Anti-CD25 for tumour specific cell depletion

11851494 · 2023-12-26

Assignee

Inventors

Cpc classification

International classification

Abstract

The present disclosure provides antibody sequences found in antibodies that bind to human CD25. In particular, the present disclosure provides sequences of anti-human CD25 antibodies, which do not block the binding of CD25 to IL-2 or IL-2 signalling. Antibodies and antigen-binding portions thereof including such sequences can be used in pharmaceutical compositions and methods of treatment, in particular for treating cancer.

Claims

1. An antibody or antigen-binding fragment thereof, comprising: a) a variable heavy chain region comprising the amino acid sequence of SEQ ID NO:1, SEQ ID NO:2, or SEQ ID NO:3; and b) a variable light chain region comprising the amino acid sequence of SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, or SEQ ID NO:7.

2. The antibody or antigen-binding fragment thereof of claim 1, comprising: a) a variable heavy chain region comprising the amino acid sequence of SEQ ID NO: 1 and a variable light chain region comprising the amino acid sequence of SEQ ID NO: 4; b) a variable heavy chain region comprising the amino acid sequence of SEQ ID NO: 1 and a variable light chain region comprising the amino acid sequence of SEQ ID NO: 5; c) a variable heavy chain region comprising the amino acid sequence of SEQ ID NO: 1 and a variable light chain region comprising the amino acid sequence of SEQ ID NO: 6; d) a variable heavy chain region comprising the amino acid sequence of SEQ ID NO: 1 and a variable light chain region comprising the amino acid sequence of SEQ ID NO: 7; e) a variable heavy chain region comprising the amino acid sequence of SEQ ID NO: 2 and a variable light chain region comprising the amino acid sequence of SEQ ID NO: 4; f) a variable heavy chain region comprising the amino acid sequence of SEQ ID NO: 2 and a variable light chain region comprising the amino acid sequence of SEQ ID NO: 5; g) a variable heavy chain region comprising the amino acid sequence of SEQ ID NO: 2 and a variable light chain region comprising the amino acid sequence of SEQ ID NO: 6; h) a variable heavy chain region comprising the amino acid sequence of SEQ ID NO: 2 and a variable light chain region comprising the amino acid sequence of SEQ ID NO: 7; i) a variable heavy chain region comprising the amino acid sequence of SEQ ID NO: 3 and a variable light chain region comprising the amino acid sequence of SEQ ID NO: 4; j) a variable heavy chain region comprising the amino acid sequence of SEQ ID NO: 3 and a variable light chain region comprising the amino acid sequence of SEQ ID NO: 5; k) a variable heavy chain region comprising the amino acid sequence of SEQ ID NO: 3 and a variable light chain region comprising the amino acid sequence of SEQ ID NO: 6; or l) a variable heavy chain region comprising the amino acid sequence of SEQ ID NO: 3 and a variable light chain region comprising the amino acid sequence of SEQ ID NO: 7.

3. The antibody or antigen-binding fragment thereof of claim 1, wherein the antibody or antigen-binding fragment thereof is a monoclonal antibody, a Fab fragment, a F(ab)2 fragment, a single chain variable fragment (scFv), a scFv-Fc fragment, or a single chain antibody (scAb).

4. The antibody or antigen-binding fragment thereof of claim 1, wherein the antibody is selected from the group consisting of IgG1, IgG2, IgG3, and IgG4 isotype antibodies.

5. The antibody or antigen-binding fragment thereof of claim 1, wherein the antibody or antigen-binding fragment thereof is comprised in a bispecific antibody, a multispecific antibody, or an immunoconjugate further comprising a therapeutic or diagnostic agent.

6. The antibody or antigen-binding fragment thereof of claim 1, wherein the antibody or antigen-binding fragment thereof binds the extracellular domain of human CD25.

7. The antibody or antigen-binding fragment thereof of claim 1, wherein the antibody or antigen-binding fragment thereof binds cells expressing human CD25 on their surface and is an anti-CD25 Antibody Agent.

8. The antibody or antigen-binding fragment thereof of claim 1, wherein the antibody or antigen-binding fragment does not inhibit the binding of Interleukin-2 (IL-2) to CD25.

9. The antibody or antigen-binding fragment thereof of claim 1, wherein the antibody or antigen-binding fragment does not inhibit the signalling of Interleukin-2 (IL-2) via CD25.

10. The antibody or an antigen-binding fragment thereof of claim 1, wherein the antibody or antigen-binding fragment thereof is afucosylated.

11. The antibody or antigen-binding fragment thereof of claim 1, wherein the antibody or an antigen-binding fragment thereof specifically binds to an epitope of human CD25, wherein the epitope comprises one or more amino acid residues comprised in amino acids 150 to 163 (YQCVQGYRALHRGP) or amino acids 166 to 180 (SVCKMTHGKTRWTQP) of SEQ ID NO:8.

12. The antibody or antigen-binding fragment thereof of claim 1, wherein the antibody or an antigen-binding fragment thereof specifically binds to an epitope of human CD25, wherein the epitope comprises amino acids 150 to 163 (YQCVQGYRALHRGP) of SEQ ID NO: 8 and amino acids 166 to 180 (SVCKMTHGKTRWTQP) of SEQ ID NO: 8.

13. A nucleic acid molecule encoding the antibody or antigen-binding fragment thereof of claim 1.

14. A nucleic acid vector comprising the nucleic acid molecule of claim 13.

15. A host cell comprising the nucleic acid vector of claim 14.

16. A method for producing an antibody or antigen-binding fragment thereof comprising culturing the host cell of claim 15.

17. A composition comprising an antibody or antigen-binding fragment thereof of claim 1 and a pharmaceutically acceptable carrier or excipient.

18. A method of treating cancer in a subject, comprising administering to the subject an effective amount of the composition of claim 17.

19. The method of claim 18, further comprising administering, simultaneously or sequentially in any order, a second agent to the subject.

20. The method of claim 19, wherein the second agent is an immune checkpoint inhibitor or a cancer vaccine.

21. The method of claim 20, wherein the second agent is an immune checkpoint inhibitor, wherein the immune check point inhibitor is a PD-1 antagonist.

22. The method of claim 21, wherein the PD-1 antagonist is an anti-PD-1 antibody or an anti-PD-L1 antibody.

23. The method of claim 18, wherein the subject has a solid tumour.

24. The method of claim 18, wherein the subject has a haematological cancer tumour.

25. A method of depleting regulatory T cells in a tumour in a subject comprising the step of administering an effective amount of the composition of claim 17.

26. The method according to claim 25, wherein the subject has a solid tumour.

27. The method according to claim 25, wherein the subject has a haematological cancer.

Description

BRIEF DESCRIPTION OF DRAWINGS

(1) FIG. 1: Relevant protein sequences of Antibody 1, Antibody 2, Antibody 3, Antibody 4, Antibody 5, Antibody 6, Antibody 7, Antibody 8, Antibody 9, Antibody 10, Antibody 11, and Antibody 12. Heavy chain sequences: (A)SEQ ID NO:1, (B)SEQ ID NO:2 and (C)SEQ ID NO:3. Light chain sequences (D)SEQ ID NO:4, (E)SEQ ID NO:5, (F)SEQ ID NO:6 and (G)SEQ ID NO:7. The putative CDRs for each chain are underlined (Kabat definition).

(2) FIG. 2: Consensus sequence of human CD25 (Uniprot code P01589) (SEQ ID NO:8). The extracellular domain of mature CD25, corresponding to amino acids 22-240, is underlined. The position of the epitope of the antibodies as preliminarily identified, aCD25ep-a and aCD25ep-b, is indicated.

(3) FIG. 3: Characterization of Antibody 1, Antibody 2, Antibody 3, Antibody 4, Antibody 5, Antibody 6, Antibody 7, Antibody 8, Antibody 9, Antibody 10, Antibody 11, and Antibody 12 binding to CD25 expressed on Karpas 299 cells at increasing antibody concentrations and comparing with human IgG1 isotype control.

(4) FIG. 4: SPR based analysis of purified the antibodies (IgG1) to rhCD25 his tagged on the Biacore 2000. (A) Antibody 1, (B) Antibody 2, (C) Antibody 3, (D) Antibody 4, (E) Antibody 5, (F) Antibody 6, (G) Antibody 7, (H) Antibody 8, (I) Antibody 9, (J) Antibody 10, (K) Antibody 11 and (L) Antibody 12.

(5) FIG. 5: Competition assays in the Octet. Binding the first Ab (Antibody 10) to the immobilized rhCD25 followed by a second Ab, Daclizumab (A) or Basiliximab (B).

(6) FIG. 6: Characterization of Antibody 1, Antibody 2, Antibody 3, Antibody 4, Antibody 5, Antibody 6, Antibody 7, Antibody 8, Antibody 9, Antibody 10, Antibody 11, and Antibody 12 compared to human IgG1 isotype control, Daclizumab-Hyp, or in the absence of a primary antibody in respect to blocking IL-2 signalling in a STAT5 phosphorylation assay using PBMCs of human origin. Cells were incubated with 10 g/ml antibody followed by increasing concentrations of IL-2 (as shown in the Figures). Analysis was restricted to percentage of CD3-positive cells phosphorylating STAT5.

(7) FIG. 7: Functional characterization of Antibody 10 compared to an anti-human CD25 Fc silent control antibody in respect to inducing ADCC in a Reporter Bioassay. CD25 expressing SR-786 cells were co-cultured with Jurkat T cells genetically engineered to express FcRIIIa and an NFAT-response element that drives luciferase expression (NFAT-RE-luc2) in the presence of varying concentrations of antibodies (as shown in the Figures).

(8) FIG. 8: Functional characterization of Antibody 10 compared to an anti-human CD25 Fc silent control antibody in respect to phagocytosis of in-vitro differentiated Treg cells in an ADCP assay. Tregs were co-cultured with MCSF differentiated Macrophages in the presence of varying concentrations of antibodies (as shown in the Figures). Two colour flow cytometric analysis was performed with CD14+ stained Macrophages and eFluor450-dye labelled Tregs. Residual target cells were defined as cells that were eFluor450-dye.sup.+/CD14.sup.. Dual-labelled cells (eFluor450-dye+/CD14+) were considered to represent phagocytosis of targets by Macrophages. Phagocytosis of target cells was calculated with the following equation: % Phagocytosis=100[(percent dual positive)/(percent dual positive+percent residual targets)].

(9) FIG. 9: Functional characterization of Antibody 3 (A) and Antibody 11 (B) compared to an anti-human CD25 Fc silent control antibody in respect to phagocytosis of in-vitro differentiated Treg cells in an ADCP assay. Tregs were co-cultured with MCSF differentiated Macrophages in the presence of varying concentrations of antibodies (as shown in the Figures). Two colour flow cytometric analysis was performed with CD14+ stained Macrophages and eFluor450-dye labelled Tregs. Residual target cells were defined as cells that were eFluor450-dye.sup.+/CD14.sup.. Dual-labelled cells (eFluor450-dye+/CD14+) were considered to represent phagocytosis of targets by Macrophages. Phagocytosis of target cells was calculated with the following equation: % Phagocytosis=100[(percent dual positive)/(percent dual positive+percent residual targets)].

(10) FIG. 10: Evaluation of the therapeutic activity of 7D4 mIgG2a, an anti-mouse CD25 non-IL-2 blocking, Treg depleting antibody alone (D) and in combination with an IL-2 neutralizing antibody (E) or an IL-2 blocking antibody (F) in mice bearing CT26 syngeneic colon tumours in female BALB/c mice. The activity of mouse IgG2a control (A), an IL-2 neutralizing antibody alone (B) and an IL-2 blocking antibody alone (C) were tested for comparison.

DETAILED DESCRIPTION OF CERTAIN EMBODIMENTS

(11) Below are provided certain definitions of terms, technical means, and embodiments used herein, many or most of which confirm common understanding of those skilled in the art.

(12) Administration: As used herein, the term administration refers to the administration of a composition to a subject. Administration to an animal subject (e.g., to a human) may be by any appropriate route. For example, in some embodiments, administration may be bronchial (including by bronchial instillation), buccal, enteral, intra-arterial, intra-dermal, intra-gastric, intra-medullary, intra-muscular, intra-nasal, intra-peritoneal, intra-thecal, intra-venous, intra-ventricular, within a specific organ or tissue (e. g. intra-hepatic, intra-tumoral, peri-tumoral, etc), mucosal, nasal, oral, rectal, subcutaneous, sublingual, topical, tracheal (including by intra-tracheal instillation), transdermal, vaginal and vitreal. The administration may involve intermittent dosing. Alternatively, administration may involve continuous dosing (e.g., perfusion) for at least a selected period of time. As is known in the art, antibody therapy is commonly administered parenterally, e.g. by intravenous, subcutaneous, or intratumoral injection (e.g., particularly when high doses within a tumour are desired).

(13) Agent: The term agent as used herein may refer to a compound or entity of any chemical class including, for example, polypeptides, nucleic acids, saccharides, small molecules, metals, or combinations thereof. Specific embodiments of agents that may be utilized in accordance with the present invention include small molecules, drugs, hormones, antibodies, antibody fragments, aptamers, nucleic acids (e.g., siRNAs, shRNAs, antisense oligonucleotides, ribozymes), peptides, peptide mimetics, etc. An agent may be or comprise a polymer.

(14) Antibody: As used herein, the term antibody refers to a polypeptide that includes canonical immunoglobulin sequence elements sufficient to confer specific binding to a particular target antigen, such as CD25, human CD25 in particular, and human CD25 extracellular domain. As is known in the art, intact antibodies as produced in nature are approximately 150 kD tetrameric agents comprised of two identical heavy chain polypeptides (about 50 kD each) and two identical light chain polypeptides (about 25 kD each) that associate with each other into what is commonly referred to as a Y-shaped structure. Each heavy chain is comprised of at least four domains (each about 110 amino acids long), an amino-terminal variable (VH) domain (located at the tips of the Y structure), followed by three constant domains: CH1, CH2, and the carboxy-terminal CH3 (located at the base of the Y's stem). A short region, known as the switch, connects the heavy chain variable and constant regions. The hinge connects CH2 and CH3 domains to the rest of the antibody. Two disulfide bonds in this hinge region connect the two heavy chain polypeptides to one another in an intact antibody. Each light chain is comprised of two domainsan amino-terminal variable (VL) domain, followed by a carboxy-terminal constant (CL) domain, separated from one another by another switch. Intact antibody tetramers are comprised of two heavy chain-light chain dimers in which the heavy and light chains are linked to one another by a single disulfide bond; two other disulfide bonds connect the heavy chain hinge regions to one another, so that the dimers are connected to one another and the tetramer is formed. Naturally produced antibodies are also glycosylated, typically on the CH2 domain, and each domain has a structure characterized by an immunoglobulin fold formed from two beta sheets (e.g., 3-, 4-, or 5-stranded sheets) packed against each other in a compressed antiparallel beta barrel. Each variable domain contains three hypervariable loops known as complement determining regions (CDR1, CDR2, and CDR3; as understood in the art, for example determined according to Kabat numbering scheme) and four somewhat invariant framework regions (FR1, FR2, FR3, and FR4). When natural antibodies fold, the FR regions form the beta sheets that provide the structural framework for the domains, and the CDR loop regions from both the heavy and light chains are brought together in three-dimensional space so that they create a single hypervariable antigen-binding site located at the tip of the Y structure. The Fc region of naturally-occurring antibodies binds to elements of the complement system, and also to receptors on effector cells, including for example effector cells that mediate cytotoxicity. As is known in the art, affinity and/or other binding attributes of Fc regions for Fc receptors can be modulated through glycosylation or other modification that can improve the developability of the antibody (Jarasch A et al., 2015).

(15) In some embodiments, antibodies produced and/or utilized in accordance with the present invention include glycosylated Fc domains, including Fc domains with modified or engineered such glycosylation. For purposes of the present invention, in certain embodiments, any polypeptide or complex of polypeptides that includes sufficient immunoglobulin domain sequences as found in natural antibodies can be referred to and/or used as an antibody, whether such polypeptide is naturally produced (e.g., generated by an organism reacting to an antigen), or produced by recombinant engineering, chemical synthesis, or other artificial system or methodology. In some embodiments, an antibody is polyclonal or oligoclonal, that is generated as a panel of antibodies, each associated to a single antibody sequence and binding more or less distinct epitopes within an antigen (such as different epitopes within human CD25 extracellular domain that are associated to different reference anti-CD25 antibodies).

(16) Polyclonal or oligoclonal antibodies can be provided in a single preparation for medical uses as described in the literature (Kearns J D et al., 2015). In some embodiments, an antibody is monoclonal. In some embodiments, an antibody has constant region sequences that are characteristic of human antibodies. In some embodiments, antibody sequence elements are humanized, as is known in the art. Moreover, the term antibody as used herein, can refer in appropriate embodiments (unless otherwise stated or clear from context) to any of the art-known or developed constructs or formats for utilizing antibody structural and functional features in alternative presentation, for instance as antigen-binding fragments as defined below. For example, an antibody utilized in accordance with the present invention is in a format selected from, but not limited to, intact IgG, IgE and IgM, bi- or multi-specific antibodies (e.g., Zybodies, etc), single chain variable domains (scFv), polypeptide-Fc fusions, Fabs, cameloid antibodies, heavy-chain shark antibody (IgNAR), masked antibodies (e.g., Probodies), or fusion proteins with polypeptides that allow expression and exposure on the cell surface (as scFv within constructs for obtaining artificial T cell receptors that are used to graft the specificity of a monoclonal antibody onto a T cell). A masked antibody can comprise a blocking or mask peptide that specifically binds to the antigen binding surface of the antibody and interferes with the antibody's antigen binding. The mask peptide is linked to the antibody by a cleavable linker (e.g. by a protease). Selective cleavage of the linker in the desired environment, e.g. in the tumour environment, allows the masking/blocking peptide to dissociate, enabling antigen binding to occur in the tumour, and thereby limiting potential toxicity issues. In some embodiments, an antibody may lack a covalent modification (e.g., attachment of a glycan) that it would have if produced naturally. Alternatively, an antibody may contain a covalent modification (e.g., attachment of a glycan, a payload [e.g., a detectable moiety, a therapeutic moiety, a catalytic moiety, etc.], or other pendant group [e.g., poly-ethylene glycol, etc.]).

(17) Non-IL-2 Blocking Antibody Agent: The anti-CD25 Antibody Agents and antigen-binding fragments of the present invention are non-IL-2 blocking antibody agents. The term Non-IL-2 blocking antibody agent is used herein to refer to those anti-CD25 antibody agents (e.g. anti-CD25 non-IL-2 blocking antibodies) that are capable of specific binding to the CD25 subunit of the IL-2 receptor without blocking the binding of IL-2 to CD25 or signalling of IL-2 via CD25. The anti-CD25 Antibody Agents allow at least 50% of IL-2 signaling in response to IL-2 binding to CD25 compared to the level of signaling in the absence of the anti-CD25 Antibody Agent. Preferably the anti-CD25 Antibody Agents allow at least 75% of IL-2 signaling in response to CD25 compared to the level of signaling in the absence of the anti-CD25 Antibody Agent.

(18) The CD25 subunit of the IL-2 receptor is also known as the alpha subunit of the IL-2 receptor and is found on activated T cells, regulatory T cells, activated B cells, some thymocytes, myeloid precursors and oligodendrocytes. CD25 associates with CD122 and CD132 to form a heterotrimeric complex that acts as the high-affinity receptor for IL-2. The consensus sequence of human CD25 is shown in FIG. 2.

(19) Specific binding, bind specifically, and specifically bind are understood to mean that the antibody or antigen-binding fragment has a dissociation constant (K.sub.d) for the antigen of interest of less than about 10.sup.6 M, 10.sup.7 M, 10.sup.8 M, 10.sup.9 M, 10.sup.10 M, 10.sup.11 M or 10.sup.12 M. In a preferred embodiment, the dissociation constant is less than 10.sup.8 M, for instance in the range of 10.sup.9 M, 10.sup.10 M, 10.sup.11 M or 10.sup.12 M.

(20) Non-IL-2 blocking, as used herein and references to non-blocking, does not block and the like (with respect to the non-blocking of IL-2 binding to CD25 in the presence of the anti-CD25 antibody) include embodiments wherein the anti-CD25 antibody or antigen-binding fragment inhibit less than 50% of IL-2 signalling compared to IL-2 signalling in the absence of the antibodies. In particular embodiments of the invention as described herein, the anti-CD25 antibody or antigen-binding fragment inhibits less than about 40%, 35%, 30%, preferably less than about 25% of IL-2 signalling compared to IL-2 signaling in the absence of the antibodies. Anti-CD25 non-IL-2 blocking antibodies allow binding to CD25 without interfering with IL-2 binding to CD25, or without substantially interfering with IL-2 binding to CD25. References herein to a non-IL-2 blocking antibody may alternatively be expressed as an anti-CD25 antibody that does not inhibit the binding of interleukin 2 to CD25 or as an anti-CD25 antibody that does not inhibit the signalling of IL-2.

(21) Some anti-CD25 Antibody Agents may allow binding of IL-2 to CD25, but still block signalling via the CD25 receptor. Such Antibody Agents are not within the scope of the present invention. Instead, the non-IL-2 blocking anti-CD25 Antibody Agents allow binding of IL-2 to CD25 to facilitate at least 50% of the level of signalling via the CD25 receptor compared to the signalling in the absence of the anti-CD25 Antibody Agent.

(22) IL-2 signalling via CD25, may be measured by methods as discussed in the Example and as known in the art. Comparison of IL-2 signalling in the presence and absence of the anti-CD25 antibody agent can occur under the same or substantially the same conditions.

(23) In some embodiments, IL-2 signalling can be determined by measuring by the levels of phosphorylated STAT5 protein in cells, using a standard Stat-5 phosphorylation assay. For example a Stat-5 phosphorylation assay to measure IL-2 signalling may involve culturing PMBC cells in the presence of the anti-CD25 antibody at a concentration of 10 ug/ml for 30 mins and then adding varying concentrations of IL-2 (for example 10U/ml or varying concentrations of 0.25 U/ml, 0.74 U/ml, 2.22 U/ml, 6.66 U/ml or 20 U/ml) for 10 mins. Cells may then be permeabilized and levels of STAT5 protein can then be measured with a fluorescent labelled antibody to a phosphorylated STAT5 peptide analysed by flow cytometry. The percentage blocking of IL-2 signalling can be calculated as follows: % blocking=100[(% Stat5.sup.+ cells No Antibody group% Stat5.sup.+ cells 10 ug/ml Antibody group)/(% Stat5.sup.+ cells No Ab group)].

(24) In some embodiments, the anti-CD25 Antibody Agents as described herein are characterized in that they deplete tumour-infiltrating regulatory T cells efficiently, in particular within tumours.

(25) In some embodiments, anti-CD25 Antibody Agents are characterised in that they bind Fcy receptor with high affinity, preferably at least one activating Fcy receptor with high affinity. Preferably the antibody binds to at least one activatory Fcy receptor with a dissociation constant of less than about 10.sup.6M, 10.sup.7M, 10.sup.8M, 10.sup.9M or 10.sup.10M. In some embodiments, the anti-CD25 Antibody agents are characterized by other features related to Fc receptors, in particular: (a) bind to Fc receptors with an activatory to inhibitory ratio (NI) superior to 1; and/or (b) bind to at least one of FcRI, FcRIIc, and FcRIIIa with higher affinity than it binds to FcRIIb.

(26) In some embodiments, the CD25 Antibody agent is an IgG1 antibody, preferably a human IgG1 antibody, which is capable of binding to at least one Fc activating receptor. For example, the antibody may bind to one or more receptor selected from FcRI, FcRIIa, FcRIIc, FcRIIIa and FcRIIIb. In some embodiments, the antibody is capable of binding to FcRIIIa. In some embodiments, the antibody is capable of binding to FcRIIIa and FcRIIa and optionally FcRI. In some embodiments, the antibody is capable of binding to these receptors with high affinity, for example with a dissociation constant of less than about 10.sup.7M, 10.sup.9M, 10.sup.9M or 10.sup.10M. In some embodiments, the antibody binds an inhibitory receptor, FcRIIb, with low affinity. In one aspect, the antibody binds FcRIIb with a dissociation constant higher than 10.sup.7M, higher than 10.sup.6M or higher than 10.sup.5M.

(27) In some embodiments, desirable anti-CD25 Antibody Agents as described herein are characterized in that they are cytotoxic towards or induce phagocytosis of CD25 expressing cells (e.g. expressing high levels of CD25) such as immune suppressive cells or tumour cells (e.g., in each case, that express CD25 on their surfaces). In some embodiments, an anti-CD25 Antibody Agent is characterized by an activity (e.g., level and/or type) reasonably comparable to that of Antibody 1, Antibody2, Antibody3, Antibody 4, Antibody 5, Antibody 6, Antibody 7, Antibody 8, Antibody 9, Antibody 10, Antibody 11, or Antibody 12, with respect to immune cells (e.g., when contacted with immune cells, and particularly with immune cells that express CD25) and tumour cells. In some embodiments, a relevant activity is or comprises depleting Treg cells (e.g. in a solid tumour), or certain CD25-expressing cells (e.g., high-expressing cells) by ADCP, ADCC or CDC, promotion of T cell, B cell or NK cell expansion), skewing of T cell repertoire, etc., and combinations thereof. In some embodiments, an increased level and/or activity, or decreased level and/or increased or no change in level or activity, is assessed or determined relative to that observed under otherwise comparable conditions in absence of the entity(ies) or moiety(ies). Alternatively, or additionally, in some embodiments, an increased level and/or activity is comparable to or greater than that observed under comparable conditions when a reference anti-CD25 Antibody Agents (e.g., an appropriate reference anti-CD25 antibody, which in many embodiments is a CD25 antibody that blocks IL-2 binding to CD25, such as Daclizumab or Basiliximab) is present. In many embodiments, an anti-CD25 Antibody Agent for use in accordance with the present disclosure is or comprises an entity or moiety that binds, directly or indirectly, to CD25, typically to its extracellular domain. In some embodiments, an anti-CD25 Antibody Agent is, comprises, an antigen-binding fragment (e.g., comprising all heavy chain CDRs, all light chain CDRs, all CDRs, a heavy chain variable region, a light chain variable region, or both heavy and light chain variable regions) thereof, an affinity matured variant thereof (or an antigen-binding fragment or variant thereof), or any alternative format (e.g., humanized, multispecific, alternate isotype, etc) of any of the foregoing. Alternatively, or additionally, in some embodiments, an anti-CD25 Antibody Agent as described herein may be characterized by one or more features that may be features that are advantageous for screening, manufacturing, (pre-clinical testing, and/or for identifying relevant epitope within human CD25, such as the sequence identified as aCD25ep-a or aCD25ep-b), and/or for formulation, administration, and/or efficacy in particular contexts (e.g., for cancer therapy), as disclosed herein.

(28) Antigen: The term antigen, as used herein, refers to an agent that elicits an immune response and/or that binds to a T cell receptor (e.g., when presented by an MHC molecule) and/or B cell receptor. An antigen that elicits a humoral response involve the production of antigen-specific antibodies or, as shown in the Examples for CD25 extracellular domain, can be used for screening antibody libraries and identifying candidate antibody sequences to be further characterized.

(29) Antigen-binding Fragment: As used herein, the term Antigen-binding Fragment encompasses agents that include or comprise one or more portions of an antibody as described herein sufficient to confer on the antigen-binding fragment and ability to specifically bind to the Antigen targeted by the antibody. For example, in some embodiments, the term encompasses any polypeptide or polypeptide complex that includes immunoglobulin structural elements sufficient to confer specific binding. Exemplary antigen-binding fragments include, but are not limited to Small Modular ImmunoPharmaceuticals (SMIPs), single chain antibodies, cameloid antibodies, single domain antibodies (e.g., shark single domain antibodies), single chain or Tandem diabodies (TandAb), VHHs, Anticalins, Nanobodies, minibodies, BiTEs, ankyrin repeat proteins or DARPINs, Avimers, a DART, a TCR-like antibody, Adnectins, Affilins, Trans-bodies, Affibodies, a TrimerX, MicroProteins, Centyrins, CoVX bodies, BiCyclic peptides, Kunitz domain derived antibody constructs, or any other antibody fragments so long as they exhibit the desired biological activity. In some embodiments, the term encompasses other protein structures such as stapled peptides, antibody-like binding peptidomimetics, antibody-like binding scaffold proteins, monobodies, and/or other non-antibody proteins scaffold, for example as reviewed in the literature (Vazquez-Lombardi R et al., 2015). In some embodiments, an antigen-binding fragment is or comprises a polypeptide whose amino acid sequence includes one or more structural elements recognized by those skilled in the art as a complementarity determining region (CDR). In some embodiments an antigen-binding fragment is or comprises a polypeptide whose amino acid sequence includes an amino acid sequence that is substantially identical to one found in an anti-CD25 antibody as described herein (e.g., in an amino acid sequence of Antibody 1, Antibody 2, Antibody 3, Antibody 4, Antibody 5, Antibody 6, Antibody 7, Antibody 8, Antibody 9, Antibody 10, Antibody 11, or Antibody 12). In some embodiments an antigen-binding fragment is or comprises a polypeptide whose amino acid sequence includes at least one heavy chain amino acid sequence comprising SEQ ID NO: 1, 2 or 3 and/or at least one light chain amino acid sequence comprising SEQ ID NO: 4, 5, 6 or 7) that is either identical in sequence or contains a small number (e.g., 1, 2, 3, or 4) more amino acid alterations (e.g., substitutions, additions, or deletions; in many cases, substitutions) relative to such a reference sequence, while maintaining binding to the target of the antibody from which the reference sequence was derived. In some embodiments, an antigen-binding fragment is or comprises a polypeptide or complex thereof that includes all three CDRs (or, in some embodiments, sequences substantially identical thereto) from a heavy or light chain of a reference antibody (e.g., Antibody 1, Antibody 2, Antibody 3, Antibody 4, Antibody 5, Antibody 6, Antibody 7, Antibody 8, Antibody 9, Antibody 10, Antibody 11, or Antibody 12). In some embodiments, an antigen-binding fragment is or comprises a polypeptide or complex thereof that includes the heavy and/or light chain variable domains (or, in some embodiments, sequences substantially identical thereto) of a reference antibody (e.g., Antibody 1, Antibody 2, Antibody 3, Antibody 4, Antibody 5, Antibody 6, Antibody 7, Antibody 8, Antibody 9, Antibody 10, Antibody 11, or Antibody 12). In some embodiments, the term antigen-binding fragment encompasses non-peptide and non-protein structures, such as nucleic acid aptamers, for example, RNA aptamers and DNA aptamers. An aptamer is an oligonucleotide (e.g., DNA, RNA, or an analog or derivative thereof) that binds to a particular target, such as a polypeptide. Aptamers are short synthetic single-stranded oligonucleotides that specifically bind to various molecular targets such as small molecules, proteins, nucleic acids, and even cells and tissues. These small nucleic acid molecules can form secondary and tertiary structures capable of specifically binding proteins or other cellular targets, and are essentially a chemical equivalent of antibodies. Aptamers are highly specific, relatively small in size, and non-immunogenic. Aptamers are generally selected from a biopanning method known as SELEX (Systematic Evolution of Ligands by Exponential enrichment) (See for example Ellington et al, 1990; Tuerk et al., 1990; Ni et al., 2011). Methods of generating an apatmer for any given target are well known in the art. Peptide aptamers including affimers are also encompassed. An affimer is a small, highly stable protein engineered to display peptide loops which provide a high affinity binding surface for a specific target protein. It is a protein of low molecular weight, 12-14 kDa, derived from the cysteine protease inhibitor family of cystatins. Affimer proteins are composed of a scaffold, which is a stable protein based on the cystatin protein fold. They display two peptide loops and an N-terminal sequence that can be randomized to bind different target proteins with high affinity and specificity similar to antibodies. Stabilization of the peptide upon the protein scaffold constrains the possible conformations which the peptide may take, thus increasing the binding affinity and specificity compared to libraries of free peptides.

(30) Biological Sample. As used herein, the terms biological sample or sample typically refers to a sample obtained or derived from a biological source (e.g., a tissue or organism or cell culture) of interest, as described herein. A source of interest may be an organism, such as an animal or human. The biological sample may comprise biological tissue or fluid.

(31) Cancer: The terms cancer, malignancy, neoplasm, tumor, tumour, and carcinoma, are used interchangeably herein to refer to cells that exhibit relatively abnormal, uncontrolled, and/or autonomous growth, so that they exhibit an aberrant growth phenotype characterized by a significant loss of control of cell proliferation. In general, cells of interest for detection or treatment in the present application include precancerous (e.g., benign), malignant, pre-metastatic, metastatic, and non-metastatic cells. The teachings of the present disclosure may be relevant to any and all cancers. To give but a few, non-limiting examples, in some embodiments, teachings of the present disclosure are applied to one or more cancers such as, for example, hematopoietic cancers including leukemias, lymphomas (Hodgkins and non-Hodgkins), myelomas and myeloproliferative disorders; sarcomas, melanomas, adenomas, carcinomas of solid tissue, squamous cell carcinomas of the mouth, throat, larynx, and lung, liver cancer, genitourinary cancers such as prostate, cervical, bladder, uterine, and endometrial cancer and renal cell carcinomas, bone cancer, pancreatic cancer, skin cancer, cutaneous or intraocular melanoma, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, head and neck cancers, breast cancer, gastro-intestinal cancers and nervous system cancers, benign lesions such as papillomas, and the like. The antibodies of the invention can be used for the treatment of CD25+ expressing tumours. The treatment of cancer involving CD25 expressing tumours can include but is not limited to lymphomas, such as such as Hodgkin lymphomas, and lymphocytic leukemias, such as chronic lymphocytic leukemia (CLL).

(32) Combination Therapy: As used herein, the term combination therapy refers to those situations in which a subject is simultaneously exposed to two or more therapeutic regimens (e.g., two or more therapeutic agents). In some embodiments, two or more agents may be administered simultaneously. Alternatively, such agents may be administered sequentially; otherwise, such agents are administered in overlapping dosing regimens.

(33) Comparable: As used herein, the term comparable refers to two or more agents, entities, situations, effects, sets of conditions, etc., that may not be identical to one another but that are sufficiently similar to permit comparison (e.g., by level and/or activity) there between so that conclusions may reasonably be drawn based on differences or similarities observed. Such comparable sets of conditions, effects, circumstances, individuals, or populations are characterized by a plurality of substantially identical features and one or a small number of varied features. Those of ordinary skill in the art will understand, in context, what degree of identity is required in any given circumstance for two or more such agents, entities, situations, sets of conditions, effects, or populations, etc. to be considered comparable.

(34) Comprising: A composition or method described herein as comprising one or more named elements or steps is open-ended, meaning that the named elements or steps are essential, but other elements or steps may be added within the scope of the composition or method. It is also understood that any composition or method described as comprising (or which comprises) one or more named elements or steps also describes the corresponding, more limited composition or method consisting essentially of (or which consists essentially of) the same named elements or steps, meaning that the composition or method includes the named essential elements or steps and may also include additional elements or steps that do not materially affect the basic and novel characteristic(s) of the composition or method.

(35) Depleted: As used herein, references to depleted or depleting (with respect to the depletion of regulatory Tcells by an anti-CD25 antibody agent) it is meant that the number, ratio or percentage of Tregs is decreased relative to when an anti-CD25 antibody that does not inhibit the binding of interleukin 2 to CD25 is not administered. In particular embodiments of the invention as described herein, over about 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 99% of the tumour-infiltrating regulatory T cells are depleted.

(36) Dosage Form: As used herein, the term dosage form refers to a physically discrete unit of an active agent (e.g., a therapeutic or diagnostic agent) for administration to a subject. Each unit contains a predetermined quantity of active agent. In some embodiments, such quantity is a unit dosage amount (or a whole fraction thereof) appropriate for administration in accordance with a dosing regimen that has been determined to correlate with a desired or beneficial outcome when administered to a relevant population (i.e., with a therapeutic dosing regimen). Those of ordinary skill in the art appreciate that the total amount of a therapeutic composition or agent administered to a particular subject is determined by one or more attending physicians and may involve administration of multiple dosage forms.

(37) Dosing Regimen: As used herein, the term dosing regimen refers to a set of unit doses (typically more than one) that are administered individually to a subject, typically separated by periods of time. In some embodiments, a given therapeutic agent has a recommended dosing regimen, which may involve one or more doses. In some embodiments, a dosing regimen comprises a plurality of doses each of which are separated from one another by a time period of the same length. Alternatively, a dosing regimen comprises a plurality of doses and at least two different time periods separating individual doses. In some embodiments, all doses within a dosing regimen are of the same unit dose amount. Alternatively, different doses within a dosing regimen are of different amounts. In some embodiments, a dosing regimen comprises a first dose in a first dose amount, followed by one or more additional doses in a second dose amount different from the first dose amount. A dosing regimen may comprise a first dose in a first dose amount, followed by one or more additional doses in a second dose amount same as the first dose amount. In some embodiments, a dosing regimen is correlated with a desired or beneficial outcome when administered across a relevant population (i.e., is a therapeutic dosing regimen).

(38) Epitope: As used herein, the term epitope refers to a portion of an antigen that is bound by an antibody or antigen-binding fragment. In some embodiments, where the antigen is a polypeptide, an epitope is conformational in that it is comprised of portions of an antigen that are not covalently contiguous in the antigen but that are near to one another in three-dimensional space when the antigen is in a relevant conformation. For example, for CD25, conformational epitopes are those comprised of amino acid residues that are not contiguous in CD25 extracellular domain; linear epitopes are those comprised of amino acid residues that are contiguous in CD25 extracellular domain. In some embodiments, epitopes utilized in accordance with the present invention are provided by means of reference to those bound by anti-CD25 Antibody Agents provided herein (e.g., by Antibody 1, Antibody 2, Antibody 3, Antibody 4, Antibody 5, Antibody 6, Antibody 7, Antibody 8, Antibody 9, Antibody 10, Antibody 11, or Antibody 12 and defined as aCD25ep-a and aCD25ep-b). Means for determining the exact sequence and/or particularly amino acid residues of the epitope for the antibody are known in the literature and in the Examples, including competition with peptides, from antigen sequences, binding to CD25 sequence from different species, truncated, and/or mutagenized (e.g. by alanine scanning or other site-directed mutagenesis), phage display-based screening, or (co-) crystallography techniques.

(39) Identity: Percent (%) identity as known in the art is the relationship between two or more polypeptide sequences or two or more polynucleotide sequences, as determined by comparing the sequences. In the art, identity also means the degree of sequence relatedness between polypeptide or polynucleotide sequences, as the case may be, as determined by the match between strings of such sequences. While there exist a number of methods to measure identity between two polypeptides or two polynucleotide sequences, methods commonly employed to determine identity are codified in computer programs. Preferred computer programs to determine identity between two sequences include, but are not limited to, GCG program package (Devereux, et al., Nucleic Acids Research, 12, 387 (1984), BLASTP, BLASTN, and FASTA (Atschul et al., J. Molec. Biol. 215, 403 (1990)). The percent identity of two amino acid sequences or of two nucleic acid sequences is determined by aligning the sequences for optimal comparison purposes (e.g., gaps can be introduced in the first sequence for best alignment with the sequence) and comparing the amino acid residues or nucleotides at corresponding positions. The best alignment is an alignment of two sequences which results in the highest percent identity. The percent identity is determined by the number of identical amino acid residues or nucleotides in the sequences being compared (i.e., % identity=number of identical positions/total number of positions100). Generally, references to % identity herein refer to % identity along the entire length of the molecule, unless the context specifies or implies otherwise.

(40) Immune effector cell: An immune effector cell refers to an immune cell which is involved in the effector phase of an immune response. Exemplary immune cells include a cell of a myeloid or lymphoid origin, e.g., lymphocytes (e.g., B cells and T cells including cytolytic T cells (CTLs)), killer cells, natural killer cells, macrophages, monocytes, eosinophils, neutrophils, polymorphonuclear cells, granulocytes, mast cells, and basophils.

(41) Immune effector cells involved in the effector phase of an immune response may express specific Fc receptors and carry out specific immune functions. An effector cell can induce antibody-dependent cell-mediated cytotoxicity (ADCC), e.g., a neutrophil capable of inducing ADCC. An effector cell can also induce antibody-dependent cell-mediated phagocytosis (ADCP), which consists in phagocytosis of a target antigen, target cell, or microorganism, e.g. macrophages capable of ADCP. For example, monocytes, macrophages, neutrophils, eosinophils, and lymphocytes which express FcR are involved in specific killing of target cells and presenting antigens to other components of the immune system, or binding to cells that present antigens. As discussed, the antibodies according to the present invention may be optimised for ability to induce ADCC and/or ADCP.

(42) Regulatory T cells: As used herein, regulatory T cells (Treg, Treg cells, or Tregs) refer to a lineage of CD4+T lymphocytes specialized in controlling autoimmunity, allergy and infection. Typically, they regulate the activities of T cell populations, but they can also influence certain innate immune system cell types. Tregs are usually identified by the expression of the biomarkers CD4, CD25 and Foxp3, and low expression of CD127. Naturally occurring Treg cells normally constitute about 5-10% of the peripheral CD4+T lymphocytes. However, within a tumour microenvironment (i.e. tumour-infiltrating Treg cells), they can make up as much as 20-30% of the total CD4+T lymphocyte population.

(43) Activated human Treg cells may directly kill target cells such as effector T cells and APCs through perforin- or granzyme B-dependent pathways; cytotoxic T-lymphocyte-associated antigen 4 (CTLA4+) Treg cells induce indoleamine 2,3-dioxygenase (IDO) expression by APCs, and these in turn suppress T-cell activation by reducing tryptophan; Treg cells, may release interleukin-10 (IL-10) and transforming growth factor (TGF) in vivo, and thus directly inhibit T-cell activation and suppress APC function by inhibiting expression of MHC molecules, CD80, CD86 and IL-12. Treg cells can also suppress immunity by expressing high levels of CTLA4 which can bind to CD80 and CD86 on antigen presenting cells and prevent proper activation of effector T cells

(44) Patient: As used herein, the term patient or subject refers to any organism to which a provided composition is or may be administered, e.g., for experimental, diagnostic, prophylactic, cosmetic, and/or therapeutic purposes. Typical patients include animals (e.g., mammals such as mice, rats, rabbits, non-human primates, and/or humans). In some embodiments, a patient is a human. In some embodiments, a patient is suffering from or susceptible to one or more disorders or conditions. A patient may display one or more symptoms of a disorder or condition, or may have been diagnosed with one or more disorders or conditions (such as cancer, or presence of one or more tumours). In some embodiments, the patient is receiving or has received certain therapy to diagnose and/or to treat such disease, disorder, or condition.

(45) Pharmaceutically Acceptable: As used herein, the term pharmaceutically acceptable applied to the carrier, diluent, or excipient used to formulate a composition as disclosed herein means that the carrier, diluent, or excipient must be compatible with the other ingredients of the composition and not deleterious to the recipient thereof.

(46) Pharmaceutical Composition: As used herein, the term pharmaceutical composition refers to a composition in which an active agent is formulated together with one or more pharmaceutically acceptable carriers. In some embodiments, active agent is present in unit dose amount appropriate for administration in a therapeutic regimen that shows a statistically significant probability of achieving a predetermined therapeutic effect when administered to a relevant population. A pharmaceutical compositions may be formulated for administration in solid or liquid form, including those adapted for the following: oral administration, for example, drenches (aqueous or non-aqueous solutions or suspensions), tablets, e.g., those targeted for buccal, sublingual, and systemic absorption, boluses, powders, granules, pastes for application to the tongue; parenteral administration, for example, by subcutaneous, intramuscular, intravenous, intratumoral, or epidural injection as a sterile solution or suspension, or sustained-release formulation; topical application, for example, as a cream, ointment, or a controlled-release patch or spray applied to skin, lungs, or oral cavity; intravaginally, intrarectally, sublingually, ocularly, transdermally, nasally, pulmonary, and to other mucosal surfaces.

(47) Solid Tumour: As used herein, the term solid tumour refers to an abnormal mass of tissue that usually does not contain cysts or liquid areas. Solid tumours may be benign or malignant. Different types of solid tumours are named for the type of cells that form them. Examples of solid tumours are sarcomas (including cancers arising from transformed cells of mesenchymal origin in tissues such as cancellous bone, cartilage, fat, muscle, vascular, hematopoietic, or fibrous connective tissues), carcinomas (including tumours arising from epithelial cells), melanomas, lymphomas, mesothelioma, neuroblastoma, retinoblastoma, etc. Cancers involving solid tumours include, without limitations, brain cancer, lung cancer, stomach cancer, duodenal cancer, esophagus cancer, breast cancer, colon and rectal cancer, renal cancer, bladder cancer, kidney cancer, pancreatic cancer, prostate cancer, ovarian cancer, melanoma, mouth cancer, sarcoma, eye cancer, thyroid cancer, urethral cancer, vaginal cancer, neck cancer, lymphoma, and the like.

(48) Therapeutically Effective Amount: As used herein, the term therapeutically effective amount means an amount (e.g., of an agent or of a pharmaceutical composition) that is sufficient, when administered to a population suffering from or susceptible to a disease and/or condition in accordance with a therapeutic dosing regimen, to treat such disease and/or condition. A therapeutically effective amount is one that reduces the incidence and/or severity of, stabilizes, and/or delays onset of, one or more symptoms of the disease, disorder, and/or condition. Those of ordinary skill in the art will appreciate that a therapeutically effective amount does not in fact require successful treatment be achieved in a particular subject.

(49) Treatment: As used herein, the term treatment (also treat or treating) refers to any administration of a substance (e.g., provided anti-CD25 Antibody Agent, e.g. as exemplified by Antibody 1, Antibody 2, Antibody 3, Antibody 4, Antibody 5, Antibody 6, Antibody 7, Antibody 8, Antibody 9, Antibody 10, Antibody 11, or Antibody 12, or any other agent) that partially or completely alleviates, ameliorates, relives, inhibits, delays onset of, reduces severity of, and/or reduces incidence of one or more symptoms. In some embodiments, treatment may involve the direct administration of anti-CD25 Antibody Agent (for example, as an injectable, aqueous composition, optionally comprising a pharmaceutically acceptable carrier, excipient and/or adjuvant, for use for intravenous, intratumoral or peritumoral injection) or the administration using a regimen comprising obtaining cells from the subject (e.g. from the blood, a tissue, or a tumour, with or without a selection on the basis of presence, or absence, of the expression of a marker), contacting said cells with an anti-CD25 Antibody Agent ex vivo, and administering such cells to the subject (with or without a selection on the basis of presence, or absence, of the expression of a marker).

(50) Dosing and Administration. Pharmaceutical compositions comprising an anti-CD25 Antibody Agent as described herein (e.g. an anti-CD25 antibody or antigen-binding fragment or variant thereof, for example comprising amino acid sequences of Antibody 1, Antibody 2, Antibody 3, Antibody 4, Antibody 5, Antibody 6, Antibody 7, Antibody 8, Antibody 9, Antibody 10, Antibody 11, or Antibody 12) for use in accordance with the present invention may be prepared for storage and/or delivery using any of a variety of techniques and/or technologies known and/or available to those skilled in the art. In some embodiments, a provided anti-CD25 Antibody Agent is administered according to a dosing regimen approved by a regulatory authority such as the United States Food and Drug Administration (FDA) and/or the European Medicines Agency (EMEA), e.g., for the relevant indication. In some embodiments, a provided anti-CD25 Antibody Agent is administered in combination with one or more other agents or therapies, which may themselves be administered according to a dosing regimen approved by a regulatory authority such as the United States Food and Drug Administration (FDA) and/or the European Medicines Agency (EMEA), e.g., for the relevant indication. In some embodiments however, use of a provided anti-CD25 Antibody Agent may permit reduced dosing (e.g., lower amount of active in one or more doses, smaller number of doses, and/or reduced frequency of doses) of an approved agent or therapy used in combination with the anti-CD25 Antibody Agent therapy. In some embodiments, dosing and/or administration may be adapted to other drugs that also administered, the patient status, and/or the format of anti-CD25 Antibody Agent (e.g. modified as an immunoconjugate, a single domain antibody, or a bispecific antibody).

(51) Moreover, in some embodiments, it may be desirable to tailor dosing regimens, and particularly to design sequential dosing regimens, based on timing and/or threshold expression levels of CD25, whether for particular cell types, particular tumours or types thereof, or particular patient populations (e.g., carrying genetic markers). In some such embodiments, therapeutic dosing regimens may be combined with or adjusted in light of detection methods that assess expression of one or more inducible markers or other criteria prior to and/or during therapy.

(52) In some embodiments, dosing and administration according to the present invention utilizes active agent having a desired degree of purity combined with one or more physiologically acceptable carriers, excipients or stabilizers in any or variety of forms. These include, for example, liquid, semi-solid and solid dosage forms, such as liquid solutions (e.g., injectable and infusible solutions), dispersions or suspensions, tablets, pills, powders, liposomes and suppositories. A preferred form may depend on the intended mode of administration and/or therapeutic application, typically in the form of injectable or infusible solutions, such as compositions similar to those used for treating of human subjects with antibodies.

(53) In some embodiments, ingredient(s) can be prepared with carriers that protect the agent(s) against rapid release and/or degradation, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as polyanhydrides, polyglycolic acid, polyorthoesters, and polylactic acid. In general, each active agent is formulated, dosed, and administered in therapeutically effective amount using pharmaceutical compositions and dosing regimens that are consistently with good medical practice and appropriate for the relevant agent(s) (e.g., for agents such as antibodies). Pharmaceutical compositions containing active agents can be administered by any appropriate method known in the art, including, without limitation, oral, mucosal, by-inhalation, topical, buccal, nasal, rectal, or parenteral (e.g. intravenous, infusion, intratumoral, intranodal, subcutaneous, intraperitoneal, intramuscular, intradermal, transdermal, or other kinds of administration involving physical breaching of a tissue of a subject and administration of the pharmaceutical composition through such breach).

(54) In some embodiments, a dosing regimen for a particular active agent may involve intermittent or continuous (e.g., by perfusion or slow release system) administration, for example to achieve a particular desired pharmacokinetic profile or other pattern of exposure in one or more tissues or fluids of interest in the subject. In some embodiments, different agents administered in combination may be administered via different routes of delivery and/or according to different schedules. Alternatively, or additionally, in some embodiments, one or more doses of a first active agent is administered substantially simultaneously with, and in some embodiments via a common route and/or as part of a single composition with, one or more other active agents.

(55) Factors to be considered when optimizing routes and/or dosing schedule for a given therapeutic regimen may include, for example, the particular cancer being treated (e.g., type, stage, location, etc.), the clinical condition of a subject (e.g., age, overall health, weight, etc.), the site of delivery of the agent, the nature of the agent (e.g. an antibody or other protein-based compound), the mode and/or route of administration of the agent, the presence or absence of combination therapy, and other factors known to medical practitioners.

(56) Those skilled in the art will appreciate, for example, that a specific route of delivery may impact dose amount and/or required dose amount may impact route of delivery. For example, where particularly high concentrations of an agent within a particular site or location (e.g., within a tissue or organ) are of interest, focused delivery (e.g., intratumoral delivery) may be desired and/or useful. In some embodiments, one or more features of a particular pharmaceutical composition and/or of a utilized dosing regimen may be modified over time (e.g., increasing or decreasing amount of active in any individual dose, increasing or decreasing time intervals between doses, etc.), for example in order to optimize a desired therapeutic effect or response (e.g., a therapeutic or biological response that is related to the functional features of an anti-CD25 Antibody Agent as described herein). In general, type, amount, and frequency of dosing of active agents in accordance with the present invention in governed by safety and efficacy requirements that apply when relevant agent(s) is/are administered to a mammal, preferably a human. In general, such features of dosing are selected to provide a particular and typically detectable, therapeutic response as compared with what is observed absent therapy. In context of the present invention, an exemplary desirable therapeutic response may involve, but is not limited to, inhibition of and/or decreased tumour growth, tumour size, metastasis, one or more of the symptoms and side effects that are associated with the tumour, as well as increased apoptosis of cancer cells, therapeutically relevant decrease or increase of one or more cell marker or circulating markers and the like. Such criteria can be readily assessed by any of a variety of immunological, cytological, and other methods that are disclosed in the literature. For example, the therapeutically effective amount of anti-CD25 Antibody Agents, alone or in combination with a further agent, can be determined as being sufficient to enhance killing of cancer cells as described in the Examples.

(57) A therapeutically effective amount of an anti-CD25 Antibody Agent as active agent or composition comprising such agent can be readily determined using techniques available in the art including, for example, considering one or more factors such as the disease or condition being treated, the stage of the disease, the age and health and physical condition of the mammal being treated, the severity of the disease, the particular compound being administered, and the like.

(58) In some embodiments, therapeutically effective amount is an effective dose (and/or a unit dose) of an active agent that may be at least about 0.01 mg/kg body weight, at least about 0.05 mg/kg body weight; at least about 0.1 mg/kg body weight, at least about 1 mg/kg body weight, at least about 5 mg/kg body weight, at least about 10 mg/kg body weight, or more (e.g. 0.01, 0.1, 0.3, 0.5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, or 50 mg/kg body weight). It will be understood by one of skill in the art that in some embodiments such guidelines may be adjusted for the molecular weight of the active agent. The dosage may also be varied for route of administration, the cycle of treatment, or consequently to dose escalation protocol that can be used to determine the maximum tolerated dose and dose limiting toxicity (if any) in connection to the administration of the isolated antibody or antigen-binding fragment or variant thereof comprising Antibody 1, Antibody 2, Antibody 3, Antibody 4, Antibody 5, Antibody 6, Antibody 7, Antibody 8, Antibody 9, Antibody 10, Antibody 11, or Antibody 12 amino acid sequences at increasing doses.

(59) Therapeutic compositions typically should be sterile and stable under the conditions of manufacture and storage. The composition can be formulated as a solution, microemulsion, dispersion, liposome, or other ordered structure suitable to high drug concentration. Sterile injectable solutions can be prepared by incorporating the antibody in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, followed by filtered sterilization. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and other required ingredients from those enumerated above. In the case of powders for preparing sterile injectable solutions, the preferred methods of preparation are vacuum drying and freeze drying that yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile filtered solution. The proper fluidity of a solution can be maintained, for example, by using a coating, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. Prolonged absorption of injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.

(60) The formulation of each agent should desirably be sterile, as can be accomplished by filtration through sterile filtration membranes, and then packaged, or sold in a form suitable for bolus administration or for continuous administration. Injectable formulations may be prepared, packaged, or sold in unit dosage form, such as in ampules or in multi dose containers containing a preservative. Formulations for parenteral administration include, but are not limited to, suspensions, solutions, emulsions in oily or aqueous vehicles, pastes, and implantable sustained-release or biodegradable formulations as discussed herein. Sterile injectable formulations may be prepared using a non-toxic parenterally acceptable diluent or solvent, such as water or 1,3 butanediol. Other parentally-administrable formulations which are useful include those which comprise the active ingredient in microcrystalline form, in a liposomal preparation, or as a component of biodegradable polymer systems. Compositions for sustained release or implantation may comprise pharmaceutically acceptable polymeric or hydrophobic materials such as an emulsion, an ion exchange resin, a sparingly soluble polymer or salt.

(61) Each pharmaceutical composition for use in accordance with the present invention may include pharmaceutically acceptable dispersing agents, wetting agents, suspending agents, isotonic agents, coatings, antibacterial and antifungal agents, carriers, excipients, salts, or stabilizers are non-toxic to the subjects at the dosages and concentrations employed. A non-exhaustive list of such additional pharmaceutically acceptable compounds includes buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; salts containing pharmacologically acceptable anions (such as acetate, benzoate, bicarbonate, bisulfate, isothionate, lactate, lactobionate, laurate, malate, maleate, salicylate, stearate, subacetate, succinate, tannate, tartrate, teoclate, tosylate, thiethiodode, and valerate salts); preservatives (such as octadecyidimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; sodium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, glutamic acid, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g., Zn-protein complexes); and/or non-ionic surfactants such as TWEEN, PLURONICS or polyethylene glycol (PEG).

(62) In some embodiments, where two or more active agents are utilized in accordance with the present invention, such agents can be administered simultaneously or sequentially. In some embodiments, administration of one agent is specifically timed relative to administration of another agent. In some embodiments, desired relative dosing regimens for agents administered in combination may be assessed or determined empirically, for example using ex vivo, in vivo and/or in vitro models; in some embodiments, such assessment or empirical determination is made in vivo, in a particular patient or patient population (e.g., so that a correlation is made).

(63) In some embodiments, one or more active agents utilized in practice of the present invention is administered according to an intermittent dosing regimen comprising at least two cycles. Where two or more agents are administered in combination, and each by such an intermittent, cycling, regimen, individual doses of different agents may be interdigitated with one another. In some embodiments, one or more doses of the second agent is administered a period of time after a dose of an anti-CD25 Antibody Agent as described herein. In some embodiments, each dose of the second agent is administered a period of time after a dose of anti-CD25 Antibody Agent as described herein. In some embodiments, one or more doses of the second agent is administered a period of time before a dose of an anti-CD25 Antibody Agent. In some embodiments, an anti-CD25 Antibody Agent as described herein can be also administered in regimens that involve not only subsequent administration by the same route but also by alternating administration routes such as by sub-cutaneous (or intramuscular) administration and intra-tumoral administration, within one or more cycles of treatments over one, two, four or more weeks, repeating such cycle with the same regimen (or by extending the interval between administrations), depending of patient responses. Also, in some embodiments, the precise regimen followed (e.g., number of doses, spacing of doses (e.g., relative to each other or to another event such as administration of another therapy), amount of doses, etc. may be different for one or more cycles as compared with one or more other cycles.

(64) By using any of the routes of administrations, dosages, and/or regimens as described herein, an anti-CD25 Antibody Agent as described herein can be identified, characterized, and/or validated, for example, taking into account one or more criteria that are measured in the patients using biopsies, blood samples, and/or other clinical criteria. In some embodiments, as an alternative or in addition to direct evaluation of tumour size and/or metastasis, therapeutic efficacy of an anti-CD25 Antibody Agent as described herein can be determined in methods wherein one or more different general criteria are evaluated: direct cytotoxicity on cancer cells (apoptosis and necrosis of cancer cells), increase of tumour infiltrating, immune cells (such as CD4-positive and/or CD8-positive tumour infiltrating T cells), increase in immune cells that circulates in blood (total populations or specific sub-populations of lymphocytes, NK cells, monocytes, dendritic cells, macrophages, B cells, etc.), and/or presenting some differential expression pre-versus post-treatment only in either responding or non-responding patients (as determined by RNA sequencing, mass flow cytometry, and/or other mass sequencing approach). Alternatively, or additionally, in some embodiments, such identification, characterization, and/or validation may involve the follow-up at molecular level by screening the mRNA and/or protein expression of one or more specific proteins or sets of proteins. In some embodiments, one or more such techniques may allow identification or relevant information for evaluating the response to an anti-CD25 Antibody Agent as described herein, for example that may be is related to tissue distribution and/or markers for specific cell populations within (or nearby) the tumour and/or circulating in blood.

(65) Such approaches and immune-biological data may allow determination not only of one or more efficacy and/or safety parameters or characteristics, but in some embodiments, can provide a rationale for choosing a particular dose, route or dosing regimen, for example that may be utilized in one or more clinical trials for a given indication, alone and/or in combination with other drugs, standard-of-care protocols, or immunotherapies that can provide further therapeutic benefits. Thus, in a series of further embodiments of the invention, an anti-CD25 Antibody Agent as described herein is used in a method of treating a patient suffering from a disease (such as cancer) or preventing a disease (such as cancer) after determining the combined presence (and/or absence) of expression at RNA and/or protein level for one or more genes in cells or tissues of the patient (such as a tumour, a blood sample, or a blood fraction), post- or pre-treatment with such a formulation. Such methods may allow therefore defining one or more biomarkers, or a more complex gene expression signature (or cell population distribution) that is associated to the therapeutically effective amount of a desirable anti-CD25 Antibody Agent, the therapeutically relevant biomarker(s) that predicts that a subject may have an anti-tumour or anti-infective response after the treatment with an anti-CD25 Antibody Agent as described herein, or the therapeutically relevant biomarker(s) that predicts that a subject may respond to the treatment with a compound after the treatment with an anti-CD25 Antibody Agent.

(66) Alternatively, or additionally, in some embodiments, dosing and administration for a particular anti-CD25 Antibody Agent as disclosed herein can be preliminarily established and/or later evaluated in view of CD25 expression in human cancers and/or other human tissues, for example by gathering data about CD25 distribution in stromal and/or immune subsets in various cancers, tissues and/or patients. Such data can be generated by using common technologies (such as flow cytometry, mass cytometry, immunohistochemistry or mRNA expression libraries) across common cancer types and/or tissues (central nervous system, Esophagus, Stomach, Liver, Colon, Rectum, Lung, Bladder, Heart, Kidney, Thyroid, Pancreas, Uterus, Skin, Breast, Ovary, Prostate and testis) for identifying relationship between CD25 expression in various immune and non-immune subpopulations and/or its relation with cell infiltrate measures and/or cancer-relevant markers associated with sub-sets of cancer cells or immune cells (such as Foxp3 and PD-1/PD-L1). CD25 expression can be confined (or not) to immune subsets in tumour tissue (such as in NK cells and other effector or regulatory immune cells), and correlations between CD25 expression and immune checkpoint inhibitors can be determined if being positive, thus suggesting appropriate uses of anti-CD25 Antibody Agents in combinations with compounds targeting such immune checkpoint inhibitor, for example a PD-1 antagonist, such as an anti-PD-1 antibody or an anti-PD-L1 antibody.

(67) Articles of Manufacture and Kits; In some embodiments of the invention, an anti-CD25 Antibody Agent as described herein is provided in a separate article of manufacture. In some embodiments of the invention, an article of manufacture containing an anti-CD25 Antibody Agent is provided in or with a container with a label. Suitable containers may include, for example, bottles, vials, syringes, and test tubes. In some embodiments, a container may be formed from any or a variety of materials such as glass or plastic. In some embodiments, a container holds a composition that is effective for treating a particular disease, disorder, or condition, or stage or type thereof. In some embodiments, a container may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). For example, in some embodiments, a composition comprising an anti-CD25 Antibody Agent as described herein is packaged in clear glass vials with a rubber stopper and an aluminium seal. The label on, or associated with, the container indicates that the composition is used for treating the condition of choice.

(68) In some embodiments, an article of manufacture may further comprise a separate container comprising a pharmaceutically acceptable buffer, such as phosphate-buffered saline, Ringer's solution and dextrose solution and/or may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, syringes, and package inserts with instructions for use. For example, in some embodiments, an article of manufacture may allow providing each or the agent in an intravenous formulation as a sterile aqueous solution containing a total of 2 mg, 5 mg, 10 mg, 20 mg, 50 mg, or more that are formulated, with appropriate diluents and buffers, at a final concentration of 0.1 mg/ml, 1 mg/ml, 10 mg/ml, or at a higher concentration.

(69) In some embodiments, an anti-CD25 Antibody Agent as described herein can be provided within the kits-of-parts in the form of lyophilized is to be reconstituted with any appropriate aqueous solution that provided or not with the kits, or other types of dosage unit using any compatible pharmaceutical carrier. One or more unit dosage forms of an anti-CD25 Antibody Agent may be provided in a pack or dispenser device. Such a pack or device may, for example, comprise metal or plastic foil, such as a blister pack. In order to use correctly such kits-of-parts, it may further comprise buffers, diluents, filters, needles, syringes, and package inserts with instructions for use in the treatment of cancer.

(70) In some embodiments, instructions that are associated with an article of manufacture or the kits as described herein may be in the form of a label, a leaflet, a publication, a recording, a diagram, or any other means that can be used to inform about the correct use and/or monitoring of the possible effects of the agents, formulations, and other materials in the article of manufacture and/or in the kit. Instructions may be provided together with the article of manufacture and/or in the kit.

EXAMPLES

Example 1: Generation of Antibodies

(71) Antibodies designated Antibody 1, Antibody 2, Antibody 3, Antibody 4, Antibody 5, Antibody 6, Antibody 7, Antibody 8, Antibody 9, Antibody 10, Antibody 11 and Antibody 12, having the heavy and light chain sequences as set out in Table 1, were generated using standard techniques in the art.

(72) TABLE-US-00002 TABLE1 VHProtein VLProtein Ab1 QVQLQESGPGLVKPSETLSLTCTVSGFSLT EIVLTQSPATLSLSPGERATLSCRASSSV SYGIQWIRQPPGKGLEWIGVIWAGGSTNYN SYMHWYQQKPGQAPRPLIFATSNLASGIP SALMSRVTISKDNSKNQFSLKLSSVTAADT ARFSGSGSGTDFTLTISSLEPEDFAVYYC AVYYCARAYGYDGSWLAYWGQGTLVTVSS QQWSSNPPTFGGGTKLEIK (SEQIDNO:1) (SEQIDNO:4) Ab2 QVQLQESGPGLVKPSETLSLTCTVSGFSLT QIVLTQSPATLSLSPGERATLSCRASSSV SYGIQWIRQPPGKGLEWIGVIWAGGSTNYN SYMHWYQQKPGQAPRPLIFATSNLASGIP SALMSRVTISKDNSKNQFSLKLSSVTAADT ARFSGSGSGTDYTLTISSLEPEDFAVYYC AVYYCARAYGYDGSWLAYWGQGTLVTVSS QQWSSNPPTFGGGTKLEIK (SEQIDNO:1) P(SEQIDNO:5) Ab3 QVQLQESGPGLVKPSETLSLTCTVSGFSLT DIQMTQSPSSLSASVGDRVTITCRASSSV SYGIQWIRQPPGKGLEWIGVIWAGGSTNYN SYMHWYQQKPGKAPKPLIFATSNLASGVP SALMSRVTISKDNSKNQFSLKLSSVTAADT SRFSGSGSGTDYTLTISSLQPEDFATYYC AVYYCARAYGYDGSWLAYWGQGTLVTVSS QQWSSNPPTFGGGTKLEIK (SEQIDNO:1) (SEQIDNO:6) Ab4 QVQLQESGPGLVKPSETLSLTCTVSGFSLT QIQLTQSPSSLSASVGDRVTITCRASSSV SYGIQWIRQPPGKGLEWIGVIWAGGSTNYN SYMHWYQQKPGKSPKPLIFATSNLASGVP SALMSRVTISKDNSKNQFSLKLSSVTAADT SRFSGSGSGTDYTLTISSLQPEDFATYYC AVYYCARAYGYDGSWLAYWGQGTLVTVSS QQWSSNPPTFGGGTKLEIK (SEQIDNO:1) (SEQIDNO:7) Ab5 QVQLQESGPGLVKPSETLSLTCTVSGFSLT EIVLTQSPATLSLSPGERATLSCRASSSV SYGIQWVRQPPGKGLEWIGVIWAGGSTNYN SYMHWYQQKPGQAPRPLIFATSNLASGIP SALMSRVTISKDNSKSQFSLKLSSVTAADT ARFSGSGSGTDFTLTISSLEPEDFAVYYC AVYYCARAYGYDGSWLAYWGQGTLVTVSS QQWSSNPPTFGGGTKLEIK (SEQIDNO:2) (SEQIDNO:4) Ab6 QVQLQESGPGLVKPSETLSLTCTVSGFSLT QIVLTQSPATLSLSPGERATLSCRASSSV SYGIQWVRQPPGKGLEWIGVIWAGGSTNYN SYMHWYQQKPGQAPRPLIFATSNLASGIP SALMSRVTISKDNSKSQFSLKLSSVTAADT ARFSGSGSGTDYTLTISSLEPEDFAVYYC AVYYCARAYGYDGSWLAYWGQGTLVTVSS QQWSSNPPTFGGGTKLEIK (SEQIDNO:2) (SEQIDNO:5) Ab7 QVQLQESGPGLVKPSETLSLTCTVSGFSLT DIQMTQSPSSLSASVGDRVTITCRASSSV SYGIQWVRQPPGKGLEWIGVIWAGGSTNYN SYMHWYQQKPGKAPKPLIFATSNLASGVP SALMSRVTISKDNSKSQFSLKLSSVTAADT SRFSGSGSGTDYTLTISSLQPEDFATYYC AVYYCARAYGYDGSWLAYWGQGTLVTVSS QQWSSNPPTFGGGTKLEIK (SEQIDNO:2) (SEQIDNO:6) Ab8 QVQLQESGPGLVKPSETLSLTCTVSGFSLT QIQLTQSPSSLSASVGDRVTITCRASSSV SYGIQWVRQPPGKGLEWIGVIWAGGSTNYN SYMHWYQQKPGKSPKPLIFATSNLASGVP SALMSRVTISKDNSKSQFSLKLSSVTAADT SRFSGSGSGTDYTLTISSLQPEDFATYYC AVYYCARAYGYDGSWLAYWGQGTLVTVSS QQWSSNPPTFGGGTKLEIK (SEQIDNO:2) (SEQIDNO:7) Ab9 QVQLVESGGGVVQPGGSLRLSCAVSGFSLT EIVLTQSPATLSLSPGERATLSCRASSSV SYGIQWVRQAPGKGLEWVSVIWAGGSTNYN SYMHWYQQKPGQAPRPLIFATSNLASGIP SALMSRFTISKDNSKSTLYLQMNSLRAEDT ARFSGSGSGTDFTLTISSLEPEDFAVYYC AVYYCARAYGYDGSWLAYWGQGTLVTVSS QQWSSNPPTFGGGTKLEIK (SEQIDNO:3) (SEQIDNO:4) Ab10 QVQLVESGGGVVQPGGSLRLSCAVSGFSLT QIVLTQSPATLSLSPGERATLSCRASSSV SYGIQWVRQAPGKGLEWVSVIWAGGSTNYN SYMHWYQQKPGQAPRPLIFATSNLASGIP SALMSRFTISKDNSKSTLYLQMNSLRAEDT ARFSGSGSGTDYTLTISSLEPEDFAVYYC AVYYCARAYGYDGSWLAYWGQGTLVTVSS QQWSSNPPTFGGGTKLEIK (SEQIDNO:3) (SEQIDNO:5) Ab11 QVQLVESGGGVVQPGGSLRLSCAVSGFSLT DIQMTQSPSSLSASVGDRVTITCRASSSV SYGIQWVRQAPGKGLEWVSVIWAGGSTNYN SYMHWYQQKPGKAPKPLIFATSNLASGVP SALMSRFTISKDNSKSTLYLQMNSLRAEDT SRFSGSGSGTDYTLTISSLQPEDFATYYC AVYYCARAYGYDGSWLAYWGQGTLVTVSS QQWSSNPPTFGGGTKLEIK (SEQIDNO:3) (SEQIDNO:6) Ab12 QVQLVESGGGVVQPGGSLRLSCAVSGFSLT QIQLTQSPSSLSASVGDRVTITCRASSSV SYGIQWVRQAPGKGLEWVSVIWAGGSTNYN SYMHWYQQKPGKSPKPLIFATSNLASGVP SALMSRFTISKDNSKSTLYLQMNSLRAEDT SRFSGSGSGTDYTLTISSLQPEDFATYYC AVYYCARAYGYDGSWLAYWGQGTLVTVSS QQWSSNPPTFGGGTKLEIK (SEQIDNO:3) (SEQIDNO:7)

(73) The sequences of the complementarity determining regions (CDRs; i.e., CDR1, CDR2, and CDR3), as shown in FIG. 1, and framework regions (FRs) were defined according to Kabat numbering.

(74) Recloning, Producing, and Characterizing of antiCD25 Antibodies as Human IgG1 Expressed in Mammalian Cells:

(75) The antibodies were synthesised and cloned as human IgG1. The antibodies were expressed in mammalian cells (HEK293) HEK293. Cells were transiently transfected with heavy and light chain expression vectors and cultured for a further 6-14 days. An appropriate volume of cells were transfected to obtain approximately 1 mg of antibody. Cultures were harvested and a one-step purification performed using affinity chromatography. Human IgG1 antibodies were further characterized as described below.

(76) The antibodies can also be synthesised and cloned by the following method. Synthesis of codon optimized VH and VL coding sequences for the antibodies can be performed by Genewiz. cDNAs of variable regions can be cloned into the antibody expression vector (Icosagen, EST) containing human IgG1 heavy chain and kappa light chain constant regions (for example P01857 and P01834 respectively). Full length heavy and light chain cDNAs are verified by sequencing in final vectors and then recloned for expressing them using the QMCF Technology (Icosagen) a stable episomal expression system that uses CHO-based cells (CHOEBNALT85) and appropriate vectors for production of recombinant proteins, antibodies, CHOEBNALT85 cells are transfected with 1 g of the expression plasmids for antibody production. 48 h after the transfection 700 g/ml of G418 is added to select plasmid containing cell population. For the production, temperature is shifted to 30 C. and the cultures are additionally fed. At the end of the production the culture supernatants are clarified by centrifugation (1000 g, 30 min, and 15 C.), PMSF is added and supernatants are processed or frozen until purification. hIgG1 antibodies are purified by MabSelect SuRe affinity chromatography followed by Superdex 200 gel filtration into either PBS or PBS 100 mM L-Arg.

Example 2: Epitope Mapping of Anti-CD25 Non-IL-2 Blocking Antibodies

(77) Different sets of linear, single loop, -turn mimics, disulfide bridge mimics, discontinuous disulfide bridges, discontinuous epitope mimics peptides representing the human CD25 sequence (Uniprot record no. P01589) were synthesized using solid-phase Fmoc synthesis (Pepscan BV, The Netherlands; Timmermann P et al., 2007 J. Mol. Recognit., 20, 283-99; Langedijk J P et al., 2011, Analytical Biochemistry. 417:149-155). The binding of the antibodies to each of the synthesized peptides was tested in an ELISA (Pepscan, The Netherlands). The peptide arrays were incubated with primary antibody solution (overnight at 4 C.). After washing, the peptide arrays were incubated with a 1/1000 dilution of an appropriate antibody peroxidase conjugate (2010-05; Southern Biotech) for one hour at 25 C. After washing, the peroxidase substrate 2,2-azino-di-3-ethylbenzthiazoline sulfonate (ABTS) and 20 l/ml of 3 percent H.sub.2O.sub.2 were added. After one hour, the color development was measured. The color development was quantified with a charge coupled device (CCD)camera and an image processing system. The values obtained from the CCD camera range from 0 to 3000 mAU, similar to a standard 96-well plate ELISA-reader. To verify the quality of the synthesized peptides, a separate set of positive and negative control peptides was synthesized in parallel and screened with irrelevant, control antibodies.

(78) Results

(79) The antibodies were characterised to determine the epitopes for the non-IL-2 blocking antibodies. The results of the epitope mapping are shown in Table 2 for anti-human CD25 antibodies, Antibody 1 to Antibody 12:

(80) TABLE-US-00003 TABLE2 anti-humanCD25antibodies: Antibody Epitope1 Epitope2 Antibody1 .sub.150YQCVQGYRALHRGP.sub.163 .sub.166SVCKMTHGKTRWTQP.sub.180 Antibody2 .sub.150YQCVQGYRALHRGP.sub.163 .sub.166SVCKMTHGKTRWTQP.sub.180 Antibody3 .sub.150YQCVQGYRALHRGP.sub.163 .sub.166SVCKMTHGKTRWTQP.sub.180 Antibody4 .sub.150YQCVQGYRALHRGP.sub.163 .sub.166SVCKMTHGKTRWTQP.sub.180 Antibody5 .sub.150YQCVQGYRALHRGP.sub.163 .sub.166SVCKMTHGKTRWTQP.sub.180 Antibody6 .sub.150YQCVQGYRALHRGP.sub.163 .sub.166SVCKMTHGKTRWTQP.sub.180 Antibody-7 .sub.150YQCVQGYRALHRGP.sub.163 .sub.166SVCKMTHGKTRWTQP.sub.180 Antibody8 .sub.150YQCVQGYRALHRGP.sub.163 .sub.166SVCKMTHGKTRWTQP.sub.180 Antibody9 .sub.150YQCVQGYRALHRGP.sub.163 .sub.166SVCKMTHGKTRWTQP.sub.180 Antibody10 .sub.150YQCVQGYRALHRGP.sub.163 .sub.166SVCKMTHGKTRWTQP.sub.180 Antibody11 .sub.150YQCVQGYRALHRGP.sub.163 .sub.166SVCKMTHGKTRWTQP.sub.180 Antibody12 .sub.150YQCVQGYRALHRGP.sub.163 .sub.166SVCKMTHGKTRWTQP.sub.180

(81) The epitope mapping study that has been performed using Pepscan technology would indicate that the antibodies bind human CD25 in the region from amino acids 150 to 163 and amino acids 166 to 180 (FIG. 2) and binds human CD25 extracellular protein sequences with a Kd value in the 10.sup.8 M to 10.sup.10 M range.

Example 3: Binding of Anti-CD25 Antibodies to CD25 Expressing Cells

(82) The Antibodies are evaluated can be evaluated for binding to Karpas299 cells. Binding to CD25 expressing Karpas299 cells is examined by staining Karpas299 cells with test articles (anti-CD25 primary antibodies) starting at a concentration of 30 g/ml antibodies followed by semi-log dilution series (7-point) for 30 minutes on ice. This is followed by staining with a secondary antibody (Alexa Fluor 647-AffiniPure F(ab)2 Fragment Rabbit Anti-Human IgG Fc fragment(Jackson ImmunoResearch)) concentration of 1 g/ml for 30 minutes on ice. All samples are stained in duplicates. Live cells are gated using FSC vs SSC parameters by flow cytometry during sample acquisition. Mean fluorescence intensity (MFI) of stained cells are plotted on an XY chart, graphing MFI against the log of the concentration, and the data fit to a non-linear regression curve from which the EC50 is calculated. The results are shown in FIG. 3.

Example 4: Affinity Measurements of Anti-Human CD25 Antibodies

(83) The affinity for the anti human CD25 antibodies was determined by measuring their K.sub.D by SPR in a Biacore 2000 using a CM-5 Sensor chip with an ambient experiment temperature of 25 C. Anti-human antibody was initially immobilised across all flow cells in analysis buffer (pH 7.4, 10 mM HEPES, 150 mM NaCl, 3 mM EDTA, 0.05% Tween 20) to an RU of between 12,000-14,000 over 10 minutes. The ligand (antibody test articles) was sub sequentially loaded to a capture level between 145-190RU. The analyte (recombinant human CD25 his tagged) was then associated in analysis buffer from a 2-fold dilution starting at 400 nM with a lowest concentration of 3.13 nM for 6 minutes. Dissociation was performed in analysis buffer over 10 minutes. Regeneration steps between sample concentrations were performed in 10 mM Glycin pH1.7 for 10 minutes. A flow rate of 25 l/min was maintained throughout the process. Kinetics data were fit using a global 1:1 Langmuir model with reference subtraction. The results are shown in FIG. 4 (A) to (L).

Example 5: Anti Human CD25 Ab Competition Assay

(84) Antibody competitions were performed on a Forte Bio Octet Red96 system (Pall Forte Bio Corp., USA) using a standard sequential binding assay. 26.8 nM recombinant human CD25his tagged was loaded onto Ni-NTA Biosensors for 200s. After base line step on kinetic buffer sensors were exposed to 66.6 nM of first antibody for 600s followed by a second anti-CD25 antibody (also at 66.6 nM for 600s). Data was processed using Forte Bio Data Analysis Software 9.0. Additional binding by a second antibody indicates an unoccupied epitope (no competition for the epitope), while no binding indicates epitope blocking (competition for the epitope). The results are shown in in FIG. 5.

Example 6: In-Vitro IL-2 Signalling by STAT5 Phosphorylation Assay

(85) IL-2-blocking is characterised using a STAT5 phosphorylation assay, in which IL-2 signalling is examined. Previously frozen PBMC (Stemcell Technologies) are cultured in 96-U-bottom well plates in the presence of 10 g/ml anti-CD25 antibodies for 30 minutes before adding IL-2 (Peprotech) at 10 U/ml for 10 minutes in RPMI 1640 (Life Technologies) containing 10% FBS (Sigma), 2 mM L-Glutamine (Life Technologies) and 10,000 U/ml Pen-Strep (Sigma). IL-2 induced STAT5 phosphorylation is stopped when the cells are fixed and permeabilized with the eBioscience Foxp3/Transcription Factor Staining Buffer Set (Invitrogen) and treated with the BD Phosflow Perm Buffer III (BD Biosciences). Cells are then simultaneously stained with surface and intracellular fluorochrome labelled antibodies (STAT5-Alexa Fluor 647 clone 47/stat5/pY694 BD Bioscience, CD3-PerCP-Cy5.5 clone UCHT1 Biolegend, CD4-BV510 clone SK3 BD Bioscience, CD8-Alexa Fluor 700 clone RPA-T8 Invitrogen, CD45RA-PE-Cy7 clone HI100 Invitrogen, FoxP3-Alexa Fluor 488 clone 236A/E7 Invitrogen) and samples are acquired on the Fortessa LSR X20 Flow Cytometer (BD Bioscience) and analysed using the BD FACSDIVA software. Doublets are excluded using FCS-H versus FCS-A, and lymphocytes defined using SSC-A versus FCS-A parameters. CD3+ T cells are defined using a CD3 PerCP-Cy5.5-A versus FCS-A plot and a gate is drawn on a histogram showing count versus STAT5 Alexa Fluor 647-A to determine the population of STAT5+CD3+ T cells. The percentage blocking of IL-2 signalling is calculated as follows: % blocking=100[(% Stat5+ cells No Ab group% Stat5+ cells 10 ug/ml Ab group)/(% Stat5+ cells No Ab group)]. Further analysis of STAT5 phosphorylation by different T cell subsets (CD4+, CD8+, CD4+FoxP3+, nave and memory T cells) can also be assessed by gating on the respective subsets and analysed as above. Graphs and statistical analysis are performed using GraphPad Prism v7.

Example 7: In-Vitro T Cell Activation Assay

(86) Impact of IL-2 signalling on Teff responses is characterised in a T cell activation assay, in which intracellular granzyme B (GrB) upregulation and proliferation are examined. Previously frozen primary human Pan T cells (Stemcell Technologies) are labelled with eFluor450 cell proliferation dye (Invitrogen) according to manufacturer's recommendation, and added to 96-U-bottom well plates at 110.sup.5 cells/well in RPMI 1640 (Life Technologies) containing 10% FBS (Sigma), 2 mM L-Glutamine (Life Technologies) and 10,000 U/ml Pen-Strep (Sigma). The cells are then treated with 10 g/ml anti-CD25 antibodies or control antibodies followed by Human T-Activator CD3/CD28 (20:1 cell to bead ratio; Gibco) and incubated for 72 hrs in a 37 C., 5% CO.sub.2 humidified incubator. To assess T cell activation, cells are stained with the eBioscience Fixable Viability Dye efluor780 (Invitrogen), followed by fluorochrome labelled antibodies for surface T cell markers (CD3-PerCP-Cy5.5 clone UCHT1 Biolegend, CD4-BV510 clone SK3 BD Bioscience, CD8-Alexa Fluor 700 clone RPA-T8 Invitrogen, CD45RA-PE-Cy7 clone HI100 Invitrogen, CD25-BUV737 clone 2A3 BD Bioscience) and then fixed and permeabilized with the eBioscience Foxp3/Transcription Factor Staining Buffer Set (Invitrogen) before staining for intracellular GrB and intranuclear FoxP3 (Granzyme B-PE clone GB11 BD Bioscience, FoxP3-APC clone 236A/E7). Samples are acquired on the Fortessa LSR X20 Flow Cytometer (BD Bioscience) and analysed using the BD FACSDIVA software. Doublets are excluded using FCS-H versus FCS-A, and lymphocytes defined using SSC-A versus FCS-A parameters. CD4.sup.+ and CD8.sup.+ T cell subsets gated from the live CD3.sup.+ lymphocytes are assessed using a GrB-PE-A versus proliferation eFluor450-A plot. Results are presented as percentage of proliferating GrB positive cells from the whole CD4.sup.+ T cell population. Graphs and statistical analysis is performed using Graph Pad Prism v7. (results not shown)

Example 8: In Vitro ADCC Assay

(87) Antibody-dependent cell-mediated cytotoxicity assays (ADCC assays) were performed for the characterization of anti-human CD25 antibodies using CD25-expressing SR786 cells, herein called target (T) cells, incubated for 20 minutes at 37 C. with different concentrations of anti-human CD25 antibodies in a low-IgG FBS-supplemented medium (4% FBS in RPMI). ADCC effector (E) cells are then added to the cell-mAbs mixture at an E:T ratio of 1:1. The effector cells are Jurkat cells stably transfected with a luciferase reporter system and over-expressing CD16/FcgammaRIIIA (Promega). After overnight incubation at 37 C., the cells are lysed and luciferase activity is measured by mean of luminescence release from the hydrolysis of a specific luciferase substrate, following manufacturer instruction (Promega Bio-Glow protocol). Graphs of the raw data are produced using Graphpad Prism v7 to generate dose response curves. The Relative Luminescences Units (RLU) are plotted on a XY chart against the log of the antibody concentration, and the data fir to a non-linear regression curve from which the EC50 is calculated.

Example 9: In Vitro ADPC Assay

(88) Antibody-dependent cell-mediated phagocytosis (ADCP) assays were performed using in-vitro differentiated Tregs as target cells and monocyte-derived macrophages as the effector cells. PBMCs were isolated from leucocyte cones by Ficoll gradient centrifugation. Monocytes (CD14+ cells) were isolated using CD14 Microbeads (Miltenyi Biotec). Monocytes were cultured for 5 days in the presence of 50 ng/ml M-CSF in RPMI 1640 (Life Technologies) containing 10% FBS (Sigma), 2 mM L-Glutamine (Life Technologies) and 10,000 U/ml Pen-Strep (Sigma), fresh media containing M-CSF is added after 3 days. Regulatory T cells (Treg) were isolated using the Human Treg Cell Differentiation Kit (R&D Systems). These cells were incubated in a 37 C., 5% CO.sub.2 humidified incubator for 5 days and labelled with eFluor450-dye (Invitrogen), as per manufacturer recommendations. At day 5, macrophages and eFluor450-dye labelled Tregs are cocultured for 4 hours at a 10 to 1 effector to target ratio in the presence of anti-CD25 antibodies or controls, as describe thereafter. Target cells (Treg) were added at 110.sup.4 cells/well while the effector cells (macrophages) were added at 110.sup.5 cells/well, for an effector to target ratio of 10 to 1. The anti-CD25 antibodies were then added at a top concentration of 1 g/ml followed by a log series (7 points) in duplicates. Cells and antibodies were incubated for 4 hours at 37 C. 5% CO.sub.2. To assess ADCP, cells were placed on ice, stained with the cell surface marker CD14 (CD14-PerCP-Cy5.5 clone MfP9 BD Biosciences) and fixed with the eBioscience fixation buffer. Two colour flow cytometric analysis was performed using the Fortessa LSR X20. Residual target cells were defined as cells that were eFluor450-dye.sup.+/CD14.sup.. Macrophages were defined as CD14.sup.+. Dual-labelled cells (eFluor450-dye+/CD14+) were considered to represent phagocytosis of targets by Macrophages. Phagocytosis of target cells was calculated with the following equation: % Phagocytosis=100[(percent dual positive)/(percent dual positive+percent residual targets)].

(89) Summary

(90) The antibodies, identified in Example 1, was further evaluated with respect to its ability to not interfere with IL-2 signalling and its capacity to kill of CD25 expressing target cells. The STAT5 assay showed that the tested antibodies did not block IL-2 signalling regardless of IL-2 concentrations tested while IL-2 signalling was completely blocked by the reference antibody Daclizumab (FIG. 6). The competition assay showed that Antibody 10 does do not compete with Daclizumab or Basiliximab (FIG. 5). Daclizumab, which has been shown to block the interaction of CD25 with IL-2 via the so-called Tac epitope (Queen C et al, 1989 and Bielekova B, 2013), and Basilizimab bind to different epitopes than Antibody 10 (FIG. 5). This can explain why Daclizumab blocks IL-2 signalling and Antibody 2 does not block the IL-2 signalling in the STAT5 phosphorylation assay (FIG. 6). Finally, the antibodies induce ADCC against CD25 expressing cancer cells (FIG. 7) and the killing of human macrophages via ADCP (FIGS. 8 and 9) when compared to the IgG1 isotype or an Fc silent CD25 targeting antibody.

(91) In conclusion, Antibodies have been characterized and demonstrates potent killing of CD25 positive cells (Tregs or cancer cell lines) and do not interfere with IL-2 signalling and consequently does not inhibit T effector responses. The Antibodies are thus Treg depleting antibodies which could be applied for the treatment of cancer, as monotherapy or in combination.

Example 10: Mouse Model Experiment

(92) Materials and Methods

(93) Therapeutic activity of a non-IL-2 blocking antibody: Female BALB/c mice obtained from Charles River were injected with 310.sup.5 CT26 tumour cells in 0% Matrigel subcutaneously in the flank, n=15 per group. Animals were randomized into treatment groups based on Day 1 bodyweight. Treatment was started on Day 6 and mice were treated with one injection of each antibody (mouse IgG2a isotype, IL-2 neutralizing antibody, PC61 mIgG1, a anti-mouse CD25 blocking IL-2 signalling of mouse IgG1 isotype, and 7D4 mIgG2a, an anti-mouse CD25 non-blocking IL-2 signalling of mouse IgG2a isotype) at 200 g/animal. Animals received either monotherapy treatments, with one group per antibody, or combination treatment of 7D4 mIgG2a and the IL-2 neutralizing antibody or 7D4 mIgG2a and PC61 mIgG1 antibody. Mice were sacrificed when the tumour volume reached 2000 mm3 or 50 days, whichever was reached first.

(94) Results

(95) The anti-CD25 depleting non-IL-2 blocking antibody 7D4 mIgG2a induced tumour rejection in treated mice, while the other antibodies showed no effect as monotherapy when compared to the isotype control mouse IgG2a. Combination with IL2-blocking antibodies, either PC61 mIgG1 or IL2 nAb, abrogates the therapeutic activity of the non-IL-2 blocking antibody 7D4 mIgG2a (FIG. 10). This demonstrates that the non-IL-2 blocking feature of 7D4 mIgG2a is key for therapeutic activity. It also suggests that the therapeutic activity of this antibody relies on anti-tumour immune response mediated by T effector cells, which are dependent on IL-2 signalling for optimal activity. These results show that the absence of IL-2/CD25 blocking activity is required for an optimal therapeutic activity of the CD25 targeting antibody and supports the use of an anti-CD25 non-IL-2 blocking antibody as described herein in cancer therapy.

EQUIVALENTS AND SCOPE

(96) Those skilled in the art will appreciate that the present invention is defined by the appended claims and not by the Examples or other description of certain embodiments included herein.

(97) Similarly, the singular forms a, an, and the include plural referents unless the context clearly dictates otherwise.

(98) Unless defined otherwise above, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Any methods and materials similar or equivalent to those described herein can also be used in the practice or testing of the present invention. Generally, nomenclatures used in connection with, and techniques of, cell and tissue culture, molecular biology, immunology, genetics and protein and nucleic acid chemistry described herein are those well known and commonly used in the art, or according to manufacturer's specifications.

(99) All publications mentioned herein are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited.

REFERENCES

(100) Beck A et al., 2017. Nat Rev Drug Discov. 16:315-337. Bielekova B., 2013. Neurotherapeutics, 10(1):55-67 Dantal J et al., 1991, Transplantation 52:110-5 Kearns J D et al., 2015. Mol Cancer Ther. 14:1625-36. Kijanka M et al., 2015. Nanomedicine. 10:161-174. Langedijk J P et al., 2011. Analytical Biochemistry. 417:149-155. Liu L, 2015. J Pharm Sci. 104:1866-84. Liu Y et al., 2014. MAbs. 6:483-92. Lowenthal J. W et al., 1985. J. Immunol., 135, 3988-3994 Moreau, J.-L et al., 1987. Eur. J. Immunol. 17, 929-935; Onishi H et al; 2012 Anticanc. Res. 32, 997-1003 Queen C et al., 1989. PNAS. 86(24):10029-10033 Redman J M et al., 2015. Mol Immunol. 67: 28-45. Setiady Y et al., 2010. Eur J Immunol. 40:780-6), Shang B et al., 2015, Sci Rep. 5:15179 Sliwkowski M & Mellman 1, 2013. Science. 341:1192-8. Timmermann P et al., 2007, J. Mol. Recognit., 20, 283-99. Volk H D et al., 1989 Clin. exp. Immunol. 76, 121-5 Vazquez-Lombardi R et al., 2015. Drug Discov Today. 20:1271-83. Smyth M et al., 2014, Immunol Cell Biol. 92, 473-4 Elpek et al., 2007 J Immunol. 178(11):6840-8; Golgher et al., 2002 Eur J Immunol. 32(11):3267-75; Jones et al., 2002; Cancer Immun. 22; 2:1 Onizuka et al., 1999 Cancer Res. 59(13):3128-33; Shimizu et al., 1999 J Immunol. 163(10):5211-8 Hodi et al., 2008, Proc. Natl. Acad. Sci. USA, 105, 3005-3010 Quezada et al., 2006, J Clin Invest. 116(7):1935-45 Vargas A et al., 2017, Immunity, 46(4):577-586) Kohm A et al., 2006, J Immunol. 176: 3301-5; Hallett W et al., 2008. Biol Blood Marrow Transplant 14:1088-1099; Fecci P et al., 2006 Clin Cancer Res. 12:4294-4305; McNeill A et al., 2007. Scand J Immunol 65: 63-9; Couper K et al., 2007. J Immunol. 178: 4136-4146; O'Mahony D et al, 2008, Blood, 112(11), 231; Oh et al, 2017, Oncotarget 8(29) 47440-4753; Kreitman R J et al, 2016, Clin Cancer Res, 22(2) 310-318; Flynn M J et al 2016, Mol Cancer Ther 15(11) 2709-2721; Ellington et al. Nature. 1990; 346(6287): 818-822; Tuerk et al., Science. 1990; 249(4968):505-510; Ni et al., Curr Med Che 2011; 18(27):4206-14 Altschul S F et al, 1997, Nucleic Acids Res. 25:33389-3402 Rajpal et al Proc Natl Acad Sci USA, 2005, 102(24):8466-71, Steinwand et al., MAbs, 2014, 6(1):204-18 Jarasch A et al; Pharm Sci. 2015 June; 104(6):1885-1898