEMISTRY; METALLURGY
C12Q1/6883
CHEMISTRY; METALLURGY
International classification
C07K14/705
CHEMISTRY; METALLURGY
A61P37/06
HUMAN NECESSITIES
A61P1/04
HUMAN NECESSITIES
A61K31/711
HUMAN NECESSITIES
A61P1/06
HUMAN NECESSITIES
A61P1/00
HUMAN NECESSITIES
Abstract
Provided herein are methods and compositions for the amelioration of inflammatory disorders comprising the intestinal expression of programmed death ligand 1.
Claims
1.-13. (canceled)
14. An expression vector comprising a PD-L1 nucleic acid, wherein the sequence of said PD-L1 nucleic acid comprises at least one synonymous substitution compared to SEQ ID NO: 2 for detection after administration, and preferably a plurality of synonymous substitutions.
15. The expression vector according to claim 14, wherein said PD-L1 nucleic acid sequence is codon-optimized for expression.
16. The expression vector according to claim 14, wherein said PD-L1 nucleic acid further comprises a nucleic acid sequence that encodes a heterologous sequence, preferably wherein said heterologous sequence comprises an Fc domain, a protein tag, a conjugated therapeutic, or a combination thereof.
17. (canceled)
18. The expression vector according to claim 16, wherein said Fc domain comprises a human IgG1 Fc region or a portion thereof.
19. The expression vector according to claim 18, wherein said PD-L1 nucleic acid comprises the sequence of SEQ ID NO: 4 or SEQ ID NO: 3.
20.-24. (canceled)
25. A chitosan derivative nanoparticle comprising an encapsulated expression vector, wherein the expression vector comprises a PD-L1 nucleic acid encoding a human PD-L1 polypeptide for localized intestinal expression of the human PD-L1 polypeptide, wherein the sequence of the PD-L1 nucleic acid comprises a plurality of synonymous substitutions compared to SEQ ID NO 2 for detection after administration.
26. The chitosan derivative nanoparticle of claim 25, comprising chitosan coupled with arginine and a hydrophilic polyol.
27. The chitosan derivative nanoparticle of claim 26, wherein the hydrophilic polyol is glucose.
28. The chitosan derivative nanoparticle of claim 25, wherein the PD-L1 nucleic acid comprises a nucleic acid sequence that is at least about 85% or 95% identical to SEQ ID NO: 3 or about 85% or 95% identical to SEQ ID NO: 4.
29. The chitosan derivative nanoparticle of claim 25, wherein the PD-L1 polypeptide is a soluble human PD-L1 polypeptide comprising or consisting of the IgV domain and the IgC domain of human PD-L1 (amino acids 19-239 of SEQ ID NO: 1).
30. The chitosan derivative nanoparticle of claim 25, wherein the PD-L1 polypeptide is a soluble human PD-L1 polypeptide comprising or consisting of the signal sequence, the IgV domain and the IgC domain of human PD-L1 (amino acids 1-239 of SEQ ID NO: 1).
31. The chitosan derivative nanoparticle of claim 25, wherein the PD-L1 polypeptide is N-terminally fused to a human IgG1 Fc region.
32. The chitosan derivative nanoparticle of claim 31, wherein the PD-L1 polypeptide is fused to the human IgG1 Fc region via an amino acid sequence of (GGGGS)n (SEQ ID NO: 5).
33. The chitosan derivative nanoparticle of claim 31, wherein the human IgG1 Fc is mutated to reduce antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cellular cytotoxicity (CDCC) by altering one or more of the following amino acids in the Fc domain: E233P, L234V, L235A, deletion of G236, A327G, A330S and P331S.
34. The chitosan derivative nanoparticle of claim 33, wherein the PD-L1 nucleic acid comprises the sequence of SEQ ID NO: 4.
35. The chitosan derivative nanoparticle of claim 25, wherein the PD-L1 polypeptide is a membrane-bound PD-L1 polypeptide comprising or consisting of the signal sequence, IgV domain, IgC domain and the transmembrane domain of human PD-L1 (amino acids 1-259 of SEQ ID NO: 1).
36. The chitosan derivative nanoparticle of claim 35, wherein the PD-L1 polypeptide further comprises the cytoplasmic domain of human PD-L1.
37. The chitosan derivative nanoparticle of claim 35, wherein the PD-L1 nucleic acid comprises the sequence of SEQ ID NO: 3.
38. A method for treating an inflammatory disorder in a patient in need thereof, comprising administering the chitosan derivative nanoparticle of claim 25 to the gastrointestinal tract of the patient.
39. The method of claim 38, wherein the inflammatory disorder is selected from the group consisting of inflammatory bowel disease, ulcerative colitis, and Crohns disease.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0015] The present disclosure is disclosed with reference to the accompanying drawings, wherein:
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
DETAILED DESCRIPTION
[0030] The present invention contemplates the intestinal expression of PD-L1 nucleic acids for the treatment of inflammatory disorders.
PD-L1 Proteins and Polynucleotides
[0031] The PD-L1 polypeptides contemplated herein include the full-length sequence, soluble fragments, and variants thereof.
[0032] Full-length PD-L1 proteins generally comprise a signal sequence, an IgV domain, and an IgC domain, a transmembrane domain, and a cytoplasmic domain. The human sequences are available to the public at the GenBank database under NM_014143.3 and NP_054862.1. The sequence of human PD-L1 transcript variant 1 is the canonical sequence, and all positional information described with respect to known isoforms are determined from this sequence. In this isoform, the signal sequence is shown from about amino acid 1 to about amino acid 18, the IgV domain is shown from about amino acid 19 to about amino acid 134, the IgC domain is shown from about amino acid 135 to about amino acid 227, the transmembrane domain is shown from about amino acid 239 to about amino acid 259, and the cytoplasmic domain is shown from about amino acid 260 to about amino acid 290. At least five transcript (i.e., splice) variants encoding different human PD-L1 isoforms are known and are described, e.g. in U.S. Patent Publication No. 2016/0122829, the disclosure of which is expressly incorporated by reference herein.
[0033] Nucleic acid and amino acid sequence information for PD-L1 in multiple species is well known in the art and readily available in public databases, including, for example, monkey PD-L1 (NM 001083889.1 and NP_001077358.1), chimpanzee PD-L1 (XM_0011401705.2 and XP_001140705.1), mouse PD-L1 (NM 021893.3 and NP_068693.1), rat PD-L1 (NM_001191954.1 and NP_001178883.1), chicken PD-L1 (XM_424811.3 and XP_424811.3), cow PD-L1 (NM_001163412.1 and NP_001156884.1), and dog PD-L1 (XM_541302.3 and XP_541302.3).
[0034] The PD-L1 nucleic acids of the subject invention will generally comprise a nucleic acid sequence encoding a human PD-L1 polypeptide, wherein the PD-L1 polypeptide preferably comprises an amino acid sequence of SEQ ID NO: 1 or an amino acid sequence that is at least about 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1, or fragments thereof. In some embodiments, the PD-L1 polypeptide is membrane-bound, i.e. full-length PD-L1 including the transmembrane and cytoplasmic domains. In alternative embodiments, the PD-L1 polypeptide is a soluble PD-L1 polypeptide comprising at least the IgV domain and IgC domains of human PD-L1, and optionally further comprising the signal sequence. In one embodiment, the PD-L1 polypeptide comprises amino acids 1-239 of SEQ ID NO: 1, which corresponds to nucleotides 1-717 of the full-length cDNA sequence. In other embodiments, the soluble PD-L1 polypeptide may lack all or part of the signal sequence (e.g. it may comprise amino acids 19-239 of SEQ ID NO: 1). See, e.g., U.S. Patent Publication No. 2017/0189476, the disclosure of which is expressly incorporated by reference herein.
TABLE-US-00001 TABLE1 AminoAcidsequenceforhumanPD-L1 MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLD LAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAA LQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPV TSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTST LRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTHLVILG AILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET
[0035] In some embodiments, PD-L1 nucleic acid is identical to the native PD-L1 nucleic acid sequence (SEQ ID NO: 2) or a fragment thereof. Preferably, at least one synonymous nucleic acid substitution is made to allow differentiation and detection of the resulting transcript from endogenous human PD-L1 nucleotide following administration of the subject nucleic acids, and still more preferably a plurality of such synonymous mutations are made. In particularly preferred embodiments, the PD-L1 nucleic acid sequence is codon-optimized to improve expression. In an exemplary embodiment, the PD-L1 nucleic acid preferably comprises the nucleic acid sequence of SEQ ID NO: 3 or a sequence that is at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 3.
[0036] In some embodiments, the PD-L1 polypeptides of the subject invention may be fused to an Fc region or portion thereof. In an exemplary embodiment, the PD-L1 nucleic acid comprises the nucleic sequence of SEQ ID NO: 4 or a nucleic acid sequence that is at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 4.
[0037] The PD-L1 nucleic acids of the subject invention may include exons 1-4 in their entirety, as well as the first 35 nucleotides of exon 5. It is noted that the ATG site (start codon) is found at position 13 in exon 2. Therefore, the PD-L1 nucleic acids of the subject invention may include the last 52 nucleotides of exon 2, all of exon 3 and 4, as well as the first 35 nucleotides of exon 5.
TABLE-US-00002 TABLE2 NucleicAcidSequenceforhumanPD-L1 ATGAGGATATTTGCTGTCTTTATATTCATGACCTACTGGCATTTGCTGA ACGCATTTACTGTCACGGTTCCCAAGGACCTATATGTGGTAGAGTATGG TAGCAATATGACAATTGAATGCAAATTCCCAGTAGAAAAACAATTAGAC CTGGCTGCACTAATTGTCTATTGGGAAATGGAGGATAAGAACATTATTC AATTTGTGCATGGAGAGGAAGACCTGAAGGTTCAGCATAGTAGCTACAG ACAGAGGGCCCGGCTGTTGAAGGACCAGCTCTCCCTGGGAAATGCTGCA CTTCAGATCACAGATGTGAAATTGCAGGATGCAGGGGTGTACCGCTGCA TGATCAGCTATGGTGGTGCCGACTACAAGCGAATTACTGTGAAAGTCAA TGCCCCATACAACAAAATCAACCAAAGAATTTTGGTTGTGGATCCAGTC ACCTCTGAACATGAACTGACATGTCAGGCTGAGGGCTACCCCAAGGCCG AAGTCATCTGGACAAGCAGTGACCATCAAGTCCTGAGTGGTAAGACCAC CACCACCAATTCCAAGAGAGAGGAGAAGCTTTTCAATGTGACCAGCACA CTGAGAATCAACACAACAACTAATGAGATTTTCTACTGCACTTTTAGGA GATTAGATCCTGAGGAAAACCATACAGCTGAATTGGTCATCCCAGAACT ACCTCTGGCACATCCTCCAAATGAAAGGACTCACTTGGTAATTCTGGGA GCCATCTTATTATGCCTTGGTGTAGCACTGACATTCATCTTCCGTTTAA GAAAAGGGAGAATGATGGATGTGAAAAAATGTGGCATCCAAGATACAAA CTCAAAGAAGCAAAGTGATACACATTTGGAGGAGACGTAA (SEQIDNO.2)
TABLE-US-00003 TABLE3 CodonOptimizedNucleicAcidSequence ofMembrane-BoundPD-L1 ATGAGAATCTTCGCGGTGTTCATCTTCATGACCTACTGGCACCTCCTGA ACGCTTTCACTGTGACCGTGCCTAAGGACCTCTACGTCGTGGAATACGG CTCCAACATGACCATCGAGTGCAAATTCCCAGTGGAGAAGCAGCTGGAC CTGGCTGCCCTGATCGTGTACTGGGAAATGGAGGACAAGAACATCATCC AATTCGTGCATGGGGAGGAGGACCTGAAGGTCCAGCATTCGTCATATCG GCAAAGAGCCAGGCTGCTGAAGGATCAGCTGTCCCTCGGCAATGCGGCA CTGCAGATTACCGATGTGAAGCTGCAGGACGCCGGAGTCTACCGGTGCA TGATTTCCTACGGCGGAGCAGACTACAAGCGCATTACCGTGAAGGTCAA CGCTCCCTACAACAAGATCAACCAGCGGATTCTGGTGGTCGACCCTGTG ACCTCCGAGCATGAGCTGACCTGTCAAGCCGAAGGTTACCCGAAAGCGG AAGTGATCTGGACGTCGAGCGACCACCAGGTCTTGAGCGGAAAGACGAC CACTACTAACAGCAAGCGGGAAGAGAAACTGTTTAACGTGACCAGCACT CTTCGGATCAACACCACCACTAACGAGATTTTCTACTGTACCTTTCGCC GGCTTGACCCGGAAGAAAATCACACCGCCGAGCTCGTGATCCCCGAGCT GCCCCTCGCCCACCCTCCTAACGAAAGAACCCACCTGGTCATCTTGGGG GCCATCCTGCTGTGCCTGGGAGTGGCCCTGACCTTCATTTTTAGGCTCC GAAAGGGCCGCATGATGGACGTGAAGAAATGCGGAATCCAGGACACTAA CTCCAAGAAGCAGTCCGATACTCACCTGGAAGAAACCTAG (SEQIDNO.3)
TABLE-US-00004 TABLE4 CodonOptimizedNucleicAcidSequenceofSoluble PD-L1FusedWithanFcFragment ATGAGAATCTTCGCGGTGTTCATCTTCATGACCTACTGGCACCTCCTGA ACGCTTTCACTGTGACCGTGCCTAAGGACCTCTACGTCGTGGAATACGG CTCCAACATGACCATCGAGTGCAAATTCCCAGTGGAGAAGCAGCTGGAC CTGGCTGCCCTGATCGTGTACTGGGAAATGGAGGACAAGAACATCATCC AATTCGTGCATGGGGAGGAGGACCTGAAGGTCCAGCATTCGTCATATCG GCAAAGAGCCAGGCTGCTGAAGGATCAGCTGTCCCTCGGCAATGCGGCA CTGCAGATTACCGATGTGAAGCTGCAGGACGCCGGAGTCTACCGGTGCA TGATTTCCTACGGCGGAGCAGACTACAAGCGCATTACCGTGAAGGTCAA CGCTCCCTACAACAAGATCAACCAGCGGATTCTGGTGGTCGACCCTGTG ACCTCCGAGCATGAGCTGACCTGTCAAGCCGAAGGTTACCCGAAAGCGG AAGTGATCTGGACGTCGAGCGACCACCAGGTCTTGAGCGGAAAGACGAC CACTACTAACAGCAAGCGGGAAGAGAAACTGTTTAACGTGACCAGCACT CTTCGGATCAACACCACCACTAACGAGATTTTCTACTGTACCTTTCGCC GGCTTGACCCGGAAGAAAATCACACCGCCGAGCTCGTGATCCCCGAGCT GCCCCTCGCCCACCCTCCTAACGAAAGAACTCCCAAGTCTTGCGATAAG ACCCACACATGCCCGCCATGCCCAGCCCCGCCCGTGGCGGGCCCCTCCG TGTTTCTTTTCCCGCCGAAGCCTAAGGATACCCTGATGATCTCCCGCAC CCCCGAAGTCACTTGTGTGGTGGTGGACGTCAGCCACGAAGATCCGGAA GTCAAGTTCAATTGGTACGTGGACGGGGTCGAAGTGCACAACGCCAAGA CCAAGCCCCGCGAGGAACAGTACAACTCAACGTACCGGGTGGTGTCCGT GCTGACCGTGCTGCATCAGGACTGGCTGAACGGAAAGGAGTACAAGTGC AAAGTGTCCAACAAGGGACTGCCGAGCTCGATCGAAAAGACCATTTCGA AGGCCAAGGGGCAGCCTAGGGAGCCACAGGTCTATACCCTCCCGCCCTC ACGAGATGAACTGACCAAGAACCAAGTGTCATTGACTTGCCTCGTGAAG GGCTTCTACCCTTCCGACATCGCCGTGGAATGGGAATCCAACGGACAGC CGGAGAACAACTACAAGACTACTCCGCCCGTGCTTGACTCCGACGGTTC GTTCTTCCTGTACTCCAAGCTGACCGTGGATAAGTCCCGCTGGCAACAG GGCAACGTGTTCTCCTGCTCCGTGATGCACGAAGCCCTGCACAACCACT ACACCCAGAAGTCCCTCTCGTTGAGCCCTGGAAAATAG (SEQIDNO.4)
[0038] There is a known and definite correspondence between the amino acid sequence of a particular protein and the nucleotide sequences that can code for the protein, as defined by the genetic code. Likewise, there is a known and definite correspondence between the nucleotide sequence of a particular nucleic acid and the amino acid sequence encoded by that nucleic acid, as defined by the genetic code.
TABLE-US-00005 TABLE3 GENETICCODE Alanine(Ala,A)GCA,GCC,GCG,GCT Arginine(Arg,R)AGA,ACG,CGA,CGC,CGG,CGT Asparagine(Asn,N)AAC,AAT Asparticacid(Asp,D)GAC,GAT Cysteine(Cys,C)TGC,TGT Glutamicacid(Glu,E)GAA,GAG Glutamine(Gln,Q)CAA,CAG Glycine(Gly,G)GGA,GGC,GGG,GGT Histidine(His,H)CAC,CAT Isoleucine(Ile,I)ATA,ATC,ATT Leucine(Leu,L)CTA,CTC,CTG,CTT,TTA,TTG Lysine(Lys,K)AAA,AAG Methionine(Met,M)ATG Phenylalanine(Phe,F)TTC,TTT Proline(Pro,P)CCA,CCC,CCG,CCT Serine(Ser,S)AGC,AGT,TCA,TCC,TCG,TCT Threonine(Thr,T)ACA,ACC,ACG,ACT Tryptophan(Trp,W)TGG Tyrosine(Tyr,Y)TAC,TAT Valine(Val,V)GTA,GTC,GTG,GTT
[0039] An important and well known feature of the genetic code is its redundancy, whereby, for most of the amino acids used to make proteins, more than one coding nucleotide triplet may be employed. Therefore, a number of different nucleotide sequences may code for a given amino acid sequence. Such nucleotide sequences are considered functionally equivalent since they result in the production of the same amino acid sequence in all organisms (although certain organisms may translate some sequences more efficiently than they do others). Moreover, occasionally, a methylated variant of a purine or pyrimidine may be found in a given nucleotide sequence. Such methylations do not affect the coding relationship between the trinucleotide codon and the corresponding amino acid.
[0040] In view of the foregoing, the nucleotide sequence of a DNA or RNA coding for a fusion protein or polypeptide of the invention (or any portion thereof) can be used to derive the fusion protein or polypeptide amino acid sequence, using the genetic code to translate the DNA or RNA into an amino acid sequence. Likewise, for a fusion protein or polypeptide amino acid sequence, corresponding nucleotide sequences that can encode the fusion protein or polypeptide can be deduced from the genetic code (which, because of its redundancy, will produce multiple nucleic acid sequences for any given amino acid sequence). Thus, description and/or disclosure herein of a polynucleotide sequence which encodes a fusion protein or polypeptide should be considered to also include description and/or disclosure of the amino acid sequence encoded by the nucleotide sequence. Similarly, description and/or disclosure of a fusion protein or polypeptide amino acid sequence herein should be considered to also include description and/or disclosure of all possible nucleotide sequences that can encode the amino acid sequence.
[0041] In some embodiments, the PD-L1 proteins of the present invention do not contain the signal sequence as such a sequence is usually cleaved prior to secretion of the polypeptide from the cell. In other embodiments, the PD-L1 proteins are soluble, i.e. consist of the IgV domain and the IgC domain (i.e., the extracellular portion of the full-length, membrane-bound PD-L1) and can further comprise heterologous sequences, such as Fc domains, protein tags, conjugated therapeutics, and the like. Such soluble PD-L1 isoforms can be generated by alternative splicing in a number of ways well known to the skilled artisan.
[0042] In preferred embodiments, the soluble PD-L1 comprises the elimination of part of exon 5 and the entirety of exons 6 and 7 of full-length, membrane-bound PD-L1 cDNA, as illustrated in
Nucleic Acid Delivery Vehicles
[0043] Administration of an expression vector comprising a PD-L1 nucleic acid so as to achieve effective intestinal expression can be accomplished using any method known in the art. In preferred embodiments, administration of the subject nucleic acid delivery vehicles is localized to the gut (i.e. not systemically administered). In one embodiment, the nucleic acid delivery vehicle comprises a viral vector. In another embodiment, the nucleic acid delivery vehicle comprises a cationic liposome. In preferred embodiments, the nucleic acid delivery vehicle comprises chitosan. In alternative embodiments, biological gene delivery vehicles (BGV) are used such as, e.g., gut bacteria, bacteriophage, virus-like particles, biological liposomes, or the like, to deliver a PD-L1 polynucleotide to gut epithelium. For a review of BGVs currently under investigation, see Seow and Wood, Biological Gene Delivery Vehicles Beyond Viral Vectors, Molecular Therapy 17:767-777 (2009), the contents of which are herein incorporated in their entirety.
[0044] In particular embodiments, the nucleic acid delivery vehicle comprises a chitosan derivative, e.g., a chitosan that incorporates an additional functionalization, e.g., with an attached ligand. Chitosan as used herein will be understood to include the broad category of chitosan-based polymers comprising covalently modified N-acetyl-D-glucosamine and/or D-glucosamine units, as well as chitosan-based polymers incorporating other units, or attached to other moieties. Derivatives are frequently based on a modification of the hydroxyl group or the amine group of glucosamine, such as done with arginine-functionalized chitosan. Examples of chitosan derivatives include, but are not limited to, trimethylated chitosan, PEGylated chitosan, thiolated chitosan, galactosylated chitosan, alkylated chitosan, PEI-incorporated chitosan, uronic acid modified chitosan, glycol chitosan, and the like. For further teaching on chitosan derivatives, see, for example, pp. 63-74 of Non-viral Gene Therapy, K. Taira, K. Kataoka, T. Niidome (editors), Springer-Verlag Tokyo, 2005, ISBN 4-431-25122-7; Zhu et al., Chinese Science Bulletin, December 2007, vol. 52 (23), pp. 3207-3215; and Varma et al., Carbohydrate Polymers 55 (2004) 77-93
[0045] Chitosans with any degree of deacetylation (DDA) greater than 50% are used in the present invention, with functionalization between 1% and 50%. (Percent functionalization is determined relative to the number of free amino moieties on the chitosan polymer.) The degrees of deacetylation and functionalization impart a specific charge density to the functionalized chitosan derivative. The resulting charge density affects solubility, nucleic acid binding and subsequent release, and interaction with mammalian cell membranes. Thus, in accordance with the present invention, these properties must be optimized for optimal efficacy. Exemplary chitosan derivatives are described in Baker et al; Ser. No. 11/657,382 filed on Jan. 24, 2007, which is incorporated by reference herein by reference. In one embodiment, the dually derivatized chitosan described herein comprises chitosan having a degree of deacetylation of at least 50%. In one embodiment, the degree of deacetylation is at least 60%, more preferably at least 70%, more preferably at least 80%, more preferably at least 90%, and most preferably at least 95%. In a preferred embodiment, the dually derivatized chitosan described herein comprises chitosan having a degree of deacetylation of at least 98%.
[0046] The chitosan derivatives described herein have a range of average molecular weights that are soluble at neutral and physiological pH, and include for the purposes of this invention molecular weights ranging from 3-110 kDa. Embodiments described herein feature lower average molecular weight of derivatized chitosans (<25 kDa, e.g., from about 5 kDa to about 25 kDa), which can have desirable delivery and transfection properties, and are small in size and have favorable solubility. A lower average molecular weight derivatized chitosan is generally more soluble than one with a higher molecular weight, the former thus producing a nucleic acid/chitosan complex that will release more easily the nucleic acid and provide increased transfection of cells.
[0047] In a preferred embodiment, administration of an expression vector comprising a PD-L1 nucleic acid is accomplished using chitosan or a chitosan derivative as the nucleic acid delivery vehicle. The chitosan derivatives described herein are generated by functionalizing the resulting free amino groups with positively charged and/or hydrophilic moieties. The derivatized chitosans described in International Patent Application Nos. PCT/CA2013/050218 and PCT/CA2014/050921, the contents of which are herein incorporated by reference in their entirety, have a number of properties which are advantageous for a nucleic acid delivery vehicle including: they effectively bind and complex the negatively charged nucleic acids, they can be formed into nanoparticles of a controllable size, they can be taken up by the cells and they can release the nucleic acids at the appropriate time within the cells.
[0048] In preferred embodiments, dually derivatized-chitosan or DD-chitosan is used, which refers to chitosan that has been dually functionalized (dually functionalized-chitosan or DF-chitosan), e.g., coupled with both a Arg and a hydrophilic polyol, both of which are covalently attached to chitosan. The Arg may be covalently attached to chitosan either as single amino acid or as a polypeptide. The hydrophilic polyol may be a sugar such as glucose. By DD-chitosan nucleic acid polyplex or its grammatical equivalents is meant a complex comprising a plurality of DD-chitosan molecules and a plurality of nucleic acid molecules coding for PD-L1 or fragments thereof. In a preferred embodiment, the dually derivatized-chitosan is complexed with said nucleic acid coding for a PD-L1 polypeptide.
[0049] The DD-chitosan PD-L1 nucleic acid polyplexes comprise a PD-L1 nucleic acid component and a DD-chitosan component. Chitosan, and DD-chitosan nucleic acid polyplexes may be prepared by any method known in the art. For example, functionalized chitosan and nucleotide feedstock concentrations may be adjusted to accommodate various amine-to-phosphate ratios (N/P), mixing ratios and target nucleotide concentrations. A preferred method for polyplex formation is disclosed in WO 2009/039657, which is expressly incorporated herein in its entirety by reference.
Expression Vectors and Expression Control Regions
[0050] The present invention relates to expression vectors comprising a PD-L1 nucleic acid, a promoter, and transcriptional and translational stop signals. The various nucleotide and control sequences may be joined together to produce an expression vector that may include one or more convenient restriction sites to allow for insertion or substitution of the nucleic acid encoding for PD-L1 at such sites. Alternatively, the PD-L1 nucleic acid may be expressed by inserting the polynucleotide or a nucleic acid construct comprising the PD-L1 nucleic acid into an appropriate vector for expression. In creating the expression vector, the coding sequence for PD-L1 is located in the vector such that it is operably linked with the appropriate control sequences for expression.
[0051] The expression vector may be any vector (e.g., a plasmid or virus) that can be conveniently subjected to recombinant DNA procedures and can bring about expression of the nucleic acid. The choice of the vector will typically depend on the compatibility of the vector with the host cell into which the vector is to be introduced. The vector may be a linear or closed circular plasmid. The vector may be an autonomously replicating vector, i.e., a vector that exists as an extrachromosomal entity, the replication of which is independent of chromosomal replication, e.g., a plasmid, an extrachromosomal element, a minichromosome, or an artificial chromosome. The vector may contain any means for assuring self-replication. Alternatively, the vector may be one that, when introduced into the host cell, is integrated into the genome and replicated together with the chromosome(s) into which it has been integrated. Furthermore, a single vector or plasmid or two or more vectors or plasmids that together contain the total nucleci acid to be introduced into the genome of the host cell, or a transposon, may be used.
[0052] The vector may optionally include one or more selectable markers that permit easy selection of transformed, transfected, transduced, or the like cells. A selectable marker is a gene the product of which provides for biocide or viral resistance, resistance to heavy metals, prototrophy to auxotrophs, and the like. For autonomous replication, the vector may further comprise an origin of replication enabling the vector to replicate autonomously in the host cell in question. The origin of replication may be any plasmid replicator mediating autonomous replication that functions in a cell. The term origin of replication or plasmid replicator means a polynucleotide that enables a plasmid or vector to replicate in vivo.
[0053] In preferred embodiments, the expression vectors of the present invention comprise a nucleic acid molecule encoding for PD-L1 or fragments thereof, comprising an expression control region operably linked to a coding region for a PD-L1 polypeptide as described herein. In some embodiments, the nucleic acid is DNA or RNA, e.g., mRNA. In some embodiments, the PD-L1 nucleic acid is an artificial nucleic acid. Preferred artificial nucleic acids include, but are not limited to, peptide nucleic acid (PNA), phosphorodiamidate morpholino oligo (PMO), locked nucleic acid (LNA), glycol nucleic acid (GNA) and threose nucleic acid (TNA).
[0054] In one specific embodiment, the expression vector is pVAX_hPD-L1 as exemplified herein (
[0055] In some embodiments, the expression control region possesses constitutive activity. In a number of preferred embodiments, the expression control region does not have constitutive activity. This provides for the dynamic expression of the PD-L1 nucleic acid. By dynamic expression is meant expression that changes over time. Dynamic expression may include several such periods of low or absent expression separated by periods of detectable expression. In a number of preferred embodiments, the PD-L1 nucleic acid is operably linked to a regulatable promoter. This provides for the regulatable expression of the nucleic acid molecule. Expression control regions comprise regulatory polynucleotides (sometimes referred to herein as elements), such as promoters and enhancers, which influence expression of an operably linked PD-L1 nucleic acid.
[0056] Expression control elements included herein can be from bacteria, yeast, plant, or animal (mammalian or non-mammalian). Expression control regions include full-length promoter sequences, such as native promoter and enhancer elements, as well as subsequences or polynucleotide variants that retain all or part of full-length or non-variant function (e.g., retain some amount of nutrient regulation or cell/tissue-specific expression). As used herein, the term functional and grammatical variants thereof, when used in reference to a nucleic acid sequence, subsequence or fragment, means that the sequence has one or more functions of native nucleic acid sequence (e.g., non-variant or unmodified sequence). As used herein, the term variant means a sequence substitution, deletion, or addition, or other modification (e.g., chemical derivatives such as modified forms resistant to nucleases).
[0057] As used herein, the term operable linkage refers to a physical juxtaposition of the components so described as to permit them to function in their intended manner. In the example of an expression control element in operable linkage with a nucleic acid, the relationship is such that the control element modulates expression of the nucleic acid. Typically, an expression control region that modulates transcription is juxtaposed near the 5 end of the transcribed nucleic acid (i.e., upstream). Expression control regions can also be located at the 3 end of the transcribed sequence (i.e., downstream) or within the transcript (e.g., in an intron). Expression control elements can be located at a distance away from the transcribed sequence (e.g., 100 to 500, 500 to 1000, 2000 to 5000, or more nucleotides from the nucleic acid). A specific example of an expression control element is a promoter, which is usually located 5 of the transcribed sequence. Another example of an expression control element is an enhancer, which can be located 5 or 3 of the transcribed sequence, or within the transcribed sequence.
[0058] Some expression control regions confer regulatable expression to an operably linked PD-L1 nucleic acid. A signal (sometimes referred to as a stimulus) can increase or decrease expression of a PD-L1 nucleic acid operably linked to such an expression control region. Such expression control regions that increase expression in response to a signal are often referred to as inducible. Such expression control regions that decrease expression in response to a signal are often referred to as repressible. Typically, the amount of increase or decrease conferred by such elements is proportional to the amount of signal present; the greater the amount of signal, the greater the increase or decrease in expression.
[0059] Numerous regulatable promoters are known in the art. Preferred inducible expression control regions include those comprising an inducible promoter that is stimulated with a small molecule chemical compound. In one embodiment, an expression control region is responsive to a chemical that is orally deliverable but not normally found in food. Particular examples can be found, for example, in U.S. Pat. Nos. 5,989,910; 5,935,934; 6,015,709; and 6,004,941, all of which are incorporated herein by reference in their entirety.
[0060] In one embodiment, the expression vector further comprises an integration sequence. In one embodiment, the expression vector comprises a single integration sequence. In another embodiment, the expression vector comprises a first and a second integration sequence for integrating the PD-L1 nucleic acid or a portion thereof into the genome of a target cell. In a preferred embodiment, the integration sequence(s) is functional in combination with a means for integration that is selected from the group consisting of mariner, sleeping beauty, FLP, Cre, C31, R, lambda, and means for integration from integrating viruses such as AAV, retroviruses, and lentiviruses.
[0061] In one embodiment, the subject composition further comprises a non-therapeutic construct in addition to the PD-L1 construct, wherein the non-therapeutic construct comprises a nucleic acid sequence encoding a means for integration operably linked to a second expression control region. This second expression control region and the expression control region operably linked to the PD-L1 nucleic acid may be the same or different. The encoded means for integration is preferably selected from the group consisting of mariner, sleeping beauty, FLP, Cre, C31, R, lambda, and means for integration from integrating viruses such as AAV, retroviruses, and lentiviruses.
[0062] The procedures used to ligate the elements described above to construct the recombinant expression vectors of the present invention are well known to one skilled in the art see, e.g., Sambrook et al., 1989, supra). For further teaching, see WO2008020318, which is expressly incorporated herein in its entirety by reference.
Pharmaceutical Formulations
[0063] The present invention also provides pharmaceutically acceptable or physiologically acceptable formulations comprising DD-chitosan nucleic acid polyplex compositions of the invention. Such formulations can be administered in vivo to a subject in order to practice treatment methods.
[0064] As used herein, the terms pharmaceutically acceptable and physiologically acceptable refer to carriers, diluents, excipients and the like that can be administered to a subject, preferably without producing excessive adverse side-effects (e.g., nausea, abdominal pain, headaches, etc.). Such preparations for administration include sterile aqueous or non-aqueous solutions, suspensions, and emulsions.
[0065] Pharmaceutical formulations can be made from carriers, diluents, excipients, solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with administration to a subject. Such formulations can be contained in a tablet (coated or uncoated), capsule (hard or soft), microbead, emulsion, powder, granule, crystal, suspension, syrup or elixir. Supplementary active compounds and preservatives, among other additives, may also be present, for example, antimicrobials, anti-oxidants, chelating agents, and inert gases and the like.
[0066] Excipients can include a salt, an isotonic agent, a serum protein, a buffer or other pH-controlling agent, an anti-oxidant, a thickener, an uncharged polymer, a preservative or a cryoprotectant. xcipients used in compositions of the invention may further include an isotonic agent and a buffer or other pH-controlling agent. These excipients may be added for the attainment of preferred ranges of pH (about 6.0-8.0) and osmolarity (about 50-400 mmol/L). Examples of suitable buffers are acetate, borate, carbonate, citrate, phosphate and sulfonated organic molecule buffer. Such buffers may be present in a composition in concentrations from 0.01 to 1.0% (w/v). An isotonic agent may be selected from any of those known in the art, e.g. mannitol, dextrose, glucose and sodium chloride, or other electrolytes. Preferably, the isotonic agent is glucose or sodium chloride. The isotonic agents may be used in amounts that impart to the composition the same or a similar osmotic pressure as that of the biological environment into which it is introduced. The concentration of isotonic agent in the composition will depend upon the nature of the particular isotonic agent used and may range from about 0.1 to 10%. When glucose is used, it is preferably used in a concentration of from 1 to 5% w/v, more particularly 5% w/v. When the isotonic agent is sodium chloride, it is preferably employed in amounts of up to T % w/v, in particular 0.9% w/v. The compositions of the invention may further contain a preservative. Examples preservatives are polyhexamethylene-biguanidine, benzalkonium chloride, stabilized oxychloro complexes (such as those known as Purite), phenylmercuric acetate, chlorobutanol, sorbic acid, chlorhexidine, benzyl alcohol, parabens, and thimerosal. Typically, such preservatives are present at concentrations from about 0.001 to 1.0%. Furthermore, the compositions of the invention may also contain a cryopreservative agent. Preferred cryopreservatives are glucose, sucrose, mannitol, lactose, trehalose, sorbitol, colloidal silicon dioxide, dextran of molecular weight preferable below 100,000 g/mol, glycerol, and polyethylene glycols of molecular weights below 100,000 g/mol or mixtures thereof. Most preferred are glucose, trehalose and polyethylene glycol. Typically, such cryopreservatives are present at concentrations from about 0.01 to 10%.
[0067] A pharmaceutical formulation can be formulated to be compatible with its intended route of administration. For example, for oral administration, a composition can be incorporated with excipients and used in the form of tablets, troches, capsules, e.g., gelatin capsules, or coatings, e.g., enteric coatings (Eudragit or Sureteric). Pharmaceutically compatible binding agents, and/or adjuvant materials can be included in oral formulations. The tablets, pills, capsules, troches and the like can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch; a lubricant such as magnesium stearate or other stearates; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or flavoring.
[0068] Formulations can also include carriers to protect the composition against rapid degradation or elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems. For example, a time delay material such as glyceryl monostearate or glyceryl stearate alone, or in combination with a wax, may be employed.
[0069] Suppositories and other rectally administrable formulations (e.g., those administrable by enema) are also contemplated. Further regarding rectal delivery, see, for example, Song et al., Mucosal drug delivery: membranes, methodologies, and applications, Crit. Rev. Ther. Drug. Carrier Syst., 21:195-256, 2004; Wearley, Recent progress in protein and peptide delivery by noninvasive routes, Crit. Rev. Ther. Drug. Carrier Syst., 8:331-394, 1991.
[0070] Additional pharmaceutical formulations appropriate for administration are known in the art and are applicable in the methods and compositions of the invention (see, e.g., Remington's Pharmaceutical Sciences (1990) 18th ed., Mack Publishing Co., Easton, Pa.; The Merck Index (1996) 12th ed., Merck Publishing Group, Whitehouse, N.J.; and Pharmaceutical Principles of Solid Dosage Forms, Technonic Publishing Co., Inc., Lancaster, Pa., (1993)).
Intestinal Administration
[0071] The subject compositions may be administered orally. Oral administration may involve swallowing, so that the compound enters the gastrointestinal tract. Compositions of the invention may also be administered directly to the gastrointestinal tract. Syringes, endoscopes, cannulas, intubation tubes, catheters and other articles may be used for such administration.
Formulations suitable for oral administration include solid formulations such as tablets, capsules, coated capsules containing particulates or coated particulates, liquids, or powders, lozenges (including liquid-filled), chews, multi- and nano-particulates, gels, films, ovules, and sprays.
Liquid formulations include suspensions, solutions, syrups and elixirs. Liquid formulations may be prepared by the reconstitution of a solid.
[0072] Tablet dosage forms generally contain a disintegrant. Examples of disintegrants include sodium starch glycolate, sodium carboxymethyl cellulose, calcium carboxymethyl cellulose, croscarmellose sodium, crospovidone, polyvinylpyrrolidone, methyl cellulose, microcrystalline cellulose, lower alkyl-substituted hydroxypropyl cellulose, starch, pregelatinised starch and sodium alginate. Generally, the disintegrant will comprise from 1 weight % to 25 weight %, preferably from 5 weight % to 20 weight % of the dosage form.
[0073] Binders are generally used to impart cohesive qualities to a tablet formulation. Suitable binders include microcrystalline cellulose, gelatin, sugars, polyethylene glycol, natural and synthetic gums, polyvinylpyrrolidone, pregelatinised starch, hydroxypropyl cellulose and hydroxypropyl methylcellulose. Tablets may also contain diluents, such as lactose (monohydrate, spray-dried monohydrate, anhydrous and the like), mannitol, xylitol, dextrose, sucrose, sorbitol, microcrystalline cellulose, starch and dibasic calcium phosphate dihydrate.
[0074] Tablets may also optionally comprise surface active agents, such as sodium lauryl sulfate and polysorbate 80, and glidants such as silicon dioxide and talc. When present, surface active agents may comprise from 0.2 weight % to 5 weight % of the tablet, and glidants may comprise from 0.2 weight % to 1 weight % of the tablet.
[0075] Tablets also generally contain lubricants such as magnesium stearate, calcium stearate, zinc stearate, sodium stearyl fumarate, and mixtures of magnesium stearate with sodium lauryl sulphate. Lubricants generally comprise from 0.25 weight % to 10 weight %, preferably from 0.5 weight % to 3 weight % of the tablet.
[0076] Other possible ingredients include anti-oxidants, colorants, flavoring agents, preservatives and taste-masking agents.
Tablet blends may be compressed directly or by roller to form tablets. Tablet blends or portions of blends may alternatively be wet-, dry-, or melt-granulated, melt congealed, or extruded before tabletting. The final formulation may comprise one or more layers and may be coated or uncoated; it may even be encapsulated.
[0077] The formulation of tablets is discussed in Pharmaceutical Dosage Forms: Tablets, Vol. 1, by H. Lieberman and L. Lachman (Marcel Dekker, New York, 1980).
[0078] Consumable oral films for human or veterinary use are typically pliable water-soluble or water-swellable thin film dosage forms which may be rapidly dissolving or mucoadhesive and typically comprise a film-forming polymer, a binder, a solvent, a humectant, a plasticiser, a stabiliser or emulsifier, a viscosity-modifying agent and a solvent. Some components of the formulation may perform more than one function.
[0079] Also included in the invention are multiparticulate beads comprising a composition of the invention.
[0080] Other possible ingredients include anti-oxidants, colorants, flavourings and flavour enhancers, preservatives, salivary stimulating agents, cooling agents, co-solvents (including oils), emollients, bulking agents, anti-foaming agents, surfactants and taste-masking agents.
[0081] Films in accordance with the invention are typically prepared by evaporative drying of thin aqueous films coated onto a peelable backing support or paper. This may be done in a drying oven or tunnel, typically a combined coater dryer, or by freeze-drying or vacuuming.
Solid formulations for oral administration may be formulated to be immediate and/or modified release. Modified release formulations include delayed-, sustained-, pulsed-, controlled-, targeted and programmed release.
[0082] Other suitable release technologies such as high energy dispersions and osmotic and coated particles are known.
Rectal/Intravaginal Administration
[0083] The compounds of the invention may be administered rectally or vaginally, for example, in the form of a suppository, pessary, or enema. Cocoa butter is a traditional suppository base, but various alternatives may be used as appropriate.
[0084] Formulations for rectal/vaginal administration may be formulated to be immediate and/or modified release. Modified release formulations include delayed-, sustained-, pulsed-, controlled-, targeted and programmed release.
[0085] The doses or effective amount for treating a subject are preferably sufficient to ameliorate one, several or all of the symptoms of the condition, to a measurable or detectable extent, although preventing or inhibiting a progression or worsening of the inflammatory disorder or condition, or a symptom, is a satisfactory outcome. Thus, the amount of PD-L1 protein produced to ameliorate a condition treatable by a method of the invention will depend on the condition and the desired outcome and can be readily ascertained by the skilled artisan. Appropriate amounts will depend upon the condition treated, the therapeutic effect desired, as well as the individual subject (e.g., the bioavailability within the subject, gender, age, etc.). The effective amount can be ascertained by measuring relevant physiological effects.
[0086] Veterinary applications are also contemplated by the present invention. Accordingly, in one embodiment, the invention provides methods of treating non-human mammals, which involve administering a chitosan-based nanoparticle of the invention to a non-human mammal in need of treatment.
Methods of Treatment
[0087] The subject compositions and methods find advantageous use in modulating inflammation. For example, the therapeutic polypeptide may inhibit the proliferation and differentiation of cells involved in an inflammatory response. These molecules can be used to treat inflammatory conditions, both chronic and acute conditions, including inflammation associated with infection (e.g. septic shock, sepsis, or systemic inflammatory response syndrome (SIRS)), ischemia-reperfusion injury, endotoxin lethality, inflammatory bowel disease (IBD), Crohn's disease, colitis, or resulting from over production of cytokines (e.g. TNF or IL-1.) Inflammatory disorders of particular interest for treatment in the present invention include, but are not limited to, Crohn's disease, and inflammatory bowel disease.
[0088] A therapeutic composition of the present invention may also be used to treat and/or prevent organ rejection or graft-versus-host disease (GvHD). Organ rejection occurs by host immune cell destruction of the transplanted tissue through an immune response. Similarly, an immune response is also involved in GvHD, but, in this case, the foreign transplanted immune cells destroy the host tissues. The administration of a therapeutic composition of the present invention that inhibits an immune response, particularly the proliferation, differentiation, or chemotaxis of T-cells, may be an effective therapy in preventing organ rejection or GvHD.
[0089] The examples set out herein illustrate several embodiments of the present disclosure but should not be construed as limiting the scope of the present disclosure in any manner.
EXAMPLES
Example 1
[0090] Plasmid Construction and Production
[0091] Both optimized PD-L1 and PD-L1-Fc DNA sequences were cloned in pVAX backbone cloning vector. Plasmid contain a plasmid replication origin (pUC ori) under the control of a human cytomegalovirus immediate-early gene promoter (CMV) and with a kanamycin resistance gene (KAN). Designed plasmids were custom synthesized by DNA 2.0 (Newark, CA). Once received, DNA was reconstituted according to the manufacturer's recommendation. Briefly absorbent paper containing the DNA was put into a small 0.2 mL tube with perforated bottom (performed with 23G needle). The small tube was then put into a larger 1.5 mL tube. 200 L of water was added to the absorbent paper, after 1 min incubation @ RT, the tube was centrifuged at maximum speed for 1 min. Solubilized DNA was recovered in the 1.5 ml tube. The DNA was then used to transform E. coli DH5, chemically competent bacteria. Briefly, to a 100 l thawed E. coli DH5 cells 10 L of the eluted DNA was added in a sterile condition. After 30 mins incubation on ice, cells were heat shocked at 42 C for 30 secs and incubated on ice for 2 min. 30 L of Luria-Bertani (LB) medium was added to the DH5 transformed cells and incubated for 1 hour at 37 C under 180 rpm shaking. The culture is then plated on a LB-agar plate containing kanamycin (50 g/ml) and incubated for 16 h at 37 C. The next day, a single isolated colony was used to inoculate 6 mL of LB Broth containing kanamycin (50 g/ml). The culture was incubated on a shaker (180 rpm) at 37 C for 5-6 hours. The culture was subsequently used to inoculate 2.5 L of LB medium which was incubated at 37 C for 16 hours on shaker. Plasmid DNA was then isolated from this large bacterial culture using EndoFree Plasmid Giga Kit (QIAGEN) according to the manufacturer's instruction. Upon isolation PD-L1 and PD-L1-Fc DNA insert within the plasmid was verified using restriction enzymes and fragment size confirmed by agarose gel
Example 2
[0092] In Vitro PD-L1 and PD-L1-Fc Expression
[0093] To measure in vitro expression from the polyplex, HEK-293T cells were seeded in 6-well tissue culture plates at a density of 800,000 cells per well in high glucose DMEM complete media (10% Fetal Bovine Serum, 50 Units/ml penicillin, 50 g/ml streptomycin) and incubated overnight at 37 C. and 5% CO.sub.2. The following day, PD-L1-Fc polyplex was thawed briefly in a 37 C. water bath. Each polyplex was diluted in sterile water to a concentration of 12.5-200 g/ml of DNA, corresponding to 0.5-8 g of DNA per well, and kept on ice until transfection. HEK-293T supernatant was removed from each well and cells were gently washed with 2 ml of pre-warmed OptiMEM. 1 ml of pre-warmed OptiMEM was gently added to each well. 40 l of diluted polyplex was added to the well and the plate was gently swirled to ensure proper mixing. The cells were incubated for 3 hours at 37 C. and 5% CO.sub.2. Following incubation, the cell culture medium was removed by pipetting and replaced with 2 ml of pre-warmed DMEM complete medium and the cells were incubated at 37 C. and 5% C02 for 48 hours. At 48 hours post-transfection, the cell culture medium was removed from wells transfected with PD-L1-Fc polyplex or untransfected cells as a control. Cell debris was removed from the supernatant by centrifugation (1500 rpm, 5 min, 4 C.) and the supernatant was stored at 80 C. until analysis.
[0094] To quantify the total cellular protein, cell culture supernatant was removed from the wells, the transfected cells were washed with cold PBS, and 500 l of lysis buffer (50 mM Tris pH 8.0, 1% TritonX-100, 100 mM NaCl, 1 mM EDTA, 10% glycerol plus cOmplete Protease Inhibitor Cocktail) was added to the wells. The plate was left on ice for 2-3 minutes and cells were collected using a cell scraper, transferred to a 1.5 ml microcentrifuge tube and left on ice for 30 min. Cell debris was removed from the lysate by centrifugation (13000 rpm, 10 min, 4 C.) and total protein was measured by Lowry assay.
[0095] The PD-L1 protein concentration was measured by ELISA, as per the manufacturer's protocol. Briefly, 96 well plates were coated with anti-human PD-L1 capture antibody and incubated overnight at 25 C. The following day, plates were washed with 0.05% Tween20 in PBS, blocked with 1% bovine serum albumin (BSA) in PBS for 1 hour and followed by an additional wash step. Samples or standards were added to the plate and incubated at 25 C. for 2 hours. A biotinylated goat anti-human PD-L1 detection antibody was added to the wells for 2 hours, followed by washes and the addition of streptavidin-HRP for 20 min. The wells were washed and a tetramethylbenzidine solution was added for 20 min to detect HRP. The reaction was terminated by the addition of 2 N sulfuric acid and plates were read on a SpectraMAX Plus (ENG0214) using the SoftMax Pro software at 450 nm. PD-L1 protein levels were calculated using lyophilized standard protein provided by the manufacturer. Protein samples were fitted to a standard 4 parameter logistic curve. In some instances, the PD-L1 protein levels were normalized to total protein in the transfected cells and represented as ng of PD-L1-Fc/mg of total cellular protein.
[0096] To assess the transfection potency of PD-L1-Fc polyplexes, HEK-293T were transfected with increasing amounts of DNA contained within the DD-X polymer. The quantification of PD-L1 protein showed a dose-dependent increase in hPD-L1-Fc expression with increasing amounts of pVAX-opt-hPD-L1-Fc plasmid DNA (
Example 3
Purification of Fc-Fused Protein (PD-L1-Fc)
[0097] HEK293T cells were plated in T75 flasks at 510.sup.6 cells/flask in DMEM (10% FBS, Multicell) and incubated at 37 C. The following day, cells were transfected with PD-L1-Fc plasmid DNA (9 ug/flask; 3 ml per flask) using Lipofectamine 2000 (Invitrogen), as recommended by the manufacturer, and incubated at 37 C. After 24 h, DMEM medium was exchanged with 12 ml EXCELL serum-free medium (Sigma Aldrich). After 48 h (72 h post transfection), supernatant was collected and stored at 20 C. until purification. Fc-fused proteins were purified using Protein G HiTrap columns (GE), as recommended by the manufacturer. Buffer was then exchanged using PD-10 desalting columns, and protein was eluted in 4 fractions of PBS (Gibco). Presence of protein was detected by Coomassie stain. PDL1 concentration in each of the fractions was measured by ELISA (Duoset, R&D), as recommended by the manufacturer.
Example 4
[0098] In Vitro PD-L1-Fc Functionality Assay
[0099] To assess functionality of Fc-fused PD-L1 construct, anti-mouse CD3 (0.2 g/ml, eBioscience) and/or anti-mouse CD28 (1 g/ml, eBioscience) with or without 5 g/ml in vitro serum free media produced PDL1-Fc or commercial rhPDL1-Fc (Adipogen) were added to wells of a 96-well flat-bottom plate in PBS (50 l/well). rhIgG1-Fc (Adipogen) was used as a negative control.
[0100] The plate was put on plate-shaker on medium speed for 1 h and then incubated overnight at 4 C. The following day, spleens were removed from 3 mice (Jackson Laboratories). Splenocytes were isolated by grinding the spleens on the frosted ends of microscope slides. Red blood cells were lysed for 1 min in 5 ml of in house made ACK lysis buffer, and the lysis was stopped by adding 45 ml PBS (10% FBS). After centrifugation and decanting, cells from the 3 mice were resuspended in supplemented RPMI medium (10% FBS, NEAA, L-glutamine, 2-ME; Multicell), pooled, counted, and adjusted to an appropriate concentration. A portion of cells were stained with CellTrace Violet (Life Technologies), as recommended by the manufacturer. The PBS was removed from the aCD3/aCD28 96-well plate carefully by pipetting. Cells were then seeded into the wells in the RPMI medium (200,000 cells/well), and incubated at 37 C for 3 or 4 days. At either time point, the cells were transferred to a new 96-well v-bottom plate and stained with a fixable viability dye (eBioscience) for 30 mins in the dark and on ice. Cells were washed twice with cold FACS buffer (PBS 2% FBS) and acquired on the flow cytometer (BD LSR II). Cell proliferation was measured by monitoring cell division peaks in the CellTrace Violet channel. Cell activation was measured by detecting cell size in the FSC-SSC gate.
[0101] To determine if opt-hPD-L1-Fc binds to the human PD-1 receptor and activates an intracellular signal, the PathHunter Jurkat PD-1 (SHP2) Signaling Assay (DiscoverX) was used. Prior to testing this assay, a large-scale batch of purified PD-L1-Fc protein was generated. Briefly, PD-L1-Fc was expressed from construct by transfecting HEK-293T cells with PD-L1-Fc plasmid DNA. Briefly, 3.910.sup.5 HEK-293T cells were plated in 30 ml DMEM (Multicell) complete (10% FBS, 100 U/ml Penicillin, 100 g/ml Streptomycin) in a T175 flask and incubated overnight at 37 C. and 5% CO.sub.2. The following day, medium was aspirated from the flask and cells were washed once with 10 ml PBS (Multicell). Cells were transfected with 49 g of PD-L1-Fc plasmid using Lipofectamine 2000 (Life Technologies; 100 l per flask) in 5.5 ml of OptiMEM (Gibco). Cells were incubated (37 C. and 5% CO.sub.2) for 2 h, and then 40 ml of DMEM complete was added to the flask. Cells were incubated for 24 h, medium was aspirated, and cells were washed with 10 ml PBS. EXCELL serum-free media (45 ml; Sigma) was added to the flask and cells were incubated at 37 C. and 5% CO.sub.2. After 24 h (48 h post-transfection), supernatant was removed and centrifuged for 5 min at 1500 rpm to remove cell debris. Supernatant was transferred to a new 50 ml tube and stored at 80 C. PD-L1-Fc was purified using Protein G HiTrap columns (GE) as recommended by the manufacturer. Buffer was exchanged for PBS using PD-10 desalting columns (GE) as recommended by the manufacturer. PD-L1-Fc was stored at 80 C. until protein was concentrated and quantified. PD-L1-Fc protein was concentrated using Amicon Ultra-4 centrifugal filters (Millipore Sigma) as recommended by the manufacturer. Protein was immediately quantified by PD-L1 ELISA (R&D). In some cases, PD-L1-Fc concentration was diluted to 1 mg/mL in PBS and stored at 80 C.
[0102] To assess intracellular activation through the human PD-L1 receptor, the PathHunter cells were cultured as recommended by the manufacturer. Cells were centrifuged and re-suspended in pre-warmed AssayComplete Cell Plating Reagent. Cells were seeded into the wells of a white 96-well flat-bottomed tissue culture plate (50 l/well; 20,000 cells/well) and incubated at room temperature for 15 min. AssayComplete Cell Plating Reagent (10 l/well) was added to wells with or without anti-PD-1 (clone NAT105, Abcam). Purified PD-L1-Fc protein or recombinant non-lytic human IgG1-Fc (Adipogen) were prepared in AssayComplete Plating Reagent and added to the cells (50 l/well). Cells were incubated for 40 min at 37 C. and 5% C02. PathHunter Bioassay Reagent 1 was added to the cells (10 l/well) and the plate was placed on a plate shaker for 1 min at 350 rpm. Cells were incubated for 15 min at room temperature and in the dark. PathHunter Bioassay Reagent 2 (40 l) was added to each well and cells were incubated for 1 hour at room temperature and in the dark. Luminescence was read on a luminometer (enSpirePerkin Elmer). Data was analyzed as luminescence (RLU; Relative Fluorescence Units) relative to unstimulated controls. Data was presented as meanstandard deviation. Data was analyzed using a student's t test and asterisks represent statistically significant differences (*, p0.05; **, p<0.01; ***, p<0.001).
[0103] The results of the foregoing are summarized here. To determine whether protein expressed from the pVAX-opt-hPD-L1-Fc plasmid will bind to the human PD-1 receptor and initiate intracellular signaling, the PathHunter Jurkat PD-1 (SHP2) Signaling Assay (DiscoverX) was used. Signaling through the PD-1 receptor increased with increasing doses of purified PDL1-Fc and appeared to plateau at the maximum dose of 14.7 M (783 g/ml;
Example 5
[0104] PD-L1 Wild-Type Membrane Bound In Vitro Expression and Functionality Assay
[0105] To determine hPD-L1 expression kinetic at the cell surface, NIH/3T3 cells were seeded (400,000 cells/well; 2 ml; DMEM 10% FBS) into a 6-well plate and incubated overnight at 37 C. The following day, cells were transfected with wild-type PD-L1 construct plasmid or pVax control with Lipofectamine 2000, as recommended by the manufacturer. Twenty-four hours after transfection, cells were washed with PBS, and resuspended by adding enzyme-free dissociation buffer (EFDB, Gibco; 2 ml/well), incubating at 37 C for 5 mins, and gently pipetting the cells off of the plate. Cells were centrifuged at 1500 rpm for 5 mins and resuspended in DMEM (10% FBS). Cells were re-seeded (10,000 cells/well) into a 96-well flat-bottomed plate, and cultured for 2-5 days. At each time point, supernatant was removed, cells were resuspended in EFDB as described above, and cells were distributed into a 96-well v-bottomed plate for FACS staining. Cells were stained with anti-human PD-L1-PE (BioLegend) at 0.2 ng/well and a fixable viability dye eFluor 780 (eBioscience) as recommended by supplier for 30 mins on ice and in the dark. Cells were washed twice, resuspended in FACS buffer, and acquired on the flow cytometer.
[0106] To test functionality of the hPD-L1 expressed at the NIH/3T3 cell surface, a PD-1 binding assay was employed. NIH/3T3 cells were transfected in 6-well plates as described above. Forty-eight hours after transfection, cells were resuspended in EFDB as described above, centrifuged, resuspended in FACS Buffer, and seeded into a 96-well v-bottomed plate. Cells were centrifuged at 1500 rpm for 5 mins, decanted, resuspended (50 ul) with or without rhPD-1 (R&D) at various concentrations, and incubated at 37 C for 30 mins. Cells were centrifuged, washed twice with FACS buffer, and stained with anti-human PDL1-PE (0.2 ng/well) or isotype control, anti-human PD-1-APC (eBioscience) at 0.8 ng/well or isotype control, and a viability dye for 30 mins on ice and in the dark. Cells were then washed twice, resuspended in FACS buffer, and acquired using BD LSR II Flow Cytometer. Data were analyzed using FlowJo 10.2 [software (Tree Star, Or. CA)
Example 6
[0107] In Vivo Efficacy Studies
[0108] GvHD Model
[0109] 10 weeks old female BALB/c SPF mice (Charles River) received a total body irradiation of 700 cGy in split dose 2350 cGy (RS2000 Biological Research X-ray source) first irradiation was given in the afternoon of day 1 and the second in the morning of day 0. 8-10 weeks old male C57Bl6/j mice (Charles River) were used for donor cells.
[0110] Study includes 3 control groups (n=5): non-irradiation group, no transplant group, 10 million BMT only group; and 4 treatment groups (n=8) receiving 10 million BMT and 2.5 million splenocytes. Starting from day 1, mice were treated once a week by enema for the following 6 weeks (for a total of 7 dosing) or left untreated. Animals were monitored daily for body weight and clinical signs. An animal with more than 25% body weight loss and or clinical scoring of 8 or more was terminated.
[0111] Weekly intracolonic administration of the PD-L1 or PD-L1-Fc polyplex decreased the bodyweight loss compared to pVAX control treated animals (
Example 7
[0112] T Cell Colitis Model
[0113] Total CD4+ T cells were isolated from the spleens of 6-8-week-old female C57BL/6 mice via negative selection using the magnetic activation cell sorter (MACS) CD4 T-cell isolation kit (Miltenyi Biotec, Auburn, CA). Enriched cells were subsequently sorted for CD4+CD25-CD45RBhigh naive T cells using FACS (FACSAria, BD Biosciences, San Jose, CA). 5105 CD4+CD25-CD45RBhigh cells were transferred intraperitoneally (IP) to recipient 6-8-week-old female B10-RAG2-deficient mice (Jackson).
[0114] Animals bodyweight and clinical signs were monitored 2-3/week. On day 14, presence of CD4 T cell was confirmed by flow cytometry staining for CD4. Weekly enema treatment started on day 15 or 19 post T cell transfer (total of 6 or 7 treatments). Animals were monitored twice per week for body weight and clinical signs. An animal with more than 25% body weight loss or severe clinical signs is terminated.
[0115] Weekly administration of the PD-L1-Fc polyplex by intracolonic instillation decreased the bodyweight loss and clinical signs of disease in PD-L1-Fc treated mice compared to pVAX and sucrose control mice (
[0116] While the present disclosure has been described with reference to preferred embodiments, it will be understood by those skilled in the art that various changes may be made and equivalents may be substituted for elements thereof to adapt to particular situations without departing from the scope of the present disclosure. Therefore, it is intended that the present disclosure not be limited to the particular embodiments disclosed as the best mode contemplated for carrying out the present disclosure, but that the present disclosure will include all embodiments falling within the scope and spirit of the appended claims.