Antibodies binding to NKG2D
20210032349 ยท 2021-02-04
Assignee
Inventors
- Stefan DENGL (Geretsried, DE)
- Guy Georges (Habach, DE)
- Ralf Hosse (Mettmenstetten, CH)
- Inja Waldhauer (Urdorf, CH)
- Christian Klein (Bonstetten, CH)
- Pablo Umana (Wollerau, CH)
Cpc classification
C07K16/2851
CHEMISTRY; METALLURGY
C07K16/2809
CHEMISTRY; METALLURGY
C07K2317/66
CHEMISTRY; METALLURGY
C07K2317/33
CHEMISTRY; METALLURGY
C07K2317/73
CHEMISTRY; METALLURGY
C07K2317/64
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
Abstract
The present invention generally relates to antibodies that bind to NKG2D, including multispecific antigen binding molecules e.g. for activation of T cells and/or NK cells. In addition, the present invention relates to polynucleotides encoding such antibodies, and vectors and host cells comprising such polynucleotides. The invention further relates to methods for producing the antibodies, and to methods of using them in the treatment of disease.
Claims
1. An antibody that binds to NKG2D, wherein the antibody comprises a first antigen binding domain, comprising (i) a heavy chain variable region (VH) comprising a heavy chain complementary determining region (HCDR) 1 of SEQ ID NO: 73, a HCDR 2 selected from the group consisting of SEQ ID NO: 74, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104 and SEQ ID NO: 105, and a HCDR 3 of SEQ ID NO: 75, and a light chain variable region (VL) comprising a light chain complementarity determining region (LCDR) 1 of SEQ ID NO: 76, a LCDR 2 of SEQ ID NO: 77 and a LCDR 3 of SEQ ID NO: 78; (ii) a VH comprising a HCDR 1 of SEQ ID NO: 65, a HCDR 2 of SEQ ID NO: 66, and a HCDR 3 of SEQ ID NO: 67, and a VL comprising a LCDR 1 of SEQ ID NO: 68, a LCDR 2 of SEQ ID NO: 69 and a LCDR 3 of SEQ ID NO: 70; (iii) a VH comprising a HCDR 1 of SEQ ID NO: 1, a HCDR 2 of SEQ ID NO: 2, and a HCDR 3 of SEQ ID NO: 3, and a VL comprising a LCDR 1 of SEQ ID NO: 4, a LCDR 2 of SEQ ID NO: 5 and a LCDR 3 of SEQ ID NO: 6; (iv) a VH comprising a HCDR 1 of SEQ ID NO: 25, a HCDR 2 of SEQ ID NO: 26, and a HCDR 3 of SEQ ID NO: 27, and a VL comprising a LCDR 1 of SEQ ID NO: 28, a LCDR 2 of SEQ ID NO: 29 and a LCDR 3 of SEQ ID NO: 30; (v) a VH comprising a HCDR 1 of SEQ ID NO: 49, a HCDR 2 of SEQ ID NO: 50, and a HCDR 3 of SEQ ID NO: 51, and a VL comprising a LCDR 1 of SEQ ID NO: 52, a LCDR 2 of SEQ ID NO: 53 and a LCDR 3 of SEQ ID NO: 54; (vi) a VH comprising a HCDR 1 of SEQ ID NO: 57, a HCDR 2 of SEQ ID NO: 58, and a HCDR 3 of SEQ ID NO: 59, and a VL comprising a LCDR 1 of SEQ ID NO: 60, a LCDR 2 of SEQ ID NO: 61 and a LCDR 3 of SEQ ID NO: 62; (vii) a VH comprising a HCDR 1 of SEQ ID NO: 9, a HCDR 2 of SEQ ID NO: 10, and a HCDR 3 of SEQ ID NO: 11, and a VL comprising a LCDR 1 of SEQ ID NO: 12, a LCDR 2 of SEQ ID NO: 13 and a LCDR 3 of SEQ ID NO: 14; (viii) a VH comprising a HCDR 1 of SEQ ID NO: 17, a HCDR 2 of SEQ ID NO: 18, and a HCDR 3 of SEQ ID NO: 19, and a VL comprising a LCDR 1 of SEQ ID NO: 20, a LCDR 2 of SEQ ID NO: 21 and a LCDR 3 of SEQ ID NO: 22; (ix) a VH comprising a HCDR 1 of SEQ ID NO: 33, a HCDR 2 of SEQ ID NO: 34, and a HCDR 3 of SEQ ID NO: 35, and a VL comprising a LCDR 1 of SEQ ID NO: 36, a LCDR 2 of SEQ ID NO: 37 and a LCDR 3 of SEQ ID NO: 38; or (x) a VH comprising a HCDR 1 of SEQ ID NO: 41, a HCDR 2 of SEQ ID NO: 42, and a HCDR 3 of SEQ ID NO: 43, and a VL comprising a LCDR 1 of SEQ ID NO: 44, a LCDR 2 of SEQ ID NO: 45 and a LCDR 3 of SEQ ID NO: 46.
2. The antibody of claim 1, wherein the first antigen binding domain comprises (i) a VH comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO: 79, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, and/or a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 80; (ii) a VH comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 71, and/or a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 72; (iii) a VH comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 7, and/or a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 8; (iv) a VH comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 31, and/or a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 32; (v) a VH comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 55, and/or a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 56; (vi) a VH comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 63, and/or a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 64; (vii) a VH comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 15, and/or a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 16; (viii) a VH comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 23, and/or a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 24; (ix) a VH comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 39, and/or a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 40; or (x) a VH comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 47, and/or a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 48.
3. The antibody of claim 1, wherein the antibody is an IgG antibody.
4. The antibody of claim 1, wherein the antibody is a full-length antibody.
5. The antibody of claim 1, wherein the antibody is an antibody fragment selected from the group of an Fv molecule, a scFv molecule, a Fab molecule, and a F(ab).sub.2 molecule.
6. The antibody of claim 1, wherein the antibody is a multispecific, particularly a bispecific, antibody.
7. The antibody of claim 1, wherein the antibody comprises a second antigen binding domain that binds to a second antigen.
8. The antibody of claim 7, wherein the second antigen is a target cell antigen.
9. The antibody of claim 1, wherein the antibody comprises an Fc domain composed of a first and a second subunit.
10. The antibody of claim 9, wherein the Fc domain is an IgG Fc domain.
11. The antibody of claim 9, wherein the Fc domain is a human Fc domain.
12. The antibody of claim 9, wherein the Fc domain comprises one or more amino acid substitution that reduces binding to an Fc receptor and/or effector function.
13. The antibody of claim 1, wherein the antibody does not bind to FcRIIIa (CD16a).
14. The antibody of claim 1, wherein the first and/or the second antigen binding domain is a Fab molecule.
15. The antibody of claim 1, wherein the first antigen binding domain is a Fab molecule wherein the variable domains VL and VH or the constant domains CL and CH1, of the Fab light chain and the Fab heavy chain are replaced by each other.
16. The antibody of claim 7, wherein the second antigen binding domain is a conventional Fab molecule.
17. The antibody of claim 7, wherein the second antigen binding domain is a Fab molecule wherein in the constant CL domain the amino acid at position 124 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat) and the amino acid at position 123 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat), and in the constant domain CH1 the amino acid at position 147 is substituted independently by glutamic acid (E), or aspartic acid (D) (numbering according to Kabat EU index) and the amino acid at position 213 is substituted independently by glutamic acid (E), or aspartic acid (D) (numbering according to Kabat EU index).
18. The antibody of claim 7, wherein the second antigen binding domain is a Fab molecule wherein the variable domains VL and VH or the constant domains CL and CH1, particularly the variable domains VL and VH, of the Fab light chain and the Fab heavy chain are replaced by each other.
19. The antibody of claim 1, wherein the first antigen binding domain is a conventional Fab molecule.
20. The antibody of claim 1, wherein the first antigen binding domain is a Fab molecule wherein in the constant domain CL the amino acid at position 124 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat) and the amino acid at position 123 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat), and in the constant domain CH1 the amino acid at position 147 is substituted independently by glutamic acid (E), or aspartic acid (D) (numbering according to Kabat EU index) and the amino acid at position 213 is substituted independently by glutamic acid (E), or aspartic acid (D) (numbering according to Kabat EU index).
21. The antibody of claim 7, wherein the first and the second antigen binding domain are each a Fab molecule and the antibody comprises an Fc domain composed of a first and a second subunit; and (i) the first antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain and the second antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the second subunit of the Fc domain, or (ii) the second antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain and the first antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the second subunit of the Fc domain.
22. The antibody of claim 9, wherein the Fc domain comprises a modification promoting the association of the first and the second subunit of the Fc domain.
23. The antibody of claim 9, wherein an amino acid residue in the CH3 domain of the first subunit of the Fc domain is replaced with an amino acid residue having a larger side chain volume, thereby generating a protuberance within the CH3 domain of the first subunit which is positionable in a cavity within the CH3 domain of the second subunit, and an amino acid residue in the CH3 domain of the second subunit of the Fc domain is replaced with an amino acid residue having a smaller side chain volume, thereby generating a cavity within the CH3 domain of the second subunit within which the protuberance within the CH3 domain of the first subunit is positionable.
24. An isolated polynucleotide encoding the antibody of claim 1.
25. A host cell comprising the isolated polynucleotide of claim 24.
26. A method of producing an antibody that binds to NKG2D, comprising the steps of (a) culturing the host cell of claim 25 under conditions suitable for the expression of the antibody and optionally (b) recovering the antibody.
27. An antibody that binds to NKG2D produced by the method of claim 26.
28. A pharmaceutical composition comprising the antibody of claim 1 and a pharmaceutically acceptable carrier.
29.-36. (canceled)
37. A method of treating a disease in an individual, comprising administering to said individual an effective amount of the antibody of claim 1.
38. The method of claim 37, further comprising administration of a T-cell activating agent, such as an antibody that binds to CD3, particularly a bispecific antibody that binds to CD3 and a target cell antigen, particularly a tumor cell antigen.
39. (canceled)
40. A method of treating a disease in an individual, comprising administering to said individual an effective amount of the antibody of the pharmaceutical composition of claim 28.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
DETAILED DESCRIPTION OF THE INVENTION
I. Definitions
[0060] Terms are used herein as generally used in the art, unless otherwise defined in the following.
[0061] As used herein, the terms first, second or third with respect to antigen binding domains etc., are used for convenience of distinguishing when there is more than one of each type of moiety. Use of these terms is not intended to confer a specific order or orientation of the moiety unless explicitly so stated.
[0062] The terms anti-NKG2D antibody and an antibody that binds to NKG2D refer to an antibody that is capable of binding NKG2D with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting NKG2D. In one aspect, the extent of binding of an anti-NKG2D antibody to an unrelated, non-NKG2D protein is less than about 10% of the binding of the antibody to NKG2D as measured, e.g., by surface plasmon resonance (SPR). In certain aspects, an antibody that binds to NKG2D has a dissociation constant (K.sub.D) of 1 M, 500 nM, 200 nM, or 100 nM. An antibody is said to specifically bind to NKG2D when the antibody has a K.sub.D of 1 M or less, as measured, e.g., by SPR. In certain aspects, an anti-NKG2D antibody binds to an epitope of NKG2D that is conserved among NKG2D from different species.
[0063] Conversely, an antibody that does not bind to a certain antigen is not capable of binding said antigen with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting said antigen. In certain aspects, an antibody that does not bind to a certain antigen has a dissociation constant (K.sub.D) of >1 M to said antigen.
[0064] The term antibody herein is used in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g. bispecific antibodies), and antibody fragments so long as they exhibit the desired antigen-binding activity.
[0065] An antibody fragment refers to a molecule other than an intact antibody that comprises a portion of an intact antibody that binds the antigen to which the intact antibody binds. Examples of antibody fragments include but are not limited to Fv, Fab, Fab, Fab-SH, F(ab).sub.2, diabodies, linear antibodies, single-chain antibody molecules (e.g. scFv and scFab), single-domain antibodies, and multispecific antibodies formed from antibody fragments. For a review of certain antibody fragments, see Hollinger and Hudson, Nature Biotechnology 23:1126-1136 (2005).
[0066] The terms full-length antibody, intact antibody, and whole antibody are used herein interchangeably to refer to an antibody having a structure substantially similar to a native antibody structure.
[0067] The term monoclonal antibody as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e. the individual antibodies comprised in the population are identical and/or bind the same epitope, except for possible variant antibodies, e.g., containing naturally occurring mutations or arising during production of a monoclonal antibody preparation, such variants generally being present in minor amounts. In contrast to polyclonal antibody preparations, which typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen. Thus, the modifier monoclonal indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method. For example, monoclonal antibodies may be made by a variety of techniques, including but not limited to the hybridoma method, recombinant DNA methods, phage-display methods, and methods utilizing transgenic animals containing all or part of the human immunoglobulin loci, such methods and other exemplary methods for making monoclonal antibodies being described herein.
[0068] An isolated antibody is one which has been separated from a component of its natural environment. In some aspects, an antibody is purified to greater than 95% or 99% purity as determined by, for example, electrophoretic (e.g., SDS-PAGE, isoelectric focusing (IEF), capillary electrophoresis) or chromatographic (e.g., ion exchange or reverse phase HPLC, affinity chromatography, size exclusion chromatography) methods. For review of methods for assessment of antibody purity, see, e.g., Flatman et al., J. Chromatogr. B 848:79-87 (2007). In some aspects, the antibodies provided by the present invention are isolated antibodies.
[0069] The term chimeric antibody refers to an antibody in which a portion of the heavy and/or light chain is derived from a particular source or species, while the remainder of the heavy and/or light chain is derived from a different source or species.
[0070] A humanized antibody refers to a chimeric antibody comprising amino acid residues from non-human CDRs and amino acid residues from human FRs. In certain aspects, a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDRs correspond to those of a non-human antibody, and all or substantially all of the FRs correspond to those of a human antibody. Such variable domains are referred to herein as humanized variable region. A humanized antibody optionally may comprise at least a portion of an antibody constant region derived from a human antibody. In some aspects, some FR residues in a humanized antibody are substituted with corresponding residues from a non-human antibody (e.g., the antibody from which the CDR residues are derived), e.g., to restore or improve antibody specificity or affinity. A humanized form of an antibody, e.g. of a non-human antibody, refers to an antibody that has undergone humanization.
[0071] A human antibody is one which possesses an amino acid sequence which corresponds to that of an antibody produced by a human or a human cell or derived from a non-human source that utilizes human antibody repertoires or other human antibody-encoding sequences. This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues. In certain aspects, a human antibody is derived from a non-human transgenic mammal, for example a mouse, a rat, or a rabbit. In certain aspects, a human antibody is derived from a hybridoma cell line. Antibodies or antibody fragments isolated from human antibody libraries are also considered human antibodies or human antibody fragments herein.
[0072] The term antigen binding domain refers to the part of an antibody that comprises the area which binds to and is complementary to part or all of an antigen. An antigen binding domain may be provided by, for example, one or more antibody variable domains (also called antibody variable regions). In preferred aspects, an antigen binding domain comprises an antibody light chain variable domain (VL) and an antibody heavy chain variable domain (VH).
[0073] The term variable region or variable domain refers to the domain of an antibody heavy or light chain that is involved in binding the antibody to antigen. The variable domains of the heavy chain and light chain (VH and VL, respectively) of a native antibody generally have similar structures, with each domain comprising four conserved framework regions (FRs) and complementarity determining regions (CDRs). See, e.g., Kindt et al., Kuby Immunology, 6.sup.th ed., W. H. Freeman & Co., page 91 (2007). A single VH or VL domain may be sufficient to confer antigen-binding specificity. Furthermore, antibodies that bind a particular antigen may be isolated using a VH or VL domain from an antibody that binds the antigen to screen a library of complementary VL or VH domains, respectively. See, e.g., Portolano et al., J. Immunol. 150:880-887 (1993); Clarkson et al., Nature 352:624-628 (1991). As used herein in connection with variable region sequences, Kabat numbering refers to the numbering system set forth by Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991).
[0074] As used herein, the amino acid positions of all constant regions and domains of the heavy and light chain are numbered according to the Kabat numbering system described in Kabat, et al., Sequences of Proteins of Immunological Interest, 5th ed., Public Health Service, National Institutes of Health, Bethesda, Md. (1991), referred to as numbering according to Kabat or Kabat numbering herein. Specifically the Kabat numbering system (see pages 647-660 of Kabat, et al., Sequences of Proteins of Immunological Interest, 5th ed., Public Health Service, National Institutes of Health, Bethesda, Md. (1991)) is used for the light chain constant domain CL of kappa and lambda isotype and the Kabat EU index numbering system (see pages 661-723) is used for the heavy chain constant domains (CH1, hinge, CH2 and CH3), which is herein further clarified by referring to numbering according to Kabat EU index or Kabat EU index numbering in this case.
[0075] The term hypervariable region or HVR, as used herein, refers to each of the regions of an antibody variable domain which are hypervariable in sequence and which determine antigen binding specificity, for example complementarity determining regions (CDRs). Generally, antibodies comprise six CDRs; three in the VH (HCDR1, HCDR2, HCDR3), and three in the VL (LCDR1, LCDR2, LCDR3). Exemplary CDRs herein include: [0076] (a) hypervariable loops occurring at amino acid residues 26-32 (L1), 50-52 (L2), 91-96 (L3), 26-32 (H1), 53-55 (H2), and 96-101 (H3) (Chothia and Lesk, J. Mol. Biol. 196:901-917 (1987)); [0077] (b) CDRs occurring at amino acid residues 24-34 (L1), 50-56 (L2), 89-97 (L3), 31-35b (H1), 50-65 (H2), and 95-102 (H3) (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)); and [0078] (c) antigen contacts occurring at amino acid residues 27c-36 (L1), 46-55 (L2), 89-96 (L3), 30-35b (H1), 47-58 (H2), and 93-101 (H3) (MacCallum et al. J. Mol. Biol. 262: 732-745 (1996)).
[0079] Unless otherwise indicated, the CDRs are determined according to Kabat et al., supra. One of skill in the art will understand that the CDR designations can also be determined according to Chothia, supra, McCallum, supra, or any other scientifically accepted nomenclature system.
[0080] Framework or FR refers to variable domain residues other than complementarity determining regions (CDRs). The FR of a variable domain generally consists of four FR domains: FR1, FR2, FR3, and FR4. Accordingly, the HVR and FR sequences generally appear in the following order in VH (or VL): FR1-HCDR1(LCDR1)-FR2-HCDR2(LCDR2)-FR3-HCDR3(LCDR3)-FR4.
[0081] Unless otherwise indicated, CDR residues and other residues in the variable domain (e.g., FR residues) are numbered herein according to Kabat et al., supra.
[0082] An acceptor human framework for the purposes herein is a framework comprising the amino acid sequence of a light chain variable domain (VL) framework or a heavy chain variable domain (VH) framework derived from a human immunoglobulin framework or a human consensus framework, as defined below. An acceptor human framework derived from a human immunoglobulin framework or a human consensus framework may comprise the same amino acid sequence thereof, or it may contain amino acid sequence changes. In some aspects, the number of amino acid changes is 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, or 2 or less. In some aspects, the VL acceptor human framework is identical in sequence to the VL human immunoglobulin framework sequence or human consensus framework sequence.
[0083] A human consensus framework is a framework which represents the most commonly occurring amino acid residues in a selection of human immunoglobulin VL or VH framework sequences. Generally, the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences. Generally, the subgroup of sequences is a subgroup as in Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, NIH Publication 91-3242, Bethesda Md. (1991), vols. 1-3.
[0084] The term immunoglobulin molecule herein refers to a protein having the structure of a naturally occurring antibody. For example, immunoglobulins of the IgG class are heterotetrameric glycoproteins of about 150,000 daltons, composed of two light chains and two heavy chains that are disulfide-bonded. From N- to C-terminus, each heavy chain has a variable domain (VH), also called a variable heavy domain or a heavy chain variable region, followed by three constant domains (CH1, CH2, and CH3), also called a heavy chain constant region. Similarly, from N- to C-terminus, each light chain has a variable domain (VL), also called a variable light domain or a light chain variable region, followed by a constant light (CL) domain, also called a light chain constant region. The heavy chain of an immunoglobulin may be assigned to one of five types, called (IgA), (IgD), (IgE), (IgG), or (IgM), some of which may be further divided into subtypes, e.g. .sub.1 (IgG.sub.1), .sub.2 (IgG.sub.2), .sub.3 (IgG.sub.3), .sub.4 (IgG.sub.4), .sub.1 (IgA.sub.1) and .sub.2 (IgA.sub.2). The light chain of an immunoglobulin may be assigned to one of two types, called kappa () and lambda (), based on the amino acid sequence of its constant domain. An immunoglobulin essentially consists of two Fab molecules and an Fc domain, linked via the immunoglobulin hinge region.
[0085] The class of an antibody or immunoglobulin refers to the type of constant domain or constant region possessed by its heavy chain. There are five major classes of antibodies: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgG.sub.1, IgG.sub.2, IgG3, IgG4, IgA.sub.1, and IgA.sub.2. The heavy chain constant domains that correspond to the different classes of immunoglobulins are called , , , , and , respectively.
[0086] A Fab molecule refers to a protein consisting of the VH and CH1 domain of the heavy chain (the Fab heavy chain) and the VL and CL domain of the light chain (the Fab light chain) of an immunoglobulin.
[0087] By a crossover Fab molecule (also termed Crossfab) is meant a Fab molecule wherein the variable domains or the constant domains of the Fab heavy and light chain are exchanged (i.e. replaced by each other), i.e. the crossover Fab molecule comprises a peptide chain composed of the light chain variable domain VL and the heavy chain constant domain 1 CH1 (VL-CH1, in N- to C-terminal direction), and a peptide chain composed of the heavy chain variable domain VH and the light chain constant domain CL (VH-CL, in N- to C-terminal direction). For clarity, in a crossover Fab molecule wherein the variable domains of the Fab light chain and the Fab heavy chain are exchanged, the peptide chain comprising the heavy chain constant domain 1 CH1 is referred to herein as the heavy chain of the (crossover) Fab molecule. Conversely, in a crossover Fab molecule wherein the constant domains of the Fab light chain and the Fab heavy chain are exchanged, the peptide chain comprising the heavy chain variable domain VH is referred to herein as the heavy chain of the (crossover) Fab molecule.
[0088] In contrast thereto, by a conventional Fab molecule is meant a Fab molecule in its natural format, i.e. comprising a heavy chain composed of the heavy chain variable and constant domains (VH-CH1, in N- to C-terminal direction), and a light chain composed of the light chain variable and constant domains (VL-CL, in N- to C-terminal direction).
[0089] The term Fc domain or Fc region herein is used to define a C-terminal region of an immunoglobulin heavy chain that contains at least a portion of the constant region. The term includes native sequence Fc regions and variant Fc regions. In one aspect, a human IgG heavy chain Fc region extends from Cys226, or from Pro230, to the carboxyl-terminus of the heavy chain. However, antibodies produced by host cells may undergo post-translational cleavage of one or more, particularly one or two, amino acids from the C-terminus of the heavy chain. Therefore, an antibody produced by a host cell by expression of a specific nucleic acid molecule encoding a full-length heavy chain may include the full-length heavy chain, or it may include a cleaved variant of the full-length heavy chain. This may be the case where the final two C-terminal amino acids of the heavy chain are glycine (G446) and lysine (K447, numbering according to Kabat EU index). Therefore, the C-terminal lysine (Lys447), or the C-terminal glycine (Gly446) and lysine (Lys447), of the Fc region may or may not be present. Amino acid sequences of heavy chains including an Fc region (or a subunit of an Fc domain as defined herein) are denoted herein without C-terminal glycine-lysine dipeptide if not indicated otherwise. In one aspect, a heavy chain including an Fc region (subunit) as specified herein, comprised in an antibody according to the invention, comprises an additional C-terminal glycine-lysine dipeptide (G446 and K447, numbering according to Kabat EU index). In one aspect, a heavy chain including an Fc region (subunit) as specified herein, comprised in an antibody according to the invention, comprises an additional C-terminal glycine residue (G446, numbering according to Kabat EU index). Unless otherwise specified herein, numbering of amino acid residues in the Fc region or constant region is according to the EU numbering system, also called the EU index, as described in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md., 1991 (see also above). A subunit of an Fc domain as used herein refers to one of the two polypeptides forming the dimeric Fc domain, i.e. a polypeptide comprising C-terminal constant regions of an immunoglobulin heavy chain, capable of stable self-association. For example, a subunit of an IgG Fc domain comprises an IgG CH2 and an IgG CH3 constant domain.
[0090] By fused is meant that the components (e.g. a Fab molecule and an Fc domain subunit) are linked by peptide bonds, either directly or via one or more peptide linkers.
[0091] The term multispecific means that the antibody is able to specifically bind to at least two distinct antigenic determinants. A multispecific antibody can be, for example, a bispecific antibody. Typically, a bispecific antibody comprises two antigen binding sites, each of which is specific for a different antigenic determinant. In certain aspects the multispecific (e.g. bispecific) antibody is capable of simultaneously binding two antigenic determinants, particularly two antigenic determinants expressed on two distinct cells.
[0092] The term valent as used herein denotes the presence of a specified number of antigen binding sites in an antigen binding molecule. As such, the term monovalent binding to an antigen denotes the presence of one (and not more than one) antigen binding site specific for the antigen in the antigen binding molecule.
[0093] An antigen binding site refers to the site, i.e. one or more amino acid residues, of an antigen binding molecule which provides interaction with the antigen. For example, the antigen binding site of an antibody comprises amino acid residues from the complementarity determining regions (CDRs). A native immunoglobulin molecule typically has two antigen binding sites, a Fab molecule typically has a single antigen binding site.
[0094] As used herein, the term antigenic determinant or antigen refers to a site (e.g. a contiguous stretch of amino acids or a conformational configuration made up of different regions of non-contiguous amino acids) on a polypeptide macromolecule to which an antigen binding domain binds, forming an antigen binding domain-antigen complex. Useful antigenic determinants can be found, for example, on the surfaces of tumor cells, on the surfaces of virus-infected cells, on the surfaces of other diseased cells, on the surface of immune cells, free in blood serum, and/or in the extracellular matrix (ECM). In a preferred aspect, the antigen is a human protein.
[0095] NKG2D refers to any native NKG2D from any vertebrate source, including mammals such as primates (e.g. humans), non-human primates (e.g. cynomolgus monkeys) and rodents (e.g. mice and rats), unless otherwise indicated. The term encompasses full-length, unprocessed NKG2D as well as any form of NKG2D that results from processing in the cell. The term also encompasses naturally occurring variants of NKG2D, e.g., splice variants or allelic variants. In one aspect, NKG2D is human NKG2D, particularly the extracellular domain (ECD) of human NKG2D. The amino acid sequence of human NKG2D and its ECD are shown in SEQ ID NO: 87 and SEQ ID NO: 88, respectively. See also UniProt (www.uniprot.org) entry P26718 (version 176). In another aspect, NKG2D is cynomolgus (Macaca fascicularis) NKG2D, particularly the ECD of cynomolgus NKG2D. The amino acid sequence of cynomolgus NKG2D and its ECD are shown in SEQ ID NO: 89 and SEQ ID NO: 90, respectively. See also UniProt entry P61252 (version 71). In another aspect, NKG2D is murine (Mus musculus) NKG2D, particularly the ECD of murine NKG2D. The amino acid sequence of murine NKG2D and its ECD are shown in SEQ ID NO: 91 and SEQ ID NO: 92, respectively. See also UniProt entry 054709 (version 151). In certain aspects the antibody of the invention binds to an epitope of NKG2D that is conserved among the NKG2D antigens from different species, particularly human and cynomolgus NKG2D. In preferred aspects, the antibody binds to human NKG2D. In one aspect the first antigen binding domain is cross-reactive for (i.e. binds to) human and cynomolgus NKG2D.
[0096] A target cell antigen as used herein refers to an antigenic determinant presented on the surface of a target cell, for example a cell in a tumor such as a cancer cell or a cell of the tumor stroma (in that case a tumor cell antigen). Preferably, the target cell antigen is not NKG2D, and/or is expressed on a different cell than NKG2D. In one aspect, the target cell antigen is CEA.
[0097] CEA stands for carcinoembryonic antigen (also known as Carcinoembryonic antigen-related cell adhesion molecule 5 (CEACAMS)). The amino acid sequence of human CEA is shown in UniProt entry P06731 (version 188). CEA as used herein refers to any native CEA from any vertebrate source, including mammals such as primates (e.g. humans), non-human primates (e.g. cynomolgus monkeys) and rodents (e.g. mice and rats), unless otherwise indicated. The term encompasses full-length, unprocessed CEA as well as any form of CEA that results from processing in the cell. The term also encompasses naturally occurring variants of CEA, e.g., splice variants or allelic variants. In one aspect, CEA is human CEA. In one aspect, CEA is cell membrane-bound CEA. In one aspect, CEA is CEA expressed on the surface of a cell, e.g. a cancer cell.
[0098] Affinity refers to the strength of the sum total of non-covalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, binding affinity refers to intrinsic binding affinity which reflects a 1:1 interaction between members of a binding pair (e.g., an antibody and an antigen). The affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (K.sub.D). Affinity can be measured by well-established methods known in the art, including those described herein. A preferred method for measuring affinity is Surface Plasmon Resonance (SPR).
[0099] An affinity matured antibody refers to an antibody with one or more alterations in one or more complementary determining regions (CDRs), compared to a parent antibody which does not possess such alterations, such alterations resulting in an improvement in the affinity of the antibody for antigen.
[0100] Reduced binding, for example reduced binding to an Fc receptor, refers to a decrease in affinity for the respective interaction, as measured for example by SPR. For clarity, the term includes also reduction of the affinity to zero (or below the detection limit of the analytic method), i.e. complete abolishment of the interaction. Conversely, increased binding refers to an increase in binding affinity for the respective interaction.
[0101] T-cell activation as used herein refers to one or more cellular response of a T lymphocyte, particularly a cytotoxic T lymphocyte, selected from: proliferation, differentiation, cytokine secretion, cytotoxic effector molecule release, cytotoxic activity, and expression of activation markers. Suitable assays to measure T cell activation are known in the art and described herein.
[0102] A T-cell activating agent as used herein refers to a molecule that is capable of inducing T cell activation, for example by binding to and activating (a component of) a T-cell receptor such as CD3. Accordingly, an exemplary T-cell activating agent may be an antibody that binds to CD3, particularly the epsilon subunit of CD3. A particular T-cell activating agent useful in the present invention is a bispecific antibody that binds to CD3 and a target cell antigen, such as a tumor cell antigen. Such T-cell activating bispecific antibody is also referred to herein as T-cell bispecific antibody or TCB.
[0103] CD3 refers to any native CD3 from any vertebrate source, including mammals such as primates (e.g. humans), non-human primates (e.g. cynomolgus monkeys) and rodents (e.g. mice and rats), unless otherwise indicated. The term encompasses full-length, unprocessed CD3 as well as any form of CD3 that results from processing in the cell. The term also encompasses naturally occurring variants of CD3, e.g., splice variants or allelic variants. In one aspect, CD3 is human CD3, particularly the epsilon subunit of human CD3 (CD3). The amino acid sequence of human CD3E is shown in UniProt (www.uniprot.org) entry P07766 (version 202). In another aspect, CD3 is cynomolgus (Macaca fascicularis) CD3, particularly cynomolgus CD3E. The amino acid sequence of cynomolgus CD3E is shown in NCBI GenBank no. BAB71849.1. In certain aspects a T-cell activating agent useful in the present invention binds to an epitope of CD3 that is conserved among the CD3 antigens from different species, particularly human and cynomolgus CD3. In preferred aspects, the T-cell activating agent binds to human CD3.
[0104] A modification promoting the association of the first and the second subunit of the Fc domain is a manipulation of the peptide backbone or the post-translational modifications of an Fc domain subunit that reduces or prevents the association of a polypeptide comprising the Fc domain subunit with an identical polypeptide to form a homodimer. A modification promoting association as used herein preferably includes separate modifications made to each of the two Fc domain subunits desired to associate (i.e. the first and the second subunit of the Fc domain), wherein the modifications are complementary to each other so as to promote association of the two Fc domain subunits. For example, a modification promoting association may alter the structure or charge of one or both of the Fc domain subunits so as to make their association sterically or electrostatically favorable, respectively. Thus, (hetero)dimerization occurs between a polypeptide comprising the first Fc domain subunit and a polypeptide comprising the second Fc domain subunit, which may be non-identical in the sense that further components fused to each of the subunits (e.g. antigen binding domains) are not the same. In some aspects, the modification promoting the association of the first and the second subunit of the Fc domain comprises an amino acid mutation in the Fc domain, specifically an amino acid substitution. In a preferred aspect, the modification promoting the association of the first and the second subunit of the Fc domain comprises a separate amino acid mutation, specifically an amino acid substitution, in each of the two subunits of the Fc domain.
[0105] The term effector functions refers to those biological activities attributable to the Fc region of an antibody, which vary with the antibody isotype. Examples of antibody effector functions include: C1q binding and complement dependent cytotoxicity (CDC), Fc receptor binding, antibody-dependent cell-mediated cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), cytokine secretion, immune complex-mediated antigen uptake by antigen presenting cells, down regulation of cell surface receptors (e.g. B cell receptor), and B cell activation.
[0106] An activating Fc receptor is an Fc receptor that following engagement by an Fc domain of an antibody elicits signaling events that stimulate the receptor-bearing cell to perform effector functions. Human activating Fc receptors include FcRIIIa (CD16a), FcRI (CD64), FcRIIa (CD32), and FcRI (CD89). In one aspect, the activating Fc receptor is FcRIIIa (CD16a). Human FcRIIIa (CD16a) including its sequence is described in UniProt entry P08637 (version 203).
[0107] Antibody-dependent cell-mediated cytotoxicity (ADCC) is an immune mechanism leading to the lysis of antibody-coated target cells by immune effector cells. The target cells are cells to which antibodies or derivatives thereof comprising an Fc region specifically bind, generally via the protein part that is N-terminal to the Fc region. As used herein, the term reduced ADCC is defined as either a reduction in the number of target cells that are lysed in a given time, at a given concentration of antibody in the medium surrounding the target cells, by the mechanism of ADCC defined above, and/or an increase in the concentration of antibody in the medium surrounding the target cells, required to achieve the lysis of a given number of target cells in a given time, by the mechanism of ADCC. The reduction in ADCC is relative to the ADCC mediated by the same antibody produced by the same type of host cells, using the same standard production, purification, formulation and storage methods (which are known to those skilled in the art), but that has not been engineered. For example, the reduction in ADCC mediated by an antibody comprising in its Fc domain an amino acid substitution that reduces ADCC, is relative to the ADCC mediated by the same antibody without this amino acid substitution in the Fc domain. Suitable assays to measure ADCC are well known in the art (see e.g. PCT publication no. WO 2006/082515 or PCT publication no. WO 2012/130831).
[0108] As used herein, the terms engineer, engineered, engineering, are considered to include any manipulation of the peptide backbone or the post-translational modifications of a naturally occurring or recombinant polypeptide or fragment thereof. Engineering includes modifications of the amino acid sequence, of the glycosylation pattern, or of the side chain group of individual amino acids, as well as combinations of these approaches.
[0109] The term amino acid mutation as used herein is meant to encompass amino acid substitutions, deletions, insertions, and modifications. Any combination of substitution, deletion, insertion, and modification can be made to arrive at the final construct, provided that the final construct possesses the desired characteristics, e.g., reduced binding to an Fc receptor, or increased association with another peptide. Amino acid sequence deletions and insertions include amino- and/or carboxy-terminal deletions and insertions of amino acids. Preferred amino acid mutations are amino acid substitutions. For the purpose of altering e.g. the binding characteristics of an Fc region, non-conservative amino acid substitutions, i.e. replacing one amino acid with another amino acid having different structural and/or chemical properties, are particularly preferred. Amino acid substitutions include replacement by non-naturally occurring amino acids or by naturally occurring amino acid derivatives of the twenty standard amino acids (e.g. 4-hydroxyproline, 3-methylhistidine, ornithine, homoserine, 5-hydroxylysine). Amino acid mutations can be generated using genetic or chemical methods well known in the art. Genetic methods may include site-directed mutagenesis, PCR, gene synthesis and the like. It is contemplated that methods of altering the side chain group of an amino acid by methods other than genetic engineering, such as chemical modification, may also be useful. Various designations may be used herein to indicate the same amino acid mutation. For example, a substitution from proline at position 329 of the Fc domain to glycine can be indicated as 329G, G329, G329, P329G, or Pro329Gly.
[0110] Percent (%) amino acid sequence identity with respect to a reference polypeptide sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, Clustal W, Megalign (DNASTAR) software or the FASTA program package. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. Alternatively, the percent identity values can be generated using the sequence comparison computer program ALIGN-2. The ALIGN-2 sequence comparison computer program was authored by Genentech, Inc., and the source code has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U.S. Copyright Registration No. TXU510087 and is described in WO 2001/007611.
[0111] Unless otherwise indicated, for purposes herein, % amino acid sequence identity values are generated using the ggsearch program of the FASTA package version 36.3.8c or later with a BLOSUM50 comparison matrix. The FASTA program package was authored by W. R. Pearson and D. J. Lipman (Improved Tools for Biological Sequence Analysis, PNAS 85 (1988) 2444-2448), W. R. Pearson (Effective protein sequence comparison Meth. Enzymol. 266 (1996) 227-258), and Pearson et. al. (Genomics 46 (1997) 24-36) and is publicly available from www.fasta.bioch.virginia.edu/fasta_www2/fasta_down.shtml or www.ebi.ac.uk/Tools/sss/fasta. Alternatively, a public server accessible at fasta.bioch.virginia.edu/fasta_www2/index.cgi can be used to compare the sequences, using the ggsearch (global protein:protein) program and default options (BLOSUM50; open: 10; ext: 2; Ktup=2) to ensure a global, rather than local, alignment is performed. Percent amino acid identity is given in the output alignment header.
[0112] The term polynucleotide or nucleic acid molecule includes any compound and/or substance that comprises a polymer of nucleotides. Each nucleotide is composed of a base, specifically a purine- or pyrimidine base (i.e. cytosine (C), guanine (G), adenine (A), thymine (T) or uracil (U)), a sugar (i.e. deoxyribose or ribose), and a phosphate group. Often, the nucleic acid molecule is described by the sequence of bases, whereby said bases represent the primary structure (linear structure) of a nucleic acid molecule. The sequence of bases is typically represented from 5 to 3. Herein, the term nucleic acid molecule encompasses deoxyribonucleic acid (DNA) including e.g., complementary DNA (cDNA) and genomic DNA, ribonucleic acid (RNA), in particular messenger RNA (mRNA), synthetic forms of DNA or RNA, and mixed polymers comprising two or more of these molecules. The nucleic acid molecule may be linear or circular. In addition, the term nucleic acid molecule includes both, sense and antisense strands, as well as single stranded and double stranded forms. Moreover, the herein described nucleic acid molecule can contain naturally occurring or non-naturally occurring nucleotides. Examples of non-naturally occurring nucleotides include modified nucleotide bases with derivatized sugars or phosphate backbone linkages or chemically modified residues. Nucleic acid molecules also encompass DNA and RNA molecules which are suitable as a vector for direct expression of an antibody of the invention in vitro and/or in vivo, e.g., in a host or patient. Such DNA (e.g., cDNA) or RNA (e.g., mRNA) vectors, can be unmodified or modified. For example, mRNA can be chemically modified to enhance the stability of the RNA vector and/or expression of the encoded molecule so that mRNA can be injected into a subject to generate the antibody in vivo (see e.g., Stadler et al. (2017) Nature Medicine 23:815-817, or EP 2 101 823 BO.
[0113] An isolated nucleic acid molecule refers to a nucleic acid molecule that has been separated from a component of its natural environment. An isolated nucleic acid molecule includes a nucleic acid molecule contained in cells that ordinarily contain the nucleic acid molecule, but the nucleic acid molecule is present extrachromosomally or at a chromosomal location that is different from its natural chromosomal location.
[0114] Isolated polynucleotide (or nucleic acid) encoding an antibody refers to one or more polynucleotide molecules encoding antibody heavy and light chains (or fragments thereof), including such polynucleotide molecule(s) in a single vector or separate vectors, and such polynucleotide molecule(s) present at one or more locations in a host cell.
[0115] The term vector, as used herein, refers to a nucleic acid molecule capable of propagating another nucleic acid to which it is linked. The term includes the vector as a self-replicating nucleic acid structure as well as the vector incorporated into the genome of a host cell into which it has been introduced. Certain vectors are capable of directing the expression of nucleic acids to which they are operatively linked. Such vectors are referred to herein as expression vectors.
[0116] The terms host cell, host cell line, and host cell culture are used interchangeably and refer to cells into which exogenous nucleic acid has been introduced, including the progeny of such cells. Host cells include transformants and transformed cells, which include the primary transformed cell and progeny derived therefrom without regard to the number of passages. Progeny may not be completely identical in nucleic acid content to a parent cell, but may contain mutations. Mutant progeny that have the same function or biological activity as screened or selected for in the originally transformed cell are included herein. A host cell is any type of cellular system that can be used to generate the antibodies of the present invention. Host cells include cultured cells, e.g. mammalian cultured cells, such as HEK cells, CHO cells, BHK cells, NS0 cells, SP2/0 cells, YO myeloma cells, P3X63 mouse myeloma cells, PER cells, PER. C6 cells or hybridoma cells, yeast cells, insect cells, and plant cells, to name only a few, but also cells comprised within a transgenic animal, transgenic plant or cultured plant or animal tissue. In one aspect, the host cell of the invention is a eukaryotic cell, particularly a mammalian cell. In one aspect, the host cell is not a cell within a human body.
[0117] The term pharmaceutical composition or pharmaceutical formulation refers to a preparation which is in such form as to permit the biological activity of an active ingredient contained therein to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the composition would be administered.
[0118] A pharmaceutically acceptable carrier refers to an ingredient in a pharmaceutical composition or formulation, other than an active ingredient, which is nontoxic to a subject. A pharmaceutically acceptable carrier includes, but is not limited to, a buffer, excipient, stabilizer, or preservative.
[0119] As used herein, treatment (and grammatical variations thereof such as treat or treating) refers to clinical intervention in an attempt to alter the natural course of a disease in the individual being treated, and can be performed either for prophylaxis or during the course of clinical pathology. Desirable effects of treatment include, but are not limited to, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastasis, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis. In some aspects, antibodies of the invention are used to delay development of a disease or to slow the progression of a disease.
[0120] An individual or subject is a mammal. Mammals include, but are not limited to, domesticated animals (e.g. cows, sheep, cats, dogs, and horses), primates (e.g. humans and non-human primates such as monkeys), rabbits, and rodents (e.g. mice and rats). In certain aspects, the individual or subject is a human.
[0121] An effective amount of an agent, e.g., a pharmaceutical composition, refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result.
[0122] The term package insert is used to refer to instructions customarily included in commercial packages of therapeutic products, that contain information about the indications, usage, dosage, administration, combination therapy, contraindications and/or warnings concerning the use of such therapeutic products.
II. Compositions and Methods
[0123] The invention provides antibodies that bind NKG2D, including multispecific antibodies that bind NKG2D and a second antigen. The antibodies show superior binding and agonistic activity on NKG2D, combined with other favorable properties for therapeutic application, e.g. with respect to efficacy and safety, pharmacokinetics, as well as produceability. Antibodies of the invention are useful, e.g., for the treatment of diseases such as cancer.
[0124] The antibodies of the invention are particularly useful for (co-)stimulation of cytotoxic T cells, e.g. in combination with a T-cell activating agent such as a T cell bispecific antibody (TCB). The antibodies of the invention can also efficiently activate other NKG2D-expressing immune cells, such as natural killer (NK) cells and y T cells, even without the need for simultaneous stimulation through an activating Fc receptor such as FcRIIIa (CD16a). Through avoiding the need for Fc receptor binding and activation for their function, the antibodies of the present invention are believed to enable efficient immune cell activation, with a smaller risk of systemic side effects than an NKG2D antibody requiring Fc receptor binding and activation for its function. The antibodies of the present invention can also be used in multispecific format, binding to NKG2D and a target cell antigen (e.g. a tumor antigen) to achieve targeted immune cell activation, but without also binding to an activating Fc receptor (particularly FcRIIIa (CD16a)) to reduce the risk of systemic side effects.
[0125] A. Anti-NKG2D Antibodies
[0126] The invention provides antibodies that bind to NKG2D.
[0127] In a first aspect the present invention provides an antibody that binds to NKG2D, wherein the antibody comprises a first antigen binding domain, comprising
(i) a heavy chain variable region (VH) comprising a heavy chain complementary determining region (HCDR) 1 of SEQ ID NO: 73, a HCDR 2 selected from the group consisting of SEQ ID NO: 74, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104 and SEQ ID NO: 105, and a HCDR 3 of SEQ ID NO: 75, and a light chain variable region (VL) comprising a light chain complementarity determining region (LCDR) 1 of SEQ ID NO: 76, a LCDR 2 of SEQ ID NO: 77 and a LCDR 3 of SEQ ID NO: 78;
(ii) a VH comprising a HCDR 1 of SEQ ID NO: 65, a HCDR 2 of SEQ ID NO: 66, and a HCDR 3 of SEQ ID NO: 67, and a VL comprising a LCDR 1 of SEQ ID NO: 68, a LCDR 2 of SEQ ID NO: 69 and a LCDR 3 of SEQ ID NO: 70;
(iii) a VH comprising a HCDR 1 of SEQ ID NO: 1, a HCDR 2 of SEQ ID NO: 2, and a HCDR 3 of SEQ ID NO: 3, and a VL comprising a LCDR 1 of SEQ ID NO: 4, a LCDR 2 of SEQ ID NO: 5 and a LCDR 3 of SEQ ID NO: 6;
(iv) a VH comprising a HCDR 1 of SEQ ID NO: 25, a HCDR 2 of SEQ ID NO: 26, and a HCDR 3 of SEQ ID NO: 27, and a VL comprising a LCDR 1 of SEQ ID NO: 28, a LCDR 2 of SEQ ID NO: 29 and a LCDR 3 of SEQ ID NO: 30;
(v) a VH comprising a HCDR 1 of SEQ ID NO: 49, a HCDR 2 of SEQ ID NO: 50, and a HCDR 3 of SEQ ID NO: 51, and a VL comprising a LCDR 1 of SEQ ID NO: 52, a LCDR 2 of SEQ ID NO: 53 and a LCDR 3 of SEQ ID NO: 54;
(vi) a VH comprising a HCDR 1 of SEQ ID NO: 57, a HCDR 2 of SEQ ID NO: 58, and a HCDR 3 of SEQ ID NO: 59, and a VL comprising a LCDR 1 of SEQ ID NO: 60, a LCDR 2 of SEQ ID NO: 61 and a LCDR 3 of SEQ ID NO: 62;
(vii) a VH comprising a HCDR 1 of SEQ ID NO: 9, a HCDR 2 of SEQ ID NO: 10, and a HCDR 3 of SEQ ID NO: 11, and a VL comprising a LCDR 1 of SEQ ID NO: 12, a LCDR 2 of SEQ ID NO: 13 and a LCDR 3 of SEQ ID NO: 14;
(viii) a VH comprising a HCDR 1 of SEQ ID NO: 17, a HCDR 2 of SEQ ID NO: 18, and a HCDR 3 of SEQ ID NO: 19, and a VL comprising a LCDR 1 of SEQ ID NO: 20, a LCDR 2 of SEQ ID NO: 21 and a LCDR 3 of SEQ ID NO: 22;
(ix) a VH comprising a HCDR 1 of SEQ ID NO: 33, a HCDR 2 of SEQ ID NO: 34, and a HCDR 3 of SEQ ID NO: 35, and a VL comprising a LCDR 1 of SEQ ID NO: 36, a LCDR 2 of SEQ ID NO: 37 and a LCDR 3 of SEQ ID NO: 38; or
(x) a VH comprising a HCDR 1 of SEQ ID NO: 41, a HCDR 2 of SEQ ID NO: 42, and a HCDR 3 of SEQ ID NO: 43, and a VL comprising a LCDR 1 of SEQ ID NO: 44, a LCDR 2 of SEQ ID NO: 45 and a LCDR 3 of SEQ ID NO: 46.
[0128] In one aspect, the present invention provides an antibody that binds to NKG2D, wherein the antibody comprises a first antigen binding domain, comprising
(i) a VH comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO: 79, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, and/or a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 80;
(ii) a VH comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 71, and/or a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 72;
(iii) a VH comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 7, and/or a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 8;
(iv) a VH comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 31, and/or a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 32;
(v) a VH comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 55, and/or a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 56;
(vi) a VH comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 63, and/or a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 64;
(vii) a VH comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 15, and/or a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 16;
(viii) a VH comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 23, and/or a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 24;
(ix) a VH comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 39, and/or a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 40; or
(x) a VH comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 47, and/or a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 48.
[0129] In one aspect, the antibody comprises a first antigen binding domain, comprising
a heavy chain variable region (VH) comprising a heavy chain complementary determining region (HCDR) 1 of SEQ ID NO: 73, a HCDR 2 selected from the group consisting of SEQ ID NO: 74, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104 and SEQ ID NO: 105, and a HCDR 3 of SEQ ID NO: 75, and a light chain variable region (VL) comprising a light chain complementarity determining region (LCDR) 1 of SEQ ID NO: 76, a LCDR 2 of SEQ ID NO: 77 and a LCDR 3 of SEQ ID NO: 78.
[0130] In one aspect, the antibody comprises a first antigen binding domain, comprising
a heavy chain variable region (VH) comprising a heavy chain complementary determining region (HCDR) 1 of SEQ ID NO: 73, a HCDR 2 of SEQ ID NO: 74, and a HCDR 3 of SEQ ID NO: 75, and a light chain variable region (VL) comprising a light chain complementarity determining region (LCDR) 1 of SEQ ID NO: 76, a LCDR 2 of SEQ ID NO: 77 and a LCDR 3 of SEQ ID NO: 78.
[0131] In one aspect, the antibody comprises a first antigen binding domain, comprising
a heavy chain variable region (VH) comprising a heavy chain complementary determining region (HCDR) 1 of SEQ ID NO: 73, a HCDR 2 of SEQ ID NO: 102, and a HCDR 3 of SEQ ID NO: 75, and a light chain variable region (VL) comprising a light chain complementarity determining region (LCDR) 1 of SEQ ID NO: 76, a LCDR 2 of SEQ ID NO: 77 and a LCDR 3 of SEQ ID NO: 78.
[0132] In a particular aspect, the antibody comprises a first antigen binding domain, comprising
a heavy chain variable region (VH) comprising a heavy chain complementary determining region (HCDR) 1 of SEQ ID NO: 73, a HCDR 2 of SEQ ID NO: 104, and a HCDR 3 of SEQ ID NO: 75, and a light chain variable region (VL) comprising a light chain complementarity determining region (LCDR) 1 of SEQ ID NO: 76, a LCDR 2 of SEQ ID NO: 77 and a LCDR 3 of SEQ ID NO: 78.
[0133] In one aspect, the antibody is a humanized antibody. In one aspect, the antigen binding domain is a humanized antigen binding domain (i.e. an antigen binding domain of a humanized antibody). In one aspect, the VH and/or the VL is a humanized variable region. In one aspect, the VH is a humanized variable region and the VL is a human variable region.
[0134] In one aspect, the VH and/or the VL comprises an acceptor human framework, e.g. a human immunoglobulin framework or a human consensus framework.
[0135] In one aspect, the VH comprises one or more heavy chain framework sequence (i.e. the FR1, FR2, FR3 and/or FR4 sequence) of a heavy chain variable region sequence selected from the group consisting of SEQ ID NO: 79, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, more particularly a heavy chain variable region sequence selected from the group consisting of SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, most particularly the heavy chain variable region sequence of SEQ ID NO: 112. In one aspect, the VH comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence selected from the group consisting of SEQ ID NO: 79, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, more particularly an amino acid sequence selected from the group consisting of SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, most particularly the amino acid sequence of SEQ ID NO: 112. In one aspect, the VH comprises an amino acid sequence that is at least about 95% identical to an amino acid sequence selected from the group consisting of SEQ ID NO: 79, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, more particularly an amino acid sequence selected from the group consisting of SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, most particularly the amino acid sequence of SEQ ID NO: 112. In one aspect, the VH comprises an amino acid sequence that is at least about 98% identical to an amino acid sequence selected from the group consisting of SEQ ID NO: 79, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, more particularly an amino acid sequence selected from the group consisting of SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, most particularly the amino acid sequence of SEQ ID NO: 112. In certain aspects, a VH sequence having at least 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an antibody comprising that sequence retains the ability to bind to NKG2D. In certain aspects, a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in the amino acid sequence selected from the group consisting of SEQ ID NO: 79, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, more particularly the amino acid sequence selected from the group consisting of SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, most particularly the amino acid sequence of SEQ ID NO: 112. In certain aspects, substitutions, insertions, or deletions occur in regions outside the CDRs (i.e., in the FRs). In one aspect, the VH comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 79, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, more particularly an amino acid sequence selected from the group consisting of SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, most particularly the amino acid sequence of SEQ ID NO: 112. Optionally, the VH comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 79, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, more particularly an amino acid sequence selected from the group consisting of SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, most particularly the amino acid sequence of SEQ ID NO: 112, including post-translational modifications of that sequence.
[0136] In one aspect, the VL comprises one or more light chain framework sequence (i.e. the FR1, FR2, FR3 and/or FR4 sequence) of the light chain variable region sequence of SEQ ID NO: 80. In one aspect, the VL comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 80. In one aspect, the VL comprises an amino acid sequence that is at least about 95% identical to the amino acid sequence of SEQ ID NO: 80. In one aspect, the VL comprises an amino acid sequence that is at least about 98% identical to the amino acid sequence of SEQ ID NO: 80. In certain aspects, a VL sequence having at least 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an antibody comprising that sequence retains the ability to bind to NKG2D. In certain aspects, a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in the amino acid sequence of SEQ ID NO: 80. In certain aspects, substitutions, insertions, or deletions occur in regions outside the CDRs (i.e., in the FRs). In one aspect, the VL comprises the amino acid sequence of SEQ ID NO: 80. Optionally, the VL comprises the amino acid sequence of SEQ ID NO: 80, including post-translational modifications of that sequence.
[0137] In one aspect, the VH comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence selected from the group consisting of SEQ ID NO: 79, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, more particularly an amino acid sequence selected from the group consisting of SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, most particularly the amino acid sequence of SEQ ID NO: 112; and the VL comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 80. In one aspect, the VH comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 79, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, more particularly an amino acid sequence selected from the group consisting of SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, most particularly the amino acid sequence of SEQ ID NO: 112; and the VL comprises the amino acid sequence of SEQ ID NO: 80.
[0138] In a further aspect, the invention provides an antibody that binds to NKG2D, wherein the antibody comprises a first antigen binding domain comprising a VH comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 79, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, more particularly an amino acid sequence selected from the group consisting of SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, most particularly the amino acid sequence of SEQ ID NO: 112; and a VL comprising the amino acid sequence of SEQ ID NO: 80.
[0139] In a further aspect, the invention provides an antibody that binds to NKG2D, wherein the antibody comprises a first antigen binding domain comprising a VH sequence selected from the group consisting of SEQ ID NO: 79, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, more particularly a VH sequence selected from the group consisting of SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, most particularly a VH sequence of SEQ ID NO: 112; and a VL sequence of SEQ ID NO: 80.
[0140] In another aspect, the invention provides an antibody that binds to NKG2D, wherein the antibody comprises a first antigen binding domain comprising a VH comprising the heavy chain CDR sequences of a VH selected from the group consisting of SEQ ID NO: 79, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, more particularly a VH selected from the group consisting of SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, most particularly the VH of SEQ ID NO: 112; and a VL comprising the light chain CDR sequences of the VL of SEQ ID NO: 80.
[0141] In a further aspect, the first antigen binding domain comprises the HCDR1, HCDR2 and HCDR3 amino acid sequences of a VH selected from the group consisting of SEQ ID NO: 79, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, more particularly a VH selected from the group consisting of SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, most particularly the VH of SEQ ID NO: 112; and the LCDR1, LCDR2 and LCDR3 amino acid sequences of the VL of SEQ ID NO: 11.
[0142] In one aspect, the VH comprises the heavy chain CDR sequences of a VH selected from the group consisting of SEQ ID NO: 79, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, more particularly a VH selected from the group consisting of SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, most particularly the VH of SEQ ID NO: 112, and a framework of at least 95%, 96%, 97%, 98% or 99% sequence identity to the framework sequence of a VH selected from the group consisting of SEQ ID NO: 79, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, more particularly a VH selected from the group consisting of SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, most particularly the VH of SEQ ID NO: 112. In one aspect, the VH comprises the heavy chain CDR sequences of a VH selected from the group consisting of SEQ ID NO: 79, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, more particularly a VH selected from the group consisting of SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, most particularly the VH of SEQ ID NO: 112, and a framework of at least 95% sequence identity to the framework sequence of a VH selected from the group consisting of SEQ ID NO: 79, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, more particularly a VH selected from the group consisting of SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, most particularly the VH of SEQ ID NO: 112. In another aspect, the VH comprises the heavy chain CDR sequences of a VH selected from the group consisting of SEQ ID NO: 79, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, more particularly a VH selected from the group consisting of SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, most particularly the VH of SEQ ID NO: 112, and a framework of at least 98% sequence identity to the framework sequence of a VH selected from the group consisting of SEQ ID NO: 79, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, more particularly a VH selected from the group consisting of SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112 and SEQ ID NO: 113, most particularly the VH of SEQ ID NO: 112.
[0143] In one aspect, the VL comprises the light chain CDR sequences of the VL of SEQ ID NO: 80 and a framework of at least 95%, 96%, 97%, 98% or 99% sequence identity to the framework sequence of the VL of SEQ ID NO: 80. In one aspect, the VL comprises the light chain CDR sequences of the VL of SEQ ID NO: 80 and a framework of at least 95% sequence identity to the framework sequence of the VL of SEQ ID NO: 80. In another aspect, the VL comprises the light chain CDR sequences of the VL of SEQ ID NO: 80 and a framework of at least 98% sequence identity to the framework sequence of the VL of SEQ ID NO: 80.
[0144] In one aspect, the antibody comprises a first antigen binding domain, comprising
a VH comprising a HCDR 1 of SEQ ID NO: 65, a HCDR 2 of SEQ ID NO: 66, and a HCDR 3 of SEQ ID NO: 67, and a VL comprising a LCDR 1 of SEQ ID NO: 68, a LCDR 2 of SEQ ID NO: 69 and a LCDR 3 of SEQ ID NO: 70.
[0145] In one aspect, the antibody is a human antibody. In one aspect, the antigen binding domain is a human antigen binding domain (i.e. an antigen binding domain of a human antibody). In one aspect, the VH and/or the VL is a human variable region.
[0146] In one aspect, the VH and/or VL comprises a human framework, e.g. a human immunoglobulin framework.
[0147] In one aspect, the VH comprises one or more heavy chain framework sequence (i.e. the FR1, FR2, FR3 and/or FR4 sequence) of the heavy chain variable region sequence of SEQ ID NO: 71. In one aspect, the VH comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 71. In one aspect, the VH comprises an amino acid sequence that is at least about 95% identical to the amino acid sequence of SEQ ID NO: 71. In one aspect, the VH comprises an amino acid sequence that is at least about 98% identical to the amino acid sequence of SEQ ID NO: 71. In certain aspects, a VH sequence having at least 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an antibody comprising that sequence retains the ability to bind to NKG2D. In certain aspects, a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in the amino acid sequence of SEQ ID NO: 71. In certain aspects, substitutions, insertions, or deletions occur in regions outside the CDRs (i.e., in the FRs). In one aspect, the VH comprises the amino acid sequence of SEQ ID NO: 71. Optionally, the VH comprises the amino acid sequence of SEQ ID NO: 71, including post-translational modifications of that sequence.
[0148] In one aspect, the VL comprises one or more light chain framework sequence (i.e. the FR1, FR2, FR3 and/or FR4 sequence) of the light chain variable region sequence of SEQ ID NO: 72. In one aspect, the VL comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 72. In one aspect, the VL comprises an amino acid sequence that is at least about 95% identical to the amino acid sequence of SEQ ID NO: 72. In one aspect, the VL comprises an amino acid sequence that is at least about 98% identical to the amino acid sequence of SEQ ID NO: 72. In certain aspects, a VL sequence having at least 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an antibody comprising that sequence retains the ability to bind to NKG2D. In certain aspects, a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in the amino acid sequence of SEQ ID NO: 72. In certain aspects, substitutions, insertions, or deletions occur in regions outside the CDRs (i.e., in the FRs). In one aspect, the VL comprises the amino acid sequence of SEQ ID NO: 72. Optionally, the VL comprises the amino acid sequence of SEQ ID NO: 72, including post-translational modifications of that sequence.
[0149] In one aspect, the VH comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 71, and the VL comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 72. In one aspect, the VH comprises the amino acid sequence of SEQ ID NO: 71 and the VL comprises the amino acid sequence of SEQ ID NO: 72.
[0150] In a further aspect, the invention provides an antibody that binds to NKG2D, wherein the antibody comprises a first antigen binding domain comprising a VH comprising the amino acid sequence of SEQ ID NO: 71 and a VL comprising the amino acid sequence of SEQ ID NO: 72.
[0151] In a further aspect, the invention provides an antibody that binds to NKG2D, wherein the antibody comprises a first antigen binding domain comprising a VH sequence of SEQ ID NO: 71 and a VL sequence of SEQ ID NO: 72.
[0152] In another aspect, the invention provides an antibody that binds to NKG2D, wherein the antibody comprises a first antigen binding domain comprising a VH comprising the heavy chain CDR sequences of the VH of SEQ ID NO: 71, and a VL comprising the light chain CDR sequences of the VL of SEQ ID NO: 72.
[0153] In a further aspect, the first antigen binding domain comprises the HCDR1, HCDR2 and HCDR3 amino acid sequences of the VH of SEQ ID NO: 71 and the LCDR1, LCDR2 and LCDR3 amino acid sequences of the VL of SEQ ID NO: 72.
[0154] In one aspect, the VH comprises the heavy chain CDR sequences of the VH of SEQ ID NO: 71 and a framework of at least 95%, 96%, 97%, 98% or 99% sequence identity to the framework sequence of the VH of SEQ ID NO: 71. In one aspect, the VH comprises the heavy chain CDR sequences of the VH of SEQ ID NO: 71 and a framework of at least 95% sequence identity to the framework sequence of the VH of SEQ ID NO: 71. In another aspect, the VH comprises the heavy chain CDR sequences of the VH of SEQ ID NO: 71 and a framework of at least 98% sequence identity to the framework sequence of the VH of SEQ ID NO: 71.
[0155] In one aspect, the VL comprises the light chain CDR sequences of the VL of SEQ ID NO: 72 and a framework of at least 95%, 96%, 97%, 98% or 99% sequence identity to the framework sequence of the VL of SEQ ID NO: 72. In one aspect, the VL comprises the light chain CDR sequences of the VL of SEQ ID NO: 72 and a framework of at least 95% sequence identity to the framework sequence of the VL of SEQ ID NO: 72. In another aspect, the VL comprises the light chain CDR sequences of the VL of SEQ ID NO: 72 and a framework of at least 98% sequence identity to the framework sequence of the VL of SEQ ID NO: 72.
[0156] In one aspect, the antibody comprises a first antigen binding domain, comprising
a VH comprising a HCDR 1 of SEQ ID NO: 1, a HCDR 2 of SEQ ID NO: 2, and a HCDR 3 of SEQ ID NO: 3, and a VL comprising a LCDR 1 of SEQ ID NO: 4, a LCDR 2 of SEQ ID NO: 5 and a LCDR 3 of SEQ ID NO: 6.
[0157] In one aspect, the antibody is a human antibody. In one aspect, the antigen binding domain is a human antigen binding domain (i.e. an antigen binding domain of a human antibody). In one aspect, the VH and/or the VL is a human variable region.
[0158] In one aspect, the VH and/or VL comprises a human framework, e.g. a human immunoglobulin framework.
[0159] In one aspect, the VH comprises one or more heavy chain framework sequence (i.e. the FR1, FR2, FR3 and/or FR4 sequence) of the heavy chain variable region sequence of SEQ ID NO: 7. In one aspect, the VH comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 7. In one aspect, the VH comprises an amino acid sequence that is at least about 95% identical to the amino acid sequence of SEQ ID NO: 7. In one aspect, the VH comprises an amino acid sequence that is at least about 98% identical to the amino acid sequence of SEQ ID NO: 7. In certain aspects, a VH sequence having at least 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an antibody comprising that sequence retains the ability to bind to NKG2D. In certain aspects, a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in the amino acid sequence of SEQ ID NO: 7. In certain aspects, substitutions, insertions, or deletions occur in regions outside the CDRs (i.e., in the FRs). In one aspect, the VH comprises the amino acid sequence of SEQ ID NO: 7. Optionally, the VH comprises the amino acid sequence of SEQ ID NO: 7, including post-translational modifications of that sequence.
[0160] In one aspect, the VL comprises one or more light chain framework sequence (i.e. the FR1, FR2, FR3 and/or FR4 sequence) of the light chain variable region sequence of SEQ ID NO: 8. In one aspect, the VL comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 8. In one aspect, the VL comprises an amino acid sequence that is at least about 95% identical to the amino acid sequence of SEQ ID NO: 8. In one aspect, the VL comprises an amino acid sequence that is at least about 98% identical to the amino acid sequence of SEQ ID NO: 8. In certain aspects, a VL sequence having at least 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an antibody comprising that sequence retains the ability to bind to NKG2D. In certain aspects, a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in the amino acid sequence of SEQ ID NO: 8. In certain aspects, substitutions, insertions, or deletions occur in regions outside the CDRs (i.e., in the FRs). In one aspect, the VL comprises the amino acid sequence of SEQ ID NO: 8. Optionally, the VL comprises the amino acid sequence of SEQ ID NO: 8, including post-translational modifications of that sequence.
[0161] In one aspect, the VH comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 7, and the VL comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 8. In one aspect, the VH comprises the amino acid sequence of SEQ ID NO: 7 and the VL comprises the amino acid sequence of SEQ ID NO: 8.
[0162] In a further aspect, the invention provides an antibody that binds to NKG2D, wherein the antibody comprises a first antigen binding domain comprising a VH comprising the amino acid sequence of SEQ ID NO: 7 and a VL comprising the amino acid sequence of SEQ ID NO: 8.
[0163] In a further aspect, the invention provides an antibody that binds to NKG2D, wherein the antibody comprises a first antigen binding domain comprising a VH sequence of SEQ ID NO: 7 and a VL sequence of SEQ ID NO: 8.
[0164] In another aspect, the invention provides an antibody that binds to NKG2D, wherein the antibody comprises a first antigen binding domain comprising a VH comprising the heavy chain CDR sequences of the VH of SEQ ID NO: 7, and a VL comprising the light chain CDR sequences of the VL of SEQ ID NO: 8.
[0165] In a further aspect, the first antigen binding domain comprises the HCDR1, HCDR2 and HCDR3 amino acid sequences of the VH of SEQ ID NO: 7 and the LCDR1, LCDR2 and LCDR3 amino acid sequences of the VL of SEQ ID NO: 8.
[0166] In one aspect, the VH comprises the heavy chain CDR sequences of the VH of SEQ ID NO: 7 and a framework of at least 95%, 96%, 97%, 98% or 99% sequence identity to the framework sequence of the VH of SEQ ID NO: 7. In one aspect, the VH comprises the heavy chain CDR sequences of the VH of SEQ ID NO: 7 and a framework of at least 95% sequence identity to the framework sequence of the VH of SEQ ID NO: 7. In another aspect, the VH comprises the heavy chain CDR sequences of the VH of SEQ ID NO: 7 and a framework of at least 98% sequence identity to the framework sequence of the VH of SEQ ID NO: 7.
[0167] In one aspect, the VL comprises the light chain CDR sequences of the VL of SEQ ID NO: 8 and a framework of at least 95%, 96%, 97%, 98% or 99% sequence identity to the framework sequence of the VL of SEQ ID NO: 8. In one aspect, the VL comprises the light chain CDR sequences of the VL of SEQ ID NO: 8 and a framework of at least 95% sequence identity to the framework sequence of the VL of SEQ ID NO: 8. In another aspect, the VL comprises the light chain CDR sequences of the VL of SEQ ID NO: 8 and a framework of at least 98% sequence identity to the framework sequence of the VL of SEQ ID NO: 8.
[0168] In one aspect, the invention provides an antibody that binds to NKG2D, wherein the antibody comprises a first antigen binding domain comprising a VH sequence as in any of the aspects provided above, and a VL sequence as in any of the aspects provided above.
[0169] In one aspect, the antibody comprises a human constant region. In one aspect, the antibody is an immunoglobulin molecule comprising a human constant region, particularly an IgG class immunoglobulin molecule comprising a human CH1, CH2, CH3 and/or CL domain. Exemplary sequences of human constant domains are given in SEQ ID NOs 83 and 84 (human kappa and lambda CL domains, respectively) and SEQ ID NO: 85 (human IgG1 heavy chain constant domains CH1-CH2-CH3). In one aspect, the antibody comprises a light chain constant region comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 83 or SEQ ID NO: 84, particularly the amino acid sequence of SEQ ID NO: 83. In one aspect, the antibody comprises a heavy chain constant region comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 85. Particularly, the heavy chain constant region may comprise amino acid mutations in the Fc domain as described herein.
[0170] In one aspect, the first antigen binding domain comprises a human constant region. In one aspect, the first antigen binding moiety is a Fab molecule comprising a human constant region, particularly a human CH1 and/or CL domain. In one aspect, the first antigen binding domain comprises a light chain constant region comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 83 or SEQ ID NO: 84, particularly the amino acid sequence of SEQ ID NO: 83. Particularly, the light chain constant region may comprise amino acid mutations as described herein under charge modifications and/or may comprise deletion or substitutions of one or more (particularly two) N-terminal amino acids if in a crossover Fab molecule. In some aspects, the first antigen binding domain comprises a heavy chain constant region comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the CH1 domain sequence comprised in the amino acid sequence of SEQ ID NO: 85. Particularly, the heavy chain constant region (specifically CH1 domain) may comprise amino acid mutations as described herein under charge modifications.
[0171] In one aspect, the antibody is a monoclonal antibody.
[0172] In one aspect, the antibody is an IgG, particularly an IgG.sub.1, antibody. In one aspect, the antibody is a full-length antibody.
[0173] In another aspect, the antibody is an antibody fragment selected from the group of an Fv molecule, a scFv molecule, a Fab molecule, and a F(ab).sub.2 molecule; particularly a Fab molecule. In another aspect, the antibody fragment is a diabody, a triabody or a tetrabody.
[0174] The first antigen binding domain comprised in the antibody according to the present inventions binds to NKG2D.
[0175] In a preferred aspect, the antibody comprises not more than one antigen binding domain that binds to NKG2D. In one aspect the antibody provides monovalent binding to NKG2D. In other aspects, the antibody comprises more than one (e.g. two, three, or four) antigen binding domain that binds to NKG2D. In one aspect the antibody provides multivalent binding to NKG2D. In one aspect, the antibody comprises two antigen binding domains that bind to NKG2D. In one aspect the antibody provides bivalent binding to NKG2D. In another aspect, the antibody comprises four antigen binding domains that bind to NKG2D. In one aspect the antibody provides tetravalent binding to NKG2D.
[0176] In aspects wherein the antibody comprises more than one antigen binding domain that binds to NKG2D, preferably all of these antigen binding domains are identical, i.e. they have the same molecular format (e.g. conventional or crossover Fab molecule) and comprise the same amino acid sequences.
[0177] In another aspect, the first antigen binding domain is an antibody fragment selected from the group of an Fv molecule, a scFv molecule, a Fab molecule, and a F(ab)2 molecule.
[0178] In one aspect, the first antigen binding domain is a Fab molecule. In a preferred aspect the first antigen binding domain is a Fab molecule wherein the variable domains VL and VH or the constant domains CL and CH1, particularly the variable domains VL and VH, of the Fab light chain and the Fab heavy chain are replaced by each other (i.e. the first antigen binding domain is a crossover Fab molecule).
[0179] In a further aspect, the antibody according to any of the above aspects may incorporate any of the features, singly or in combination, as described in sections II. A. 1.-10. below.
[0180] In a preferred aspect, the antibody comprises an Fc domain, particularly an IgG Fc domain, more particularly an IgG.sub.1 Fc domain. In one aspect the Fc domain is a human Fc domain. In one aspect, the Fc domain is a human IgG.sub.1 Fc domain. The Fc domain is composed of a first and a second subunit and may incorporate any of the features, singly or in combination, described hereinbelow in relation to Fc domain variants (section II. A. 10.).
[0181] In another preferred aspect, the antibody comprises a second antigen binding domain that binds to a second antigen (i.e. the antibody is a multispecific antibody, as further described hereinbelow (section II. A. 9.).
[0182] 1. Antibody Fragments
[0183] In certain aspects, an antibody provided herein is an antibody fragment.
[0184] In one aspect, the antibody fragment is a Fab, Fab, Fab-SH, or F(ab)2 molecule, in particular a Fab molecule as described herein. Fab molecule differ from Fab molecules by the addition of residues at the carboxy terminus of the CH1 domain including one or more cysteines from the antibody hinge region. Fab-SH are Fab molecules in which the cysteine residue(s) of the constant domains bear a free thiol group. Pepsin treatment yields an F(ab)2 molecule that has two antigen-binding sites (two Fab molecules) and a part of the Fc region.
[0185] In another aspect, the antibody fragment is a diabody, a triabody or a tetrabody. Diabodies are antibody fragments with two antigen-binding sites that may be bivalent or bispecific. See, for example, EP 404,097; WO 1993/01161; Hudson et al., Nat. Med. 9:129-134 (2003); and Hollinger et al., Proc. Natl. Acad. Sci. USA 90: 6444-6448 (1993). Triabodies and tetrabodies are also described in Hudson et al., Nat. Med. 9:129-134 (2003).
[0186] In a further aspect, the antibody fragment is a single chain Fab molecule. A single chain Fab molecule or scFab is a polypeptide consisting of an antibody heavy chain variable domain (VH), an antibody heavy chain constant domain 1 (CH1), an antibody light chain variable domain (VL), an antibody light chain constant domain (CL) and a linker, wherein said antibody domains and said linker have one of the following orders in N-terminal to C-terminal direction: a) VH-CH1-linker-VL-CL, b) VL-CL-linker-VH-CH1, c) VH-CL-linker-VL-CH1 or d) VL-CH1-linker-VH-CL. In particular, said linker is a polypeptide of at least 30 amino acids, preferably between 32 and 50 amino acids. Said single chain Fab molecules are stabilized via the natural disulfide bond between the CL domain and the CH1 domain. In addition, these single chain Fab molecules might be further stabilized by generation of interchain disulfide bonds via insertion of cysteine residues (e.g., position 44 in the variable heavy chain and position 100 in the variable light chain according to Kabat numbering).
[0187] In another aspect, the antibody fragment is single-chain variable fragment (scFv). A single-chain variable fragment or scFv is a fusion protein of the variable domains of the heavy (VH) and light chains (VL) of an antibody, connected by a linker. In particular, the linker is a short polypeptide of 10 to 25 amino acids and is usually rich in glycine for flexibility, as well as serine or threonine for solubility, and can either connect the N-terminus of the VH with the C-terminus of the VL, or vice versa. This protein retains the specificity of the original antibody, despite removal of the constant regions and the introduction of the linker. For a review of scFv fragments, see, e.g., Plckthun, in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., (Springer-Verlag, New York), pp. 269-315 (1994); see also WO 93/16185; and U.S. Pat. Nos. 5,571,894 and 5,587,458.
[0188] In another aspect, the antibody fragment is a single-domain antibody. Single-domain antibodies are antibody fragments comprising all or a portion of the heavy chain variable domain or all or a portion of the light chain variable domain of an antibody. In certain aspects, a single-domain antibody is a human single-domain antibody (Domantis, Inc., Waltham, Mass.; see, e.g., U.S. Pat. No. 6,248,516 BO.
[0189] Antibody fragments can be made by various techniques, including but not limited to proteolytic digestion of an intact antibody as well as recombinant production by recombinant host cells (e.g., E. coli), as described herein.
[0190] 2. Chimeric and Humanized Antibodies
[0191] In certain aspects, an antibody provided herein is a chimeric antibody. Certain chimeric antibodies are described, e.g., in U.S. Pat. No. 4,816,567; and Morrison et al., Proc. Natl. Acad. Sci. USA, 81:6851-6855 (1984)). In one example, a chimeric antibody comprises a non-human variable region (e.g., a variable region derived from a mouse, rat, hamster, rabbit, or non-human primate, such as a monkey) and a human constant region. In a further example, a chimeric antibody is a class switched antibody in which the class or subclass has been changed from that of the parent antibody. Chimeric antibodies include antigen-binding fragments thereof.
[0192] In certain aspects, an antibody provided herein is a humanized antibody. Typically, a non-human antibody is humanized to reduce immunogenicity to humans, while retaining the specificity and affinity of the parental non-human antibody. Generally, a humanized antibody comprises one or more variable domains in which the CDRs (or portions thereof) are derived from a non-human antibody, and FRs (or portions thereof) are derived from human antibody sequences. A humanized antibody optionally will also comprise at least a portion of a human constant region. In some aspects, some FR residues in a humanized antibody are substituted with corresponding residues from a non-human antibody (e.g., the antibody from which the CDR residues are derived), e.g., to restore or improve antibody specificity or affinity.
[0193] Humanized antibodies and methods of making them are reviewed, e.g., in Almagro and Fransson, Front. Biosci. 13:1619-1633 (2008), and are further described, e.g., in Riechmann et al., Nature 332:323-329 (1988); Queen et al., Proc. Nat'l Acad. Sci. USA 86:10029-10033 (1989); U.S. Pat. Nos. 5,821,337, 7,527,791, 6,982,321, and 7,087,409; Kashmiri et al., Methods 36:25-34 (2005) (describing specificity determining region (SDR) grafting); Padlan, Mol. Immunol. 28:489-498 (1991) (describing resurfacing); Dall'Acqua et al., Methods 36:43-60 (2005) (describing FR shuffling); and Osbourn et al., Methods 36:61-68 (2005) and Klimka et al., Br. J. Cancer, 83:252-260 (2000) (describing the guided selection approach to FR shuffling).
[0194] Human framework regions that may be used for humanization include but are not limited to: framework regions selected using the best-fit method (see, e.g., Sims et al. J. Immunol. 151:2296 (1993)); framework regions derived from the consensus sequence of human antibodies of a particular subgroup of light or heavy chain variable regions (see, e.g., Carter et al. Proc. Natl. Acad. Sci. USA, 89:4285 (1992); and Presta et al. J. Immunol., 151:2623 (1993)); human mature (somatically mutated) framework regions or human germline framework regions (see, e.g., Almagro and Fransson, Front. Biosci. 13:1619-1633 (2008)); and framework regions derived from screening FR libraries (see, e.g., Baca et al., J. Biol. Chem. 272:10678-10684 (1997) and Rosok et al., J. Biol. Chem. 271:22611-22618 (1996)).
[0195] 3. Human Antibodies
[0196] In certain aspects, an antibody provided herein is a human antibody. Human antibodies can be produced using various techniques known in the art. Human antibodies are described generally in van Dijk and van de Winkel, Curr. Opin. Pharmacol. 5: 368-74 (2001) and Lonberg, Curr. Opin. Immunol. 20:450-459 (2008).
[0197] Human antibodies may be prepared by administering an immunogen to a transgenic animal that has been modified to produce intact human antibodies or intact antibodies with human variable regions in response to antigenic challenge. Such animals typically contain all or a portion of the human immunoglobulin loci, which replace the endogenous immunoglobulin loci, or which are present extrachromosomally or integrated randomly into the animal's chromosomes. In such transgenic animals, the endogenous immunoglobulin loci have generally been inactivated. For review of methods for obtaining human antibodies from transgenic animals, see Lonberg, Nat. Biotech. 23:1117-1125 (2005). See also, e.g., U.S. Pat. Nos. 6,075,181 and 6,150,584 describing XENOMOUSE technology; U.S. Pat. No. 5,770,429 describing H
[0198] Human antibodies can also be made by hybridoma-based methods. Human myeloma and mouse-human heteromyeloma cell lines for the production of human monoclonal antibodies have been described (see, e.g., Kozbor J. Immunol., 133: 3001 (1984); Brodeur et al., Monoclonal Antibody Production Techniques and Applications, pp. 51-63 (Marcel Dekker, Inc., New York, 1987); and Boerner et al., J. Immunol., 147: 86 (1991)). Human antibodies generated via human B-cell hybridoma technology are also described in Li et al., Proc. Natl. Acad. Sci. USA, 103:3557-3562 (2006). Additional methods include those described, for example, in U.S. Pat. No. 7,189,826 (describing production of monoclonal human IgM antibodies from hybridoma cell lines) and Ni, Xiandai Mianyixue, 26(4):265-268 (2006) (describing human-human hybridomas). Human hybridoma technology (Trioma technology) is also described in Vollmers and Brandlein, Histology and Histopathology, 20(3):927-937 (2005) and Vollmers and Brandlein, Methods and Findings in Experimental and Clinical Pharmacology, 27(3):185-91 (2005).
[0199] Human antibodies may also be generated by isolating variable domain sequences selected from human-derived phage display libraries. Such variable domain sequences may then be combined with a desired human constant domain. Techniques for selecting human antibodies from antibody libraries are described below.
[0200] 4. Library-Derived Antibodies
[0201] In certain aspects, an antibody provided herein is derived from a library. Antibodies of the invention may be isolated by screening combinatorial libraries for antibodies with the desired activity or activities. Methods for screening combinatorial libraries are reviewed, e.g., in Lerner et al. in Nature Reviews 16:498-508 (2016). For example, a variety of methods are known in the art for generating phage display libraries and screening such libraries for antibodies possessing the desired binding characteristics. Such methods are reviewed, e.g., in Frenzel et al. in mAbs 8:1177-1194 (2016); Bazan et al. in Human Vaccines and Immunotherapeutics 8:1817-1828 (2012) and Zhao et al. in Critical Reviews in Biotechnology 36:276-289 (2016) as well as in Hoogenboom et al. in Methods in Molecular Biology 178:1-37 (O'Brien et al., ed., Human Press, Totowa, N.J., 2001) and in Marks and Bradbury in Methods in Molecular Biology 248:161-175 (Lo, ed., Human Press, Totowa, N.J., 2003).
[0202] In certain phage display methods, repertoires of VH and VL genes are separately cloned by polymerase chain reaction (PCR) and recombined randomly in phage libraries, which can then be screened for antigen-binding phage as described in Winter et al. in Annual Review of Immunology 12: 433-455 (1994). Phage typically display antibody fragments, either as single-chain Fv (scFv) fragments or as Fab fragments. Libraries from immunized sources provide high-affinity antibodies to the immunogen without the requirement of constructing hybridomas. Alternatively, the naive repertoire can be cloned (e.g., from human) to provide a single source of antibodies to a wide range of non-self and also self antigens without any immunization as described by Griffiths et al. in EMBO Journal 12: 725-734 (1993). Furthermore, naive libraries can also be made synthetically by cloning unrearranged V-gene segments from stem cells, and using PCR primers containing random sequence to encode the highly variable CDR3 regions and to accomplish rearrangement in vitro, as described by Hoogenboom and Winter in Journal of Molecular Biology 227: 381-388 (1992). Patent publications describing human antibody phage libraries include, for example: U.S. Pat. Nos. 5,750,373; 7,985,840; 7,785,903 and 8,679,490 as well as US Patent Publication Nos. 2005/0079574, 2007/0117126, 2007/0237764 and 2007/0292936.
[0203] Further examples of methods known in the art for screening combinatorial libraries for antibodies with a desired activity or activities include ribosome and mRNA display, as well as methods for antibody display and selection on bacteria, mammalian cells, insect cells or yeast cells. Methods for yeast surface display are reviewed, e.g., in Scholler et al. in Methods in Molecular Biology 503:135-56 (2012) and in Cherf et al. in Methods in Molecular biology 1319:155-175 (2015) as well as in Zhao et al. in Methods in Molecular Biology 889:73-84 (2012). Methods for ribosome display are described, e.g., in He et al. in Nucleic Acids Research 25:5132-5134 (1997) and in Hanes et al. in PNAS 94:4937-4942 (1997).
[0204] Antibodies or antibody fragments isolated from human antibody libraries are considered human antibodies or human antibody fragments herein.
[0205] 5. Glycosylation Variants
[0206] In certain aspects, an antibody provided herein is altered to increase or decrease the extent to which the antibody is glycosylated. Addition or deletion of glycosylation sites to an antibody may be conveniently accomplished by altering the amino acid sequence such that one or more glycosylation sites is created or removed.
[0207] Where the antibody comprises an Fc region, the oligosaccharide attached thereto may be altered. Native antibodies produced by mammalian cells typically comprise a branched, biantennary oligosaccharide that is generally attached by an N-linkage to Asn297 of the CH2 domain of the Fc region. See, e.g., Wright et al. TIBTECH 15:26-32 (1997). The oligosaccharide may include various carbohydrates, e.g., mannose, N-acetyl glucosamine (GlcNAc), galactose, and sialic acid, as well as a fucose attached to a GlcNAc in the stem of the biantennary oligosaccharide structure. In some aspects, modifications of the oligosaccharide in an antibody of the invention may be made in order to create antibody variants with certain improved properties.
[0208] In one aspect, antibody variants are provided having a non-fucosylated oligosaccharide, i.e. an oligosaccharide structure that lacks fucose attached (directly or indirectly) to an Fc region. Such non-fucosylated oligosaccharide (also referred to as afucosylated oligosaccharide) particularly is an N-linked oligosaccharide which lacks a fucose residue attached to the first GlcNAc in the stem of the biantennary oligosaccharide structure. In one aspect, antibody variants are provided having an increased proportion of non-fucosylated oligosaccharides in the Fc region as compared to a native or parent antibody. For example, the proportion of non-fucosylated oligosaccharides may be at least about 20%, at least about 40%, at least about 60%, at least about 80%, or even about 100% (i.e. no fucosylated oligosaccharides are present). The percentage of non-fucosylated oligosaccharides is the (average) amount of oligosaccharides lacking fucose residues, relative to the sum of all oligosaccharides attached to Asn 297 (e. g. complex, hybrid and high mannose structures) as measured by MALDI-TOF mass spectrometry, as described in WO 2006/082515, for example. Asn297 refers to the asparagine residue located at about position 297 in the Fc region (EU numbering of Fc region residues); however, Asn297 may also be located about 3 amino acids upstream or downstream of position 297, i.e., between positions 294 and 300, due to minor sequence variations in antibodies. Such antibodies having an increased proportion of non-fucosylated oligosaccharides in the Fc region may have improved FcRIIIa receptor binding and/or improved effector function, in particular improved ADCC function. See, e.g., US 2003/0157108; US 2004/0093621.
[0209] Examples of cell lines capable of producing antibodies with reduced fucosylation include Lec13 CHO cells deficient in protein fucosylation (Ripka et al. Arch. Biochem. Biophys. 249:533-545 (1986); US 2003/0157108; and WO 2004/056312, especially at Example 11), and knockout cell lines, such as alpha-1,6-fucosyltransferase gene, FUT8, knockout CHO cells (see, e.g., Yamane-Ohnuki et al. Biotech. Bioeng. 87:614-622 (2004); Kanda, Y. et al., Biotechnol. Bioeng., 94(4):680-688 (2006); and WO 2003/085107), or cells with reduced or abolished activity of a GDP-fucose synthesis or transporter protein (see, e.g., US2004259150, US2005031613, US2004132140, US2004110282).
[0210] In a further aspect, antibody variants are provided with bisected oligosaccharides, e.g., in which a biantennary oligosaccharide attached to the Fc region of the antibody is bisected by GlcNAc. Such antibody variants may have reduced fucosylation and/or improved ADCC function as described above. Examples of such antibody variants are described, e.g., in Umana et al., Nat Biotechnol 17, 176-180 (1999); Ferrara et al., Biotechn Bioeng 93, 851-861 (2006); WO 99/54342; WO 2004/065540, WO 2003/011878.
[0211] Antibody variants with at least one galactose residue in the oligosaccharide attached to the Fc region are also provided. Such antibody variants may have improved CDC function. Such antibody variants are described, e.g., in WO 1997/30087; WO 1998/58964; and WO 1999/22764.
[0212] 6. Cysteine Engineered Antibody Variants
[0213] In certain aspects, it may be desirable to create cysteine engineered antibodies, e.g., THIOMAB antibodies, in which one or more residues of an antibody are substituted with cysteine residues. In preferred aspects, the substituted residues occur at accessible sites of the antibody. By substituting those residues with cysteine, reactive thiol groups are thereby positioned at accessible sites of the antibody and may be used to conjugate the antibody to other moieties, such as drug moieties or linker-drug moieties, to create an immunoconjugate, as described further herein. Cysteine engineered antibodies may be generated as described, e.g., in U.S. Pat. Nos. 7,521,541, 8,30,930, 7,855,275, 9,000,130, or WO 2016040856.
[0214] 7. Antibody Derivatives
[0215] In certain aspects, an antibody provided herein may be further modified to contain additional non-proteinaceous moieties that are known in the art and readily available. The moieties suitable for derivatization of the antibody include but are not limited to water soluble polymers. Non-limiting examples of water soluble polymers include, but are not limited to, polyethylene glycol (PEG), copolymers of ethylene glycol/propylene glycol, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, poly-1,3-dioxolane, poly-1,3,6-trioxane, ethylene/maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers), and dextran or poly(n-vinyl pyrrolidone)polyethylene glycol, propropylene glycol homopolymers, prolypropylene oxide/ethylene oxide co-polymers, polyoxyethylated polyols (e.g., glycerol), polyvinyl alcohol, and mixtures thereof. Polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water. The polymer may be of any molecular weight, and may be branched or unbranched. The number of polymers attached to the antibody may vary, and if more than one polymer are attached, they can be the same or different molecules. In general, the number and/or type of polymers used for derivatization can be determined based on considerations including, but not limited to, the particular properties or functions of the antibody to be improved, whether the antibody derivative will be used in a therapy under defined conditions, etc.
[0216] 8. Immunoconjugates
[0217] The invention also provides immunoconjugates comprising an anti-NKG2D antibody herein conjugated (chemically bonded) to one or more therapeutic agents such as cytotoxic agents, chemotherapeutic agents, drugs, growth inhibitory agents, toxins (e.g., protein toxins, enzymatically active toxins of bacterial, fungal, plant, or animal origin, or fragments thereof), or radioactive isotopes.
[0218] In one aspect, an immunoconjugate is an antibody-drug conjugate (ADC) in which an antibody is conjugated to one or more of the therapeutic agents mentioned above. The antibody is typically connected to one or more of the therapeutic agents using linkers. An overview of ADC technology including examples of therapeutic agents and drugs and linkers is set forth in Pharmacol Review 68:3-19 (2016).
[0219] In another aspect, an immunoconjugate comprises an antibody of the invention conjugated to an enzymatically active toxin or fragment thereof, including but not limited to diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), Momordica charantia inhibitor, curcin, crotin, Sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes.
[0220] In another aspect, an immunoconjugate comprises an antibody of the invention conjugated to a radioactive atom to form a radioconjugate. A variety of radioactive isotopes are available for the production of radioconjugates. Examples include At.sup.211, I.sup.131, I.sup.125, Y.sup.90, Re.sup.186, Re.sup.188, Sm.sup.153, Bi.sup.212, P.sup.32, Pb.sup.212 and radioactive isotopes of Lu. When the radioconjugate is used for detection, it may comprise a radioactive atom for scintigraphic studies, for example Tc.sup.99m or I.sup.123 or a spin label for nuclear magnetic resonance (NMR) imaging (also known as magnetic resonance imaging, MRI), such as I.sup.123, I.sup.131, In.sup.111, F.sup.19, C.sup.13, N.sup.15, O.sup.17, gadolinium, manganese or iron.
[0221] Conjugates of an antibody and cytotoxic agent may be made using a variety of bifunctional protein coupling agents such as N-succinimidyl-3-(2-pyridyldithio) propionate (SPDP), succinimidyl-4-(N-maleimidomethyl) cyclohexane-1-carboxylate (SMCC), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCl), active esters (such as disuccinimidyl suberate), aldehydes (such as glutaraldehyde), bis-azido compounds (such as bis (p-azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as toluene 2,6-diisocyanate), and bis-active fluorine compounds (such as 1,5-difluoro-2,4-dinitrobenzene). For example, a ricin immunotoxin can be prepared as described in Vitetta et al., Science 238:1098 (1987). Carbon-14-labeled 1-isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleotide to the antibody. See WO 94/11026. The linker may be a cleavable linker facilitating release of a cytotoxic drug in the cell. For example, an acid-labile linker, peptidase-sensitive linker, photolabile linker, dimethyl linker or disulfide-containing linker (Chari et al., Cancer Res. 52:127-131 (1992); U.S. Pat. No. 5,208,020) may be used.
[0222] The immunuoconjugates or ADCs herein expressly contemplate, but are not limited to such conjugates prepared with cross-linker reagents including, but not limited to, BMPS, EMCS, GMBS, HBVS, LC-SMCC, MBS, MPBH, SBAP, SIA, SIAB, SMCC, SMPB, SMPH, sulfo-EMCS, sulfo-GMBS, sulfo-KMUS, sulfo-MBS, sulfo-SIAB, sulfo-SMCC, and sulfo-SMPB, and SVSB (succinimidyl-(4-vinylsulfone)benzoate) which are commercially available (e.g., from Pierce Biotechnology, Inc., Rockford, Ill., U.S.A.).
[0223] 9. Multispecific Antibodies
[0224] In certain aspects, an antibody provided herein is a multispecific antibody, particularly a bispecific antibody. Multispecific antibodies are monoclonal antibodies that have binding specificities for at least two different antigenic determinants (e.g., two different proteins, or two different epitopes on the same protein). In certain aspects, the multispecific antibody has three or more binding specificities. In certain aspects, one of the binding specificities is for NKG2D and the other specificity is for any other antigen. In certain aspects, multispecific antibodies may bind to two (or more) different epitopes of NKG2D. Multispecific (e.g., bispecific) antibodies may also be used to localize cytotoxic agents or cells to cells which express NKG2D. Multispecific antibodies may be prepared as full length antibodies or antibody fragments.
[0225] Techniques for making multispecific antibodies include, but are not limited to, recombinant co-expression of two immunoglobulin heavy chain-light chain pairs having different specificities (see Milstein and Cuello, Nature 305: 537 (1983)) and knob-in-hole engineering (see, e.g., U.S. Pat. No. 5,731,168, and Atwell et al., J. Mol. Biol. 270:26 (1997)). Multi-specific antibodies may also be made by engineering electrostatic steering effects for making antibody Fc-heterodimeric molecules (see, e.g., WO 2009/089004); cross-linking two or more antibodies or fragments (see, e.g., U.S. Pat. No. 4,676,980, and Brennan et al., Science, 229: 81 (1985)); using leucine zippers to produce bi-specific antibodies (see, e.g., Kostelny et al., J. Immunol., 148(5):1547-1553 (1992) and WO 2011/034605); using the common light chain technology for circumventing the light chain mis-pairing problem (see, e.g., WO 98/50431); using diabody technology for making bispecific antibody fragments (see, e.g., Hollinger et al., Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993)); and using single-chain Fv (scFv) dimers (see, e.g., Gruber et al., J. Immunol., 152:5368 (1994)); and preparing trispecific antibodies as described, e.g., in Tutt et al. J. Immunol. 147: 60 (1991).
[0226] Engineered antibodies with three or more antigen binding sites, including for example, Octopus antibodies, or DVD-Ig are also included herein (see, e.g., WO 2001/77342 and WO 2008/024715). Other examples of multispecific antibodies with three or more antigen binding sites can be found in WO 2010/115589, WO 2010/112193, WO 2010/136172, WO 2010/145792, and WO 2013/026831. The multispecific antibody or antigen binding fragment thereof also includes a Dual Acting FAb or DAF comprising an antigen binding site that binds to NKG2D as well as another different antigen, or two different epitopes of NKG2D (see, e.g., US 2008/0069820 and WO 2015/095539).
[0227] Multi-specific antibodies may also be provided in an asymmetric form with a domain crossover in one or more binding arms of the same antigen specificity (so called CrossMab technology), i.e. by exchanging the VH/VL domains (see e.g., WO 2009/080252 and WO 2015/150447), the CH1/CL domains (see e.g., WO 2009/080253) or the complete Fab arms (see e.g., WO 2009/080251, WO 2016/016299, also see Schaefer et al, PNAS, 108 (2011) 1187-1191, and Klein at al., MAbs 8 (2016) 1010-20). Asymmetrical Fab arms can also be engineered by introducing charged or non-charged amino acid mutations into domain interfaces to direct correct Fab pairing. See e.g., WO 2016/172485.
[0228] Various further molecular formats for multispecific antibodies are known in the art and are included herein (see e.g., Spiess et al., Mol Immunol 67 (2015) 95-106).
[0229] Preferred aspects of the multispecific antibodies of the present invention are described in the following.
[0230] In one aspect, the invention provides an antibody that binds to NKG2D, comprising a first antigen binding domain that binds to NKG2D, as described herein, and comprising a second antigen binding domain that binds to a second antigen.
[0231] According to preferred aspects of the invention, the antigen binding domains comprised in the antibody are Fab molecules (i.e. antigen binding domains composed of a heavy and a light chain, each comprising a variable and a constant domain). In one aspect, the first and/or the second antigen binding domain is a Fab molecule. In one aspect, said Fab molecule is human. In another aspect, said Fab molecule is humanized. In yet another aspect, said Fab molecule comprises human heavy and light chain constant domains.
[0232] Preferably, at least one of the antigen binding domains is a crossover Fab molecule. Such modification reduces mispairing of heavy and light chains from different Fab molecules, thereby improving the yield and purity of the (multispecific) antibody of the invention in recombinant production. In a preferred crossover Fab molecule useful for the (multispecific) antibody of the invention, the variable domains of the Fab light chain and the Fab heavy chain (VL and VH, respectively) are exchanged. Even with this domain exchange, however, the preparation of the (multispecific) antibody may comprise certain side products due to a so-called Bence Jones-type interaction between mispaired heavy and light chains (see Schaefer et al, PNAS, 108 (2011) 11187-11191). To further reduce mispairing of heavy and light chains from different Fab molecules and thus increase the purity and yield of the desired (multispecific) antibody, charged amino acids with opposite charges may be introduced at specific amino acid positions in the CH1 and CL domains of either the Fab molecule(s) binding to the first antigen (NKG2D), or the Fab molecule(s) binding to the second antigen (e.g. a target cell antigen such as a tumor cell antigen), as further described herein. Charge modifications are made either in the conventional Fab molecule(s) comprised in the (multispecific) antibody (such as shown e.g. in
[0233] In a preferred aspect according to the invention, the (multispecific) antibody is capable of simultaneous binding to the first antigen (i.e. NKG2D), and the second antigen (e.g. a target cell antigen such as a tumor cell antigen). In one aspect, the (multispecific) antibody is capable of crosslinking a NKG2D-expressing cells (such as a T cell or a NK cell) and a target cell (such as a tumor cell) by simultaneous binding to NKG2D and a target cell antigen. In one aspect, such simultaneous binding results in lysis of the target cell, particularly a target cell antigen-expressing tumor cell. In one aspect, such simultaneous binding results in activation of the NKG2D-expressing cell (such as a T cell or a NK cell). In other aspects, such simultaneous binding results in a cellular response of a NKG2D-expressing cell (such as a T cell or a NK cell) selected from the group of: proliferation, differentiation, cytokine secretion, cytotoxic effector molecule release, cytotoxic activity, and expression of activation markers. In one aspect, binding of the (multispecific) antibody to NKG2D without simultaneous binding to the target cell antigen does not result in activation of a NKG2D-expressing cell (such as a T cell or a NK cell).
[0234] In certain of these aspects, the (multispecific) antibody of the invention is combined with a T-cell activating agent, such as an antibody that binds to CD3, particularly a bispecific antibody that binds to CD3 and a target cell antigen, particularly a tumor cell antigen.
[0235] Preferably, a T cell according to any of the aspects of the invention is a cytotoxic T cell. In some aspects the T cell is a CD8.sup.+ T cell. In other aspects the T cell is a y T cell.
[0236] a) First Antigen Binding Domain
[0237] The (multispecific) antibody of the invention comprises at least one antigen binding domain (the first antigen binding domain) that binds to NKG2D. In preferred aspects, NKG2D is human NKG2D or cynomolgus NKG2D, most particularly human NKG2D. In one aspect the first antigen binding domain is cross-reactive for (i.e. binds to) human and cynomolgus NKG2D. In some aspects, NKG2D is the extracellular domain of NKG2D.
[0238] In a preferred aspect, the (multispecific) antibody comprises not more than one antigen binding domain that binds to NKG2D. In one aspect the (multispecific) antibody provides monovalent binding to NKG2D. In other aspects, the (multispecific) antibody comprises more than one (e.g. two, three, or four) antigen binding domain that binds to NKG2D. In one aspect the (multispecific) antibody provides multivalent binding to NKG2D. In one aspect, the (multispecific) antibody comprises two antigen binding domains that bind to NKG2D. In one aspect the (multispecific) antibody provides bivalent binding to NKG2D. In another aspect, the (multispecific) antibody comprises four antigen binding domains that bind to NKG2D. In one aspect the (multispecific) antibody provides tetravalent binding to NKG2D.
[0239] In aspects wherein the (multispecific) antibody comprises more than one antigen binding domain that binds to NKG2D, preferably all of these antigen binding domains are identical, i.e. they have the same molecular format (e.g. conventional or crossover Fab molecule) and comprise the same amino acid sequences including the same amino acid substitutions in the CH1 and CL domain as described herein (if any).
[0240] In one aspect, the antigen binding domain(s) that binds to NKG2D is an antibody fragment selected from the group of an Fv molecule, a scFv molecule, a Fab molecule, and a F(ab).sub.2 molecule. In a preferred aspect, the antigen binding domain(s) that binds to NKG2D is a Fab molecule.
[0241] In some aspects, the antigen binding domain(s) that binds to NKG2D is a crossover Fab molecule as described herein, i.e. a Fab molecule wherein the variable domains VH and VL or the constant domains CH1 and CL of the Fab heavy and light chains are exchanged/replaced by each other. In such aspects, the antigen binding domain(s) that binds to the second antigen (e.g. a target cell antigen such as a tumor cell antigen) is preferably a conventional Fab molecule.
[0242] In alternative aspects, the antigen binding domain(s) that binds to NKG2D is a conventional Fab molecule. In such aspects, the antigen binding domain(s) that binds to the second antigen (e.g. a target cell antigen such as a tumor cell antigen) is a crossover Fab molecule as described herein, i.e. a Fab molecule wherein the variable domains VH and VL or the constant domains CH1 and CL of the Fab heavy and light chains are exchanged/replaced by each other.
[0243] In preferred aspects, the first antigen binding domain is a Fab molecule wherein the variable domains VL and VH or the constant domains CL and CH1, particularly the variable domains VL and VH, of the Fab light chain and the Fab heavy chain are replaced by each other (i.e. according to such aspect, the first antigen binding domain is a crossover Fab molecule wherein the variable or constant domains of the Fab light chain and the Fab heavy chain are exchanged). In one such aspect, the second antigen binding domain is a conventional Fab molecule.
[0244] b) Second Antigen Binding Domain
[0245] In certain aspects, the (multispecific) antibody of the invention comprises an antigen binding domain (the second antigen binding domain) that binds to a second antigen. The second antigen preferably is not NKG2D, i.e. different from NKG2D. In one aspect, the second antigen is an antigen expressed on a different cell than NKG2D (e.g. expressed on a cell other than a T cell or an NK cell). In one aspect, the second antigen is not an activating Fc receptor, particularly FcRIIIa (CD16a). In one aspect, the antibody does not bind to an activating Fc receptor, particularly FcRIIIa (CD16a). In one aspect, the second antigen is not CD3. In one aspect, the antibody does not bind to CD3.
[0246] In preferred aspects, the second antigen is a target cell antigen, particularly a tumor cell antigen. In a specific aspect, the second antigen is CEA. According to the invention, the second antigen binding domain is able to direct the (multispecific) antibody to a target site, for example to a specific type of tumor cell that expresses the second antigen.
[0247] In a preferred aspect, the (multispecific) antibody comprises not more than one antigen binding domain that binds to the second antigen. In one aspect the (multispecific) antibody provides monovalent binding to the second antigen. In other aspects, the (multispecific) antibody comprises more than one (e.g. two, three, or four) antigen binding domain that binds to the second antigen. In one aspect the (multispecific) antibody provides multivalent binding to the second antigen. In one aspect, the (multispecific) antibody comprises two antigen binding domains that bind to the second antigen. In one aspect the (multispecific) antibody provides bivalent binding to the second antigen.
[0248] In aspects wherein the (multispecific) antibody comprises more than one antigen binding domain, particularly Fab molecule, that binds to the second antigen, preferably each of these antigen binding domains binds to the same antigenic determinant. In an even more preferred aspect, all of these antigen binding domains are identical, i.e. they have the same molecular format (e.g. conventional or crossover Fab molecule) and comprise the same amino acid sequences including the same amino acid substitutions in the CH1 and CL domain as described herein (if any).
[0249] In one aspect, the antigen binding domain(s) that binds to the second antigen is an antibody fragment selected from the group of an Fv molecule, a scFv molecule, a Fab molecule, and a F(ab).sub.2 molecule. In a preferred aspect, the antigen binding domain(s) that binds to the second antigen is a Fab molecule. In another aspect, the antigen binding domain(s) that binds to the second antigen is an Fv molecule.
[0250] In some aspects, the antigen binding domain(s) that binds to the second antigen is conventional Fab molecule. In such aspects, the antigen binding domain(s) that binds to NKG2D is a crossover Fab molecule as described herein, i.e. a Fab molecule wherein the variable domains VH and VL or the constant domains CH1 and CL of the Fab heavy and light chains are exchanged/replaced by each other.
[0251] In alternative aspects, the antigen binding domain(s) that binds to the second antigen is a crossover Fab molecule as described herein, i.e. a Fab molecule wherein the variable domains VH and VL or the constant domains CH1 and CL of the Fab heavy and light chains are exchanged/replaced by each other. In such aspects, the antigen binding domain(s) that binds to NKG2D is a conventional Fab molecule.
[0252] In one aspect, the second antigen binding domain comprises a human constant region. In one aspect, the second antigen binding domain is a Fab molecule comprising a human constant region, particularly a human CH1 and/or CL domain. Exemplary sequences of human constant domains are given in SEQ ID NOs 83 and 84 (human kappa and lambda CL domains, respectively) and SEQ ID NO: 85 (human IgG1 heavy chain constant domains CH1-CH2-CH3). In one aspect, the second antigen binding domain comprises a light chain constant region comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 83 or SEQ ID NO: 84, particularly the amino acid sequence of SEQ ID NO: 83. Particularly, the light chain constant region may comprise amino acid mutations as described herein under charge modifications and/or may comprise deletion or substitutions of one or more (particularly two) N-terminal amino acids if in a crossover Fab molecule. In some aspects, the second antigen binding domain comprises a heavy chain constant region comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the CH1 domain sequence comprised in the amino acid sequence of SEQ ID NO: 85. Particularly, the heavy chain constant region (specifically CH1 domain) may comprise amino acid mutations as described herein under charge modifications.
[0253] In some aspects, the second antigen is CEA, particularly human CEA.
[0254] In one aspect, the second antigen binding domain comprises a heavy chain variable region (VH) comprising a heavy chain complementary determining region (HCDR) 1 of SEQ ID NO: 114, a HCDR 2 of SEQ ID NO: 115, and a HCDR 3 of SEQ ID NO: 116, and a light chain variable region (VL) comprising a light chain complementarity determining region (LCDR) 1 of SEQ ID NO: 117, a LCDR 2 of SEQ ID NO: 118 and a LCDR 3 of SEQ ID NO: 119.
[0255] In one aspect, the second antigen binding domain comprises a VH comprising the heavy chain CDR sequences of the VH of SEQ ID NO: 120, and a VL comprising the light chain CDR sequences of the VL of SEQ ID NO: 121.
[0256] In one aspect, the VH of the second antigen binding domain comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 120, and/or the VL of the second antigen binding domain comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 121. In one aspect, the VH comprises the amino acid sequence of SEQ ID NO: 120 and/or the VL comprises the amino acid sequence of SEQ ID NO: 121.
[0257] In another aspect, the second antigen binding domain comprises a heavy chain variable region (VH) comprising a heavy chain complementary determining region (HCDR) 1 of SEQ ID NO: 122, a HCDR 2 of SEQ ID NO: 123, and a HCDR 3 of SEQ ID NO: 124, and a light chain variable region (VL) comprising a light chain complementarity determining region (LCDR) 1 of SEQ ID NO: 125, a LCDR 2 of SEQ ID NO: 126 and a LCDR 3 of SEQ ID NO: 127.
[0258] In one aspect, the second antigen binding domain is (derived from) a humanized antibody. In one aspect, the second antigen binding domain is a humanized antigen binding domain (i.e. an antigen binding domain of a humanized antibody). In one aspect, the VH and/or the VL of the second antigen binding domain is a humanized variable region.
[0259] In one aspect, the VH of the second antigen binding domain comprises an acceptor human framework, e.g. a human immunoglobulin framework or a human consensus framework.
[0260] In one aspect, the VH of the second antigen binding domain comprises one or more heavy chain framework sequence (i.e. the FR1, FR2, FR3 and/or FR4 sequence) of the heavy chain variable region sequence of SEQ ID NO: 128. In one aspect, the VH comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 128. In one aspect, the VH comprises an amino acid sequence that is at least about 95% identical to the amino acid sequence of SEQ ID NO: 128. In one aspect, the VH comprises an amino acid sequence that is at least about 98% identical to the amino acid sequence of SEQ ID NO: 128. In certain aspects, a VH sequence having at least 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an antibody comprising that sequence retains the ability to bind to the second antigen. In certain aspects, a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in the amino acid sequence of SEQ ID NO: 128. In certain aspects, substitutions, insertions, or deletions occur in regions outside the CDRs (i.e., in the FRs). In one aspect, the VH comprises the amino acid sequence of SEQ ID NO: 128. Optionally, the VH comprises the amino acid sequence of SEQ ID NO: 128, including post-translational modifications of that sequence.
[0261] In one aspect, the VL of the second antigen binding domain comprises one or more light chain framework sequence (i.e. the FR1, FR2, FR3 and/or FR4 sequence) of the light chain variable region sequence of SEQ ID NO: 129. In one aspect, the VL comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 129. In one aspect, the VL comprises an amino acid sequence that is at least about 95% identical to the amino acid sequence of SEQ ID NO: 129. In one aspect, the VL comprises an amino acid sequence that is at least about 98% identical to the amino acid sequence of SEQ ID NO: 129. In certain aspects, a VL sequence having at least 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an antibody comprising that sequence retains the ability to bind to the second antigen. In certain aspects, a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in the amino acid sequence of SEQ ID NO: 129. In certain aspects, substitutions, insertions, or deletions occur in regions outside the CDRs (i.e., in the FRs). In one aspect, the VL comprises the amino acid sequence of SEQ ID NO: 129. Optionally, the VL comprises the amino acid sequence of SEQ ID NO: 129, including post-translational modifications of that sequence.
[0262] In one aspect, the VH of the second antigen binding domain comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 128, and the VL of the second antigen binding domain comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 129. In one aspect, the VH comprises the amino acid sequence of SEQ ID NO: 128 and the VL comprises the amino acid sequence of SEQ ID NO: 129.
[0263] In a further aspect, the second antigen binding domain comprises a VH comprising the amino acid sequence of SEQ ID NO: 128 and a VL comprising the amino acid sequence of SEQ ID NO: 129.
[0264] In a further aspect, the second antigen binding domain comprises a VH sequence of SEQ ID NO: 128 and a VL sequence of SEQ ID NO: 129.
[0265] In another aspect, the second antigen binding domain comprises a VH comprising the heavy chain CDR sequences of the VH of SEQ ID NO: 128, and a VL comprising the light chain CDR sequences of the VL of SEQ ID NO: 129.
[0266] In a further aspect, the second antigen binding domain comprises the HCDR1, HCDR2 and HCDR3 amino acid sequences of the VH of SEQ ID NO: 128 and the LCDR1, LCDR2 and LCDR3 amino acid sequences of the VL of SEQ ID NO: 129.
[0267] In one aspect, the VH of the second antigen binding domain comprises the heavy chain CDR sequences of the VH of SEQ ID NO: 128 and a framework of at least 95%, 96%, 97%, 98% or 99% sequence identity to the framework sequence of the VH of SEQ ID NO: 128. In one aspect, the VH comprises the heavy chain CDR sequences of the VH of SEQ ID NO: 128 and a framework of at least 95% sequence identity to the framework sequence of the VH of SEQ ID NO: 128. In another aspect, the VH comprises the heavy chain CDR sequences of the VH of SEQ ID NO: 128 and a framework of at least 98% sequence identity to the framework sequence of the VH of SEQ ID NO: 128.
[0268] In one aspect, the VL of the second antigen binding domain comprises the light chain CDR sequences of the VL of SEQ ID NO: 129 and a framework of at least 95%, 96%, 97%, 98% or 99% sequence identity to the framework sequence of the VL of SEQ ID NO: 129. In one aspect, the VL comprises the light chain CDR sequences of the VL of SEQ ID NO: 129 and a framework of at least 95% sequence identity to the framework sequence of the VL of SEQ ID NO: 129. In another aspect, the VL comprises the light chain CDR sequences of the VL of SEQ ID NO: 129 and a framework of at least 98% sequence identity to the framework sequence of the VL of SEQ ID NO: 129.
[0269] In another aspect, the second antigen binding domain comprises a heavy chain variable region (VH) comprising a heavy chain complementary determining region (HCDR) 1 of SEQ ID NO: 165, a HCDR 2 of SEQ ID NO: 168, and a HCDR 3 of SEQ ID NO: 171, and a light chain variable region (VL) comprising a light chain complementarity determining region (LCDR) 1 of SEQ ID NO: 177, a LCDR 2 of SEQ ID NO: 126 and a LCDR 3 of SEQ ID NO: 179.
[0270] In one aspect, the second antigen binding domain comprises
(i) a heavy chain variable region (VH) comprising a heavy chain complementary determining region (HCDR) 1 of SEQ ID NO: 122, a HCDR 2 of SEQ ID NO: 123, and a HCDR 3 of SEQ ID NO: 172, and a light chain variable region (VL) comprising a light chain complementarity determining region (LCDR) 1 of SEQ ID NO: 125, a LCDR 2 of SEQ ID NO: 126 and a LCDR 3 of SEQ ID NO: 180;
(ii) a heavy chain variable region (VH) comprising a heavy chain complementary determining region (HCDR) 1 of SEQ ID NO: 122, a HCDR 2 of SEQ ID NO: 123, and a HCDR 3 of SEQ ID NO: 173, and a light chain variable region (VL) comprising a light chain complementarity determining region (LCDR) 1 of SEQ ID NO: 125, a LCDR 2 of SEQ ID NO: 126 and a LCDR 3 of SEQ ID NO: 181;
(iii) a heavy chain variable region (VH) comprising a heavy chain complementary determining region (HCDR) 1 of SEQ ID NO: 122, a HCDR 2 of SEQ ID NO: 123, and a HCDR 3 of SEQ ID NO: 174, and a light chain variable region (VL) comprising a light chain complementarity determining region (LCDR) 1 of SEQ ID NO: 125, a LCDR 2 of SEQ ID NO: 126 and a LCDR 3 of SEQ ID NO: 182;
(iv) a heavy chain variable region (VH) comprising a heavy chain complementary determining region (HCDR) 1 of SEQ ID NO: 166, a HCDR 2 of SEQ ID NO: 169, and a HCDR 3 of SEQ ID NO: 124, and a light chain variable region (VL) comprising a light chain complementarity determining region (LCDR) 1 of SEQ ID NO: 178, a LCDR 2 of SEQ ID NO: 126 and a LCDR 3 of SEQ ID NO: 127;
(v) a heavy chain variable region (VH) comprising a heavy chain complementary determining region (HCDR) 1 of SEQ ID NO: 122, a HCDR 2 of SEQ ID NO: 170, and a HCDR 3 of SEQ ID NO: 124, and a light chain variable region (VL) comprising a light chain complementarity determining region (LCDR) 1 of SEQ ID NO: 125, a LCDR 2 of SEQ ID NO: 126 and a LCDR 3 of SEQ ID NO: 127;
(vi) a heavy chain variable region (VH) comprising a heavy chain complementary determining region (HCDR) 1 of SEQ ID NO: 122, a HCDR 2 of SEQ ID NO: 123, and a HCDR 3 of SEQ ID NO: 175, and a light chain variable region (VL) comprising a light chain complementarity determining region (LCDR) 1 of SEQ ID NO: 125, a LCDR 2 of SEQ ID NO: 126 and a LCDR 3 of SEQ ID NO: 183;
(vii) a heavy chain variable region (VH) comprising a heavy chain complementary determining region (HCDR) 1 of SEQ ID NO: 122, a HCDR 2 of SEQ ID NO: 169, and a HCDR 3 of SEQ ID NO: 175, and a light chain variable region (VL) comprising a light chain complementarity determining region (LCDR) 1 of SEQ ID NO: 125, a LCDR 2 of SEQ ID NO: 126 and a LCDR 3 of SEQ ID NO: 183;
(viii) a heavy chain variable region (VH) comprising a heavy chain complementary determining region (HCDR) 1 of SEQ ID NO: 122, a HCDR 2 of SEQ ID NO: 169, and a HCDR 3 of SEQ ID NO: 175, and a light chain variable region (VL) comprising a light chain complementarity determining region (LCDR) 1 of SEQ ID NO: 125, a LCDR 2 of SEQ ID NO: 126 and a LCDR 3 of SEQ ID NO: 183;
(ix) a heavy chain variable region (VH) comprising a heavy chain complementary determining region (HCDR) 1 of SEQ ID NO: 122, a HCDR 2 of SEQ ID NO: 123, and a HCDR 3 of SEQ ID NO: 176, and a light chain variable region (VL) comprising a light chain complementarity determining region (LCDR) 1 of SEQ ID NO: 125, a LCDR 2 of SEQ ID NO: 126 and a LCDR 3 of SEQ ID NO: 182;
(x) a heavy chain variable region (VH) comprising a heavy chain complementary determining region (HCDR) 1 of SEQ ID NO: 122, a HCDR 2 of SEQ ID NO: 169, and a HCDR 3 of SEQ ID NO: 176, and a light chain variable region (VL) comprising a light chain complementarity determining region (LCDR) 1 of SEQ ID NO: 125, a LCDR 2 of SEQ ID NO: 126 and a LCDR 3 of SEQ ID NO: 182;
(xi) a heavy chain variable region (VH) comprising a heavy chain complementary determining region (HCDR) 1 of SEQ ID NO: 166, a HCDR 2 of SEQ ID NO: 169, and a HCDR 3 of SEQ ID NO: 172, and a light chain variable region (VL) comprising a light chain complementarity determining region (LCDR) 1 of SEQ ID NO: 125, a LCDR 2 of SEQ ID NO: 126 and a LCDR 3 of SEQ ID NO: 180; or
(xii) a heavy chain variable region (VH) comprising a heavy chain complementary determining region (HCDR) 1 of SEQ ID NO: 167, a HCDR 2 of SEQ ID NO: 170, and a HCDR 3 of SEQ ID NO: 172, and a light chain variable region (VL) comprising a light chain complementarity determining region (LCDR) 1 of SEQ ID NO: 125, a LCDR 2 of SEQ ID NO: 126 and a LCDR 3 of SEQ ID NO: 180.
[0271] In one aspect, the second antigen binding domain is (derived from) a humanized antibody. In one aspect, the second antigen binding domain is a humanized antigen binding domain (i.e. an antigen binding domain of a humanized antibody). In one aspect, the VH and/or the VL of the second antigen binding domain is a humanized variable region.
[0272] In one aspect, the VH of the second antigen binding domain comprises an acceptor human framework, e.g. a human immunoglobulin framework or a human consensus framework.
[0273] In one aspect, the VH of the second antigen binding domain comprises one or more heavy chain framework sequence (i.e. the FR1, FR2, FR3 and/or FR4 sequence) of a heavy chain variable region sequence selected from the group consisting of SEQ ID NO: 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204 and 206. In one aspect, the VH comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence selected from the group consisting of SEQ ID NO: 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204 and 206. In one aspect, the VH comprises an amino acid sequence that is at least about 95% identical to an amino acid sequence selected from the group consisting of SEQ ID NO: 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204 and 206. In one aspect, the VH comprises an amino acid sequence that is at least about 98% identical to an amino acid sequence selected from the group consisting of SEQ ID NO: 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204 and 206. In certain aspects, a VH sequence having at least 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an antibody comprising that sequence retains the ability to bind to the second antigen. In certain aspects, a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in the amino acid sequence of SEQ ID NO: 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204 or 206. In certain aspects, substitutions, insertions, or deletions occur in regions outside the CDRs (i.e., in the FRs). In one aspect, the VH comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204 and 206. Optionally, the VH comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204 and 206, including post-translational modifications of that sequence.
[0274] In one aspect, the VL of the second antigen binding domain comprises one or more light chain framework sequence (i.e. the FR1, FR2, FR3 and/or FR4 sequence) of a light chain variable region sequence selected from the group of SEQ ID NO: 185, 187, 189, 191, 193, 195, 197, 199, 201, 203, 205 and 207. In one aspect, the VL comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence selected from the group of SEQ ID NO: 185, 187, 189, 191, 193, 195, 197, 199, 201, 203, 205 and 207. In one aspect, the VL comprises an amino acid sequence that is at least about 95% identical to an amino acid sequence selected from the group of SEQ ID NO: 185, 187, 189, 191, 193, 195, 197, 199, 201, 203, 205 and 207. In one aspect, the VL comprises an amino acid sequence that is at least about 98% identical to an amino acid sequence selected from the group of SEQ ID NO: 185, 187, 189, 191, 193, 195, 197, 199, 201, 203, 205 and 207. In certain aspects, a VL sequence having at least 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an antibody comprising that sequence retains the ability to bind to the second antigen. In certain aspects, a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in the amino acid sequence of SEQ ID NO: 185, 187, 189, 191, 193, 195, 197, 199, 201, 203, 205 or 207. In certain aspects, substitutions, insertions, or deletions occur in regions outside the CDRs (i.e., in the FRs). In one aspect, the VL comprises an amino acid sequence selected from the group of SEQ ID NO: 185, 187, 189, 191, 193, 195, 197, 199, 201, 203, 205 and 207. Optionally, the VL comprises an amino acid sequence selected from the group of SEQ ID NO: 185, 187, 189, 191, 193, 195, 197, 199, 201, 203, 205 and 207, including post-translational modifications of that sequence.
[0275] In one aspect, the VH of the second antigen binding domain comprises
(i) an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 184, and the VL of the second antigen binding domain comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 185;
(ii) an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 186, and the VL of the second antigen binding domain comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 187;
(iii) an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 188, and the VL of the second antigen binding domain comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 189;
(iv) an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 190, and the VL of the second antigen binding domain comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 191;
(v) an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 192, and the VL of the second antigen binding domain comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 193;
(vi) an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 194, and the VL of the second antigen binding domain comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 195;
(vii) an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 196, and the VL of the second antigen binding domain comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 197;
(viii) an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 198, and the VL of the second antigen binding domain comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 199;
(ix) an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 200, and the VL of the second antigen binding domain comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 201;
[0276] (x) an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 202, and the VL of the second antigen binding domain comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 203;
[0277] (xi) an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 204, and the VL of the second antigen binding domain comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 205; or
(xii) an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 206, and the VL of the second antigen binding domain comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 207.
[0278] In one aspect, the VH comprises
(i) the amino acid sequence of SEQ ID NO: 184 and the VL comprises the amino acid sequence of SEQ ID NO: 185;
(ii) the amino acid sequence of SEQ ID NO: 186 and the VL comprises the amino acid sequence of SEQ ID NO: 187;
(iii) the amino acid sequence of SEQ ID NO: 188 and the VL comprises the amino acid sequence of SEQ ID NO: 189;
(iv) the amino acid sequence of SEQ ID NO: 190 and the VL comprises the amino acid sequence of SEQ ID NO: 191;
(v) the amino acid sequence of SEQ ID NO: 192 and the VL comprises the amino acid sequence of SEQ ID NO: 193;
(vi) the amino acid sequence of SEQ ID NO: 194 and the VL comprises the amino acid sequence of SEQ ID NO: 195;
(vii) the amino acid sequence of SEQ ID NO: 196 and the VL comprises the amino acid sequence of SEQ ID NO: 197;
(viii) the amino acid sequence of SEQ ID NO: 198 and the VL comprises the amino acid sequence of SEQ ID NO: 199;
(ix) the amino acid sequence of SEQ ID NO: 200 and the VL comprises the amino acid sequence of SEQ ID NO: 201;
[0279] (x) the amino acid sequence of SEQ ID NO: 202 and the VL comprises the amino acid sequence of SEQ ID NO: 203;
[0280] (xi) the amino acid sequence of SEQ ID NO: 204 and the VL comprises the amino acid sequence of SEQ ID NO: 205; or
(xii) the amino acid sequence of SEQ ID NO: 206 and the VL comprises the amino acid sequence of SEQ ID NO: 207.
[0281] In a further aspect, the second antigen binding domain comprises
(i) a VH comprising the amino acid sequence of SEQ ID NO: 184 and a VL comprising the amino acid sequence of SEQ ID NO: 185;
(ii) a VH comprising the amino acid sequence of SEQ ID NO: 186 and a VL comprising the amino acid sequence of SEQ ID NO: 187;
(iii) a VH comprising the amino acid sequence of SEQ ID NO: 188 and a VL comprising the amino acid sequence of SEQ ID NO: 189;
(iv) a VH comprising the amino acid sequence of SEQ ID NO: 190 and a VL comprising the amino acid sequence of SEQ ID NO: 191;
(v) a VH comprising the amino acid sequence of SEQ ID NO: 192 and a VL comprising the amino acid sequence of SEQ ID NO: 193;
(vi) a VH comprising the amino acid sequence of SEQ ID NO: 194 and a VL comprising the amino acid sequence of SEQ ID NO: 195;
(vii) a VH comprising the amino acid sequence of SEQ ID NO: 196 and a VL comprising the amino acid sequence of SEQ ID NO: 197;
(viii) a VH comprising the amino acid sequence of SEQ ID NO: 198 and a VL comprising the amino acid sequence of SEQ ID NO: 199;
(ix) a VH comprising the amino acid sequence of SEQ ID NO: 200 and a VL comprising the amino acid sequence of SEQ ID NO: 201;
[0282] (x) a VH comprising the amino acid sequence of SEQ ID NO: 202 and a VL comprising the amino acid sequence of SEQ ID NO: 203;
[0283] (xi) a VH comprising the amino acid sequence of SEQ ID NO: 204 and a VL comprising the amino acid sequence of SEQ ID NO: 205; or
(xii) a VH comprising the amino acid sequence of SEQ ID NO: 206 and a VL comprising the amino acid sequence of SEQ ID NO: 207.
[0284] In a further aspect, the second antigen binding domain comprises
(i) a VH sequence of SEQ ID NO: 184 and a VL sequence of SEQ ID NO: 185;
(ii) a VH sequence of SEQ ID NO: 186 and a VL sequence of SEQ ID NO: 187;
(iii) a VH sequence of SEQ ID NO: 188 and a VL sequence of SEQ ID NO: 189;
(iv) a VH sequence of SEQ ID NO: 190 and a VL sequence of SEQ ID NO: 191;
(v) a VH sequence of SEQ ID NO: 192 and a VL sequence of SEQ ID NO: 193;
(vi) a VH sequence of SEQ ID NO: 194 and a VL sequence of SEQ ID NO: 195;
(vii) a VH sequence of SEQ ID NO: 196 and a VL sequence of SEQ ID NO: 197;
(viii) a VH sequence of SEQ ID NO: 198 and a VL sequence of SEQ ID NO: 199;
(ix) a VH sequence of SEQ ID NO: 200 and a VL sequence of SEQ ID NO: 201;
(x) a VH sequence of SEQ ID NO: 202 and a VL sequence of SEQ ID NO: 203;
(xi) a VH sequence of SEQ ID NO: 204 and a VL sequence of SEQ ID NO: 205; or
(xii) a VH sequence of SEQ ID NO: 206 and a VL sequence of SEQ ID NO: 207.
[0285] In another aspect, the second antigen binding domain comprises
(i) a VH comprising the heavy chain CDR sequences of the VH of SEQ ID NO: 184, and a VL comprising the light chain CDR sequences of the VL of SEQ ID NO: 185;
(ii) a VH comprising the heavy chain CDR sequences of the VH of SEQ ID NO: 186, and a VL comprising the light chain CDR sequences of the VL of SEQ ID NO: 187;
(iii) a VH comprising the heavy chain CDR sequences of the VH of SEQ ID NO: 188, and a VL comprising the light chain CDR sequences of the VL of SEQ ID NO: 189;
(iv) a VH comprising the heavy chain CDR sequences of the VH of SEQ ID NO: 190, and a VL comprising the light chain CDR sequences of the VL of SEQ ID NO: 191;
(v) a VH comprising the heavy chain CDR sequences of the VH of SEQ ID NO: 192, and a VL comprising the light chain CDR sequences of the VL of SEQ ID NO: 193;
(vi) a VH comprising the heavy chain CDR sequences of the VH of SEQ ID NO: 194, and a VL comprising the light chain CDR sequences of the VL of SEQ ID NO: 195;
(vii) a VH comprising the heavy chain CDR sequences of the VH of SEQ ID NO: 196, and a VL comprising the light chain CDR sequences of the VL of SEQ ID NO: 197;
(viii) a VH comprising the heavy chain CDR sequences of the VH of SEQ ID NO: 198, and a VL comprising the light chain CDR sequences of the VL of SEQ ID NO: 199;
(ix) a VH comprising the heavy chain CDR sequences of the VH of SEQ ID NO: 200, and a VL comprising the light chain CDR sequences of the VL of SEQ ID NO: 201;
(x) a VH comprising the heavy chain CDR sequences of the VH of SEQ ID NO: 202, and a VL comprising the light chain CDR sequences of the VL of SEQ ID NO: 203;
(xi) a VH comprising the heavy chain CDR sequences of the VH of SEQ ID NO: 204, and a VL comprising the light chain CDR sequences of the VL of SEQ ID NO: 205; or
(xii) a VH comprising the heavy chain CDR sequences of the VH of SEQ ID NO: 206, and a VL comprising the light chain CDR sequences of the VL of SEQ ID NO: 207.
[0286] In a further aspect, the second antigen binding domain comprises
(i) the HCDR1, HCDR2 and HCDR3 amino acid sequences of the VH of SEQ ID NO: 184 and the LCDR1, LCDR2 and LCDR3 amino acid sequences of the VL of SEQ ID NO: 185;
(ii) the HCDR1, HCDR2 and HCDR3 amino acid sequences of the VH of SEQ ID NO: 186 and the LCDR1, LCDR2 and LCDR3 amino acid sequences of the VL of SEQ ID NO: 187;
(iii) the HCDR1, HCDR2 and HCDR3 amino acid sequences of the VH of SEQ ID NO: 188 and the LCDR1, LCDR2 and LCDR3 amino acid sequences of the VL of SEQ ID NO: 189;
(iv) the HCDR1, HCDR2 and HCDR3 amino acid sequences of the VH of SEQ ID NO: 190 and the LCDR1, LCDR2 and LCDR3 amino acid sequences of the VL of SEQ ID NO: 191;
(v) the HCDR1, HCDR2 and HCDR3 amino acid sequences of the VH of SEQ ID NO: 192 and the LCDR1, LCDR2 and LCDR3 amino acid sequences of the VL of SEQ ID NO: 193;
(vi) the HCDR1, HCDR2 and HCDR3 amino acid sequences of the VH of SEQ ID NO: 194 and the LCDR1, LCDR2 and LCDR3 amino acid sequences of the VL of SEQ ID NO: 195;
(vii) the HCDR1, HCDR2 and HCDR3 amino acid sequences of the VH of SEQ ID NO: 196 and the LCDR1, LCDR2 and LCDR3 amino acid sequences of the VL of SEQ ID NO: 197;
(viii) the HCDR1, HCDR2 and HCDR3 amino acid sequences of the VH of SEQ ID NO: 198 and the LCDR1, LCDR2 and LCDR3 amino acid sequences of the VL of SEQ ID NO: 199;
(ix) the HCDR1, HCDR2 and HCDR3 amino acid sequences of the VH of SEQ ID NO: 200 and the LCDR1, LCDR2 and LCDR3 amino acid sequences of the VL of SEQ ID NO: 201;
(x) the HCDR1, HCDR2 and HCDR3 amino acid sequences of the VH of SEQ ID NO: 202 and the LCDR1, LCDR2 and LCDR3 amino acid sequences of the VL of SEQ ID NO: 203;
(xi) the HCDR1, HCDR2 and HCDR3 amino acid sequences of the VH of SEQ ID NO: 204 and the LCDR1, LCDR2 and LCDR3 amino acid sequences of the VL of SEQ ID NO: 205; or
(xii) the HCDR1, HCDR2 and HCDR3 amino acid sequences of the VH of SEQ ID NO: 206 and the LCDR1, LCDR2 and LCDR3 amino acid sequences of the VL of SEQ ID NO: 207.
[0287] In one aspect, the VH of the second antigen binding domain comprises the heavy chain CDR sequences of a VH selected from the group consisting of SEQ ID NO: 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204 and 206 and a framework of at least 95%, 96%, 97%, 98% or 99% sequence identity to the framework sequence of a VH selected from the group consisting of SEQ ID NO: 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204 and 206. In one aspect, the VH comprises the heavy chain CDR sequences of a VH selected from the group consisting of SEQ ID NO: 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204 and 206 and a framework of at least 95% sequence identity to the framework sequence of a VH selected from the group consisting of SEQ ID NO: 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204 and 206. In another aspect, the VH comprises the heavy chain CDR sequences of a VH selected from the group consisting of SEQ ID NO: 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204 and 206 and a framework of at least 98% sequence identity to the framework sequence of a VH selected from the group consisting of SEQ ID NO: 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204 and 206.
[0288] In one aspect, the VL of the second antigen binding domain comprises the light chain CDR sequences of a VL selected from the group of SEQ ID NO: 185, 187, 189, 191, 193, 195, 197, 199, 201, 203, 205 and 207 and a framework of at least 95%, 96%, 97%, 98% or 99% sequence identity to the framework sequence of a VL selected from the group of SEQ ID NO: 185, 187, 189, 191, 193, 195, 197, 199, 201, 203, 205 and 207. In one aspect, the VL comprises the light chain CDR sequences of a VL selected from the group of SEQ ID NO: 185, 187, 189, 191, 193, 195, 197, 199, 201, 203, 205 and 207 and a framework of at least 95% sequence identity to the framework sequence of a VL selected from the group of SEQ ID NO: 185, 187, 189, 191, 193, 195, 197, 199, 201, 203, 205 and 207. In another aspect, the VL comprises the light chain CDR sequences of a VL selected from the group of SEQ ID NO: 185, 187, 189, 191, 193, 195, 197, 199, 201, 203, 205 and 207 and a framework of at least 98% sequence identity to the framework sequence of a VL selected from the group of SEQ ID NO: 185, 187, 189, 191, 193, 195, 197, 199, 201, 203, 205 and 207.
[0289] In one aspect, the second antigen binding domain comprises a VH sequence as in any of the aspects provided in this section above, and a VL sequence as in any of the aspects provided in this section above.
[0290] c) Charge Modifications
[0291] The (multispecific) antibody of the invention may comprise amino acid substitutions in Fab molecules comprised therein which are particularly efficient in reducing mispairing of light chains with non-matching heavy chains (Bence-Jones-type side products), which can occur in the production of Fab-based multispecific antibodies with a VH/VL exchange in one (or more, in case of molecules comprising more than two antigen-binding Fab molecules) of their binding arms (see also PCT publication no. WO 2015/150447, particularly the examples therein, incorporated herein by reference in its entirety). The ratio of a desired (multispecific) antibody compared to undesired side products, in particular Bence Jones-type side products occurring in multispecific antibodies with a VH/VL domain exchange in one of their binding arms, can be improved by the introduction of charged amino acids with opposite charges at specific amino acid positions in the CH1 and CL domains (sometimes referred to herein as charge modifications).
[0292] Accordingly, in some aspects wherein the first and the second antigen binding domain of the (multispecific) antibody are both Fab molecules, and in one of the antigen binding domains (particularly the first antigen binding domain) the variable domains VL and VH of the Fab light chain and the Fab heavy chain are replaced by each other,
i) in the constant domain CL of the second antigen binding domain the amino acid at position 124 is substituted by a positively charged amino acid (numbering according to Kabat), and wherein in the constant domain CH1 of the second antigen binding domain the amino acid at position 147 or the amino acid at position 213 is substituted by a negatively charged amino acid (numbering according to Kabat EU index); or
ii) in the constant domain CL of the first antigen binding domain the amino acid at position 124 is substituted by a positively charged amino acid (numbering according to Kabat), and wherein in the constant domain CH1 of the first antigen binding domain the amino acid at position 147 or the amino acid at position 213 is substituted by a negatively charged amino acid (numbering according to Kabat EU index).
[0293] The (multispecific) antibody does not comprise both modifications mentioned under i) and ii). The constant domains CL and CH1 of the antigen binding domain having the VH/VL exchange are not replaced by each other (i.e. remain unexchanged).
[0294] In a more specific aspect,
i) in the constant domain CL of the second antigen binding domain the amino acid at position 124 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat), and in the constant domain CH1 of the second antigen binding domain the amino acid at position 147 or the amino acid at position 213 is substituted independently by glutamic acid (E), or aspartic acid (D) (numbering according to Kabat EU index); or
ii) in the constant domain CL of the first antigen binding domain the amino acid at position 124 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat), and in the constant domain CH1 of the first antigen binding domain the amino acid at position 147 or the amino acid at position 213 is substituted independently by glutamic acid (E), or aspartic acid (D) (numbering according to Kabat EU index).
[0295] In one such aspect, in the constant domain CL of the second antigen binding domain the amino acid at position 124 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat), and in the constant domain CH1 of the second antigen binding domain the amino acid at position 147 or the amino acid at position 213 is substituted independently by glutamic acid (E), or aspartic acid (D) (numbering according to Kabat EU index).
[0296] In a further aspect, in the constant domain CL of the second antigen binding domain the amino acid at position 124 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat), and in the constant domain CH1 of the second antigen binding domain the amino acid at position 147 is substituted independently by glutamic acid (E), or aspartic acid (D) (numbering according to Kabat EU index).
[0297] In a preferred aspect, in the constant domain CL of the second antigen binding domain the amino acid at position 124 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat) and the amino acid at position 123 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat), and in the constant domain CH1 of the second antigen binding domain the amino acid at position 147 is substituted independently by glutamic acid (E), or aspartic acid (D) (numbering according to Kabat EU index) and the amino acid at position 213 is substituted independently by glutamic acid (E), or aspartic acid (D) (numbering according to Kabat EU index).
[0298] In a more preferred aspect, in the constant domain CL of the second antigen binding domain the amino acid at position 124 is substituted by lysine (K) (numbering according to Kabat) and the amino acid at position 123 is substituted by lysine (K) (numbering according to Kabat), and in the constant domain CH1 of the second antigen binding domain the amino acid at position 147 is substituted by glutamic acid (E) (numbering according to Kabat EU index) and the amino acid at position 213 is substituted by glutamic acid (E) (numbering according to Kabat EU index).
[0299] In an even more preferred aspect, in the constant domain CL of the second antigen binding domain the amino acid at position 124 is substituted by lysine (K) (numbering according to Kabat) and the amino acid at position 123 is substituted by arginine (R) (numbering according to Kabat), and in the constant domain CH1 of the second antigen binding domain the amino acid at position 147 is substituted by glutamic acid (E) (numbering according to Kabat EU index) and the amino acid at position 213 is substituted by glutamic acid (E) (numbering according to Kabat EU index).
[0300] In preferred aspects, if amino acid substitutions according to the above aspects are made in the constant domain CL and the constant domain CH1 of the second antigen binding domain, the constant domain CL of the second antigen binding domain is of kappa isotype.
[0301] Alternatively, the amino acid substitutions according to the above aspects may be made in the constant domain CL and the constant domain CH1 of the first antigen binding domain instead of in the constant domain CL and the constant domain CH1 of the second antigen binding domain. In preferred such aspects, the constant domain CL of the first antigen binding domain is of kappa isotype.
[0302] Accordingly, in one aspect, in the constant domain CL of the first antigen binding domain the amino acid at position 124 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat), and in the constant domain CH1 of the first antigen binding domain the amino acid at position 147 or the amino acid at position 213 is substituted independently by glutamic acid (E), or aspartic acid (D) (numbering according to Kabat EU index).
[0303] In a further aspect, in the constant domain CL of the first antigen binding domain the amino acid at position 124 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat), and in the constant domain CH1 of the first antigen binding domain the amino acid at position 147 is substituted independently by glutamic acid (E), or aspartic acid (D) (numbering according to Kabat EU index).
[0304] In still another aspect, in the constant domain CL of the first antigen binding domain the amino acid at position 124 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat) and the amino acid at position 123 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat), and in the constant domain CH1 of the first antigen binding domain the amino acid at position 147 is substituted independently by glutamic acid (E), or aspartic acid (D) (numbering according to Kabat EU index) and the amino acid at position 213 is substituted independently by glutamic acid (E), or aspartic acid (D) (numbering according to Kabat EU index).
[0305] In one aspect, in the constant domain CL of the first antigen binding domain the amino acid at position 124 is substituted by lysine (K) (numbering according to Kabat) and the amino acid at position 123 is substituted by lysine (K) (numbering according to Kabat), and in the constant domain CH1 of the first antigen binding domain the amino acid at position 147 is substituted by glutamic acid (E) (numbering according to Kabat EU index) and the amino acid at position 213 is substituted by glutamic acid (E) (numbering according to Kabat EU index).
[0306] In another aspect, in the constant domain CL of the first antigen binding domain the amino acid at position 124 is substituted by lysine (K) (numbering according to Kabat) and the amino acid at position 123 is substituted by arginine (R) (numbering according to Kabat), and in the constant domain CH1 of the first antigen binding domain the amino acid at position 147 is substituted by glutamic acid (E) (numbering according to Kabat EU index) and the amino acid at position 213 is substituted by glutamic acid (E) (numbering according to Kabat EU index).
[0307] In a preferred aspect, the (multispecific) antibody of the invention comprises
(a) a first antigen binding domain that binds to NKG2D, wherein the first antigen binding domain is a Fab molecule wherein the variable domains VL and VH of the Fab light chain and the Fab heavy chain are replaced by each other, and comprises a heavy chain variable region (VH) and a light chain variable region (VL) as in any of the aspects provided in relation to the first antigen binding domain herein;
(b) a second antigen binding domain that binds to a second antigen;
wherein in the constant domain CL of the second (and, where present, third) antigen binding domain the amino acid at position 124 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat) (in a preferred aspect independently by lysine (K) or arginine (R)) and the amino acid at position 123 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat) (in a preferred aspect independently by lysine (K) or arginine (R)), and in the constant domain CH1 of the second (and, where present, third) antigen binding domain the amino acid at position 147 is substituted independently by glutamic acid (E), or aspartic acid (D) (numbering according to Kabat EU index) and the amino acid at position 213 is substituted independently by glutamic acid (E), or aspartic acid (D) (numbering according to Kabat EU index).
[0308] d) Multispecific Antibody Formats
[0309] The (multispecific) antibodies according to the present invention can have a variety of configurations. Exemplary configurations are depicted in
[0310] In preferred aspects, the antigen binding domains comprised in the (multispecific) antibody are Fab molecules. In such aspects, the first, second etc. antigen binding domain may be referred to herein as first, second etc. Fab molecule, respectively.
[0311] In preferred aspects, the first and the second antigen binding domain are each a Fab molecule. In some aspects, the first and/or the second (particularly the second) antigen binding domain may be an Fv molecule.
[0312] In aspects wherein the first and the second antigen binding domain are each a Fab molecule, preferably the first antigen binding domain is a crossover Fab molecule as described herein (i.e. a Fab molecule wherein the variable domains VH and VL or the constant domains CH1 and CL of the Fab heavy and light chains are exchanged/replaced by each other), and the second antigen binding domain is a conventional Fab moleculeor vice versa.
[0313] In aspects wherein the (multispecific) antibody comprises more than one antigen binding domain that binds to NKG2D and/or more than one antigen binding domain that binds to a second antigen, preferably all the antigen binding domains that bind NKG2D are crossover Fab molecules as described herein, and all the antigen binding domains that bind the second antigen are conventional Fab moleculesor vice versa.
[0314] In preferred aspects, the (multispecific) antibody of the invention comprises an Fc domain composed of a first and a second subunit. The first and the second subunit of the Fc domain are capable of stable association.
[0315] The (multispecific) antibody according to the invention can have different configurations, i.e. the first, second and optionally further antigen binding domains may be fused to each other and to the Fc domain in different ways. The components may be fused to each other directly or, preferably, via one or more suitable peptide linkers. Where fusion of a Fab molecule is to the N-terminus of a subunit of the Fc domain, it is typically via an immunoglobulin hinge region.
[0316] In preferred aspects, the (multispecific) antibody of the invention comprises
(a) a first antigen binding domain that binds to NKG2D,
(b) a second antigen binding domain that binds to a second antigen, and
(c) an Fc domain composed of a first and a second subunit;
wherein the first and the second antigen binding domains are each a Fab molecule, and
wherein (i) the first antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain and the second antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the second subunit of the Fc domain, or (ii) the first antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the second subunit of the Fc domain and the first antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain.
[0317] An exemplary such configuration is depicted in
[0318] In one such aspect, the first antigen binding domain is a crossover Fab molecule as described herein, and the second antigen binding domain is a conventional Fab molecule. In a more specific such aspect, the first antigen binding domain is a crossover Fab molecule wherein the variable domains VH and VL are exchanged/replaced by each other, and the second antigen binding domain is a conventional Fab molecule comprising charge modifications as described herein.
[0319] In another such aspect, the first antigen binding domain is a conventional Fab molecule, and the second antigen binding domain is a crossover Fab molecule as described herein. In a more specific such aspect, the first antigen binding domain is a conventional Fab molecule comprising charge modifications as described herein, and the second antigen binding domain is a crossover Fab molecule wherein the variable domains VH and VL are exchanged/replaced by each other.
[0320] In a further such aspect, the Fc domain comprises a modification promoting the association of the first and the second subunit of the Fc domain, as described herein.
[0321] In still a further such aspect, the (multispecific) antibody essentially consists of the first and the second antigen binding domain and the Fc domain, and optionally one or more peptide linkers.
[0322] In other aspects, the (multispecific) antibody of the invention comprises
(a) a first antigen binding domain that binds to NKG2D,
(b) a second antigen binding domain that binds to a second antigen,
(c) a third antigen binding domain that binds to NKG2D, and
(d) an Fc domain composed of a first and a second subunit;
wherein the first, second and third antigen binding domains are each a Fab molecule, and
wherein (i) the first antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain, the second antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the second subunit of the Fc domain, and the third antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the Fab heavy chain of the first antigen binding domain, or (ii) the first antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the second subunit of the Fc domain, the second antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain, and the third antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the Fab heavy chain of the first antigen binding domain.
[0323] An exemplary such configuration is depicted in
[0324] In one such aspect, the first and the third antigen binding domains are each a crossover Fab molecule as described herein, and the second antigen binding domain is a conventional Fab molecule. In a more specific such aspect, the first and the third antigen binding domains are each a crossover Fab molecule wherein the variable domains VH and VL are exchanged/replaced by each other, and the second antigen binding domain is a conventional Fab molecule comprising charge modifications as described herein.
[0325] In another such aspect, the first and the third antigen binding domains are each a conventional Fab molecule, and the second antigen binding domain is a crossover Fab molecule as described herein. In a more specific such aspect, the first and the third antigen binding domains are each a conventional Fab molecule comprising charge modifications as described herein, and the second antigen binding domain is a crossover Fab molecule wherein the variable domains VH and VL are exchanged/replaced by each other.
[0326] In a further such aspect, the Fc domain comprises a modification promoting the association of the first and the second subunit of the Fc domain, as described herein.
[0327] In still a further such aspect, the (multispecific) antibody essentially consists of the first, the second and the third antigen binding domain and the Fc domain, and optionally one or more peptide linkers.
[0328] In other aspects, the (multispecific) antibody of the invention comprises
(a) a first antigen binding domain that binds to NKG2D,
(b) a second antigen binding domain that binds to a second antigen,
(c) a third antigen binding domain that binds to NKG2D, and
(d) an Fc domain composed of a first and a second subunit;
wherein the first, second and third antigen binding domains are each a Fab molecule, and
wherein (i) the first antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain, the second antigen binding domain is fused at the N-terminus of the Fab heavy chain to the C-terminus of the second subunit of the Fc domain, and the third antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the Fab heavy chain of the first antigen binding domain, or (ii) the first antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the second subunit of the Fc domain, the second antigen binding domain is fused at the N-terminus of the Fab heavy chain to the C-terminus of the first subunit of the Fc domain, and the third antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the Fab heavy chain of the first antigen binding domain.
[0329] An exemplary such configuration is depicted in
[0330] In one such aspect, the first and the third antigen binding domains are each a crossover Fab molecule as described herein, and the second antigen binding domain is a conventional Fab molecule. In a more specific such aspect, the first and the third antigen binding domains are each a crossover Fab molecule wherein the variable domains VH and VL are exchanged/replaced by each other, and the second antigen binding domain is a conventional Fab molecule comprising charge modifications as described herein.
[0331] In another such aspect, the first and the third antigen binding domains are each a conventional Fab molecule, and the second antigen binding domain is a crossover Fab molecule as described herein. In a more specific such aspect, the first and the third antigen binding domains are each a conventional Fab molecule comprising charge modifications as described herein, and the second antigen binding domain is a crossover Fab molecule wherein the variable domains VH and VL are exchanged/replaced by each other.
[0332] In a further such aspect, the Fc domain comprises a modification promoting the association of the first and the second subunit of the Fc domain, as described herein.
[0333] In still a further such aspect, the (multispecific) antibody essentially consists of the first, the second and the third antigen binding domain and the Fc domain, and optionally one or more peptide linkers.
[0334] In other aspects, the (multispecific) antibody of the invention comprises
(a) a first antigen binding domain that binds to NKG2D,
(b) a second antigen binding domain that binds to a second antigen,
(c) a third antigen binding domain that binds to NKG2D,
(d) a fourth antigen binding domain that binds to NKG2D,
(e) a fifth antigen binding domain that binds to NKG2D, and
(f) an Fc domain composed of a first and a second subunit;
wherein the first, second, third, fourth and fifth antigen binding domains are each a Fab molecule, and
wherein (i) the first antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the Fab heavy chain of the third antigen binding domain, and the third antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain, (ii) the fourth antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the Fab heavy chain of the fifth antigen binding domain, and the fifth antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the second subunit of the Fc domain, and (iii) the second antigen binding domain is fused at the N-terminus of the Fab heavy chain to the C-terminus of the first or the second subunit of the Fc domain.
[0335] An exemplary such configuration is depicted in
[0336] In one such aspect, the first, the third, the fourth and the fifth antigen binding domains are each a crossover Fab molecule as described herein, and the second antigen binding domain is a conventional Fab molecule. In a more specific such aspect, the first, the third, the fourth and the fifth antigen binding domains are each a crossover Fab molecule wherein the variable domains VH and VL are exchanged/replaced by each other, and the second antigen binding domain is a conventional Fab molecule comprising charge modifications as described herein.
[0337] In another such aspect, the first, the third, the fourth and the fifth antigen binding domains are each a conventional Fab molecule, and the second antigen binding domain is a crossover Fab molecule as described herein. In a more specific such aspect, the first, the third, the fourth and the fifth antigen binding domains are each a conventional Fab molecule comprising charge modifications as described herein, and the second antigen binding domain is a crossover Fab molecule wherein the variable domains VH and VL are exchanged/replaced by each other.
[0338] In a further such aspect, the Fc domain comprises a modification promoting the association of the first and the second subunit of the Fc domain, as described herein.
[0339] In still a further such aspect, the (multispecific) antibody essentially consists of the first, the second, the third, the fourth and the fifth antigen binding domain and the Fc domain, and optionally one or more peptide linkers.
[0340] In other aspects, the (multispecific) antibody of the invention comprises
(a) a first antigen binding domain that binds to NKG2D,
(b) a second antigen binding domain that binds to a second antigen,
(c) a third antigen binding domain that binds to NKG2D,
(d) a fourth antigen binding domain that binds to the second antigen,
(e) an Fc domain composed of a first and a second subunit;
wherein the first, second, third and fourth antigen binding domains are each a Fab molecule, and
wherein the first antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain, the second antigen binding domain is fused at the N-terminus of the Fab heavy chain to the C-terminus of the first subunit of the Fc domain, the third antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the second subunit of the Fc domain, and the fourth antigen binding domain is fused at the N-terminus of the Fab heavy chain to the C-terminus of the second subunit of the Fc domain.
[0341] An exemplary such configuration is depicted in
[0342] In one such aspect, the first and the third antigen binding domains are each a crossover Fab molecule as described herein, and the second and the fourth antigen binding domains are each a conventional Fab molecule. In a more specific such aspect, the first and the third antigen binding domains are each a crossover Fab molecule wherein the variable domains VH and VL are exchanged/replaced by each other, and the second and the fourth antigen binding domain are each a conventional Fab molecule comprising charge modifications as described herein.
[0343] In another such aspect, the first and the third antigen binding domains are each a conventional Fab molecule, and the second and the fourth antigen binding domains are each a crossover Fab molecule as described herein. In a more specific such aspect, the first and the third antigen binding domains are each a conventional Fab molecule comprising charge modifications as described herein, and the second and the fourth antigen binding domains are each a crossover Fab molecule wherein the variable domains VH and VL are exchanged/replaced by each other.
[0344] In a further such aspect, the (multispecific) antibody essentially consists of the first, the second, the third and the fourth antigen binding domain and the Fc domain, and optionally one or more peptide linkers.
[0345] In other aspects, the (multispecific) antibody of the invention comprises
(a) a first antigen binding domain that binds to NKG2D,
(b) a second antigen binding domain that binds to a second antigen,
(c) a third antigen binding domain that binds to NKG2D, and
(d) an Fc domain composed of a first and a second subunit;
wherein the first and the third antigen binding domains are each a Fab molecule and the second antigen binding domain is an Fv molecule, and
wherein the first antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain, the third antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the second subunit of the Fc domain, and the second antigen binding domain is fused (i) at the N-terminus of the Fv heavy chain to the C-terminus of the first subunit of the Fc domain and at the N-terminus of the Fv light chain to the C-terminus of the second subunit of the Fc domain, or (ii) at the N-terminus of the Fv heavy chain to the C-terminus of the second subunit of the Fc domain and at the N-terminus of the Fv light chain to the C-terminus of the first subunit of the Fc domain.
[0346] An exemplary such configuration is depicted in
[0347] In one such aspect, the first and the third antigen binding domains are each a conventional Fab molecule.
[0348] In a further such aspect, the Fc domain comprises a modification promoting the association of the first and the second subunit of the Fc domain, as described herein.
[0349] In still a further such aspect, the (multispecific) antibody essentially consists of the first, the second and the third antigen binding domain and the Fc domain, and optionally one or more peptide linkers.
[0350] In configurations of the (multispecific) antibody wherein a Fab molecule is fused at the C-terminus of the Fab heavy chain to the N-terminus of each of the subunits of the Fc domain through an immunoglobulin hinge region, the two Fab molecules, the hinge regions and the Fc domain essentially form an immunoglobulin molecule. In a preferred aspect the immunoglobulin molecule is an IgG class immunoglobulin. In an even more preferred aspect the immunoglobulin is an IgG.sub.1 subclass immunoglobulin. In another aspect the immunoglobulin is an IgG.sub.4 subclass immunoglobulin. In a further preferred aspect the immunoglobulin is a human immunoglobulin. In other aspects the immunoglobulin is a chimeric immunoglobulin or a humanized immunoglobulin. In one aspect, the immunoglobulin comprises a human constant region, particularly a human Fc region.
[0351] The antigen binding domains may be fused to the Fc domain or to each other directly or through a peptide linker, comprising one or more amino acids, typically about 2-20 amino acids. Peptide linkers are known in the art and are described herein. Suitable, non-immunogenic peptide linkers include, for example, (G.sub.4S).sub.n, (SG.sub.4).sub.n, (G.sub.4S).sub.n or G.sub.4(SG.sub.4).sub.n peptide linkers. n is generally an integer from 1 to 10, typically from 2 to 4. In one aspect said peptide linker has a length of at least 5 amino acids, in one aspect a length of 5 to 100, in a further aspect of 10 to 50 amino acids. In one aspect said peptide linker is (GxS).sub.n or (GxS).sub.nG.sub.m with G=glycine, S=serine, and (x=3, n=3, 4, 5 or 6, and m=0, 1, 2 or 3) or (x=4, n=2, 3, 4 or 5 and m=0, 1, 2 or 3), in one aspect x=4 and n=2 or 4. In one aspect said peptide linker is (G.sub.4S).sub.2 or (G.sub.4S).sub.4. In particular aspects, the peptide linker for fusing the Fab heavy chains of a first and a second Fab molecule to each other in the multispecific antibody formats described hereinabove is (G.sub.4S).sub.2. In further particular aspects, the peptide linker for fusing a Fab molecule or an Fv molecule to the C-terminus of the Fc domain in the multispecific antibody formats described hereinabove is (G.sub.4S).sub.4. Suitable peptide linkers may also comprise (a portion of) an immunoglobulin hinge region. Particularly where a Fab molecule is fused to the N-terminus of an Fc domain subunit, it may be fused via an immunoglobulin hinge region or a portion thereof, with or without an additional peptide linker. In particular aspects, the fusion of a Fab molecule to the N-terminus of an Fc domain subunit in the multispecific antibody formats described hereinabove is via an immunoglobulin hinge region, preferably via an immunoglobulin hinge region of the same subclass as the Fc domain (e.g. an IgG.sub.1 hinge region where the Fc domain is of IgG.sub.1 subclass).
[0352] In one aspect, the invention provides a (multispecific) antibody comprising
(a) a first antigen binding domain that binds to NKG2D, wherein the first antigen binding domain comprises a heavy chain variable region (VH) comprising a heavy chain complementary determining region (HCDR) 1 of SEQ ID NO: 73, a HCDR 2 of SEQ ID NO: 104, and a HCDR 3 of SEQ ID NO: 75, and a light chain variable region (VL) comprising a light chain complementarity determining region (LCDR) 1 of SEQ ID NO: 76, a LCDR 2 of SEQ ID NO: 77 and a LCDR 3 of SEQ ID NO: 78,
(b) a second antigen binding domain that binds to a second antigen, particularly a target cell antigen, more particularly a tumor cell antigen, and
(c) an Fc domain composed of a first and a second subunit;
wherein the first and the second antigen binding domains are each a Fab molecule, and
wherein (i) the first antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain and the second antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the second subunit of the Fc domain, or (ii) the first antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the second subunit of the Fc domain and the first antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain.
[0353] In one aspect, the invention provides a (multispecific) antibody comprising
(a) a first antigen binding domain that binds to NKG2D, wherein the first antigen binding domain comprises a heavy chain variable region (VH) comprising a heavy chain complementary determining region (HCDR) 1 of SEQ ID NO: 73, a HCDR 2 of SEQ ID NO: 104, and a HCDR 3 of SEQ ID NO: 75, and a light chain variable region (VL) comprising a light chain complementarity determining region (LCDR) 1 of SEQ ID NO: 76, a LCDR 2 of SEQ ID NO: 77 and a LCDR 3 of SEQ ID NO: 78,
(b) a second antigen binding domain that binds to a second antigen, particularly a target cell antigen, more particularly a tumor cell antigen, and
(c) an Fc domain composed of a first and a second subunit, comprising a modification promoting the association of the first and the second subunit of the Fc domain;
wherein the first and the second antigen binding domains are each a Fab molecule;
wherein (i) the first antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain and the second antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the second subunit of the Fc domain, or (ii) the first antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the second subunit of the Fc domain and the first antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain.
[0354] In one aspect, the invention provides a (multispecific) antibody comprising
(a) a first antigen binding domain that binds to NKG2D, wherein the first antigen binding domain comprises a heavy chain variable region (VH) comprising a heavy chain complementary determining region (HCDR) 1 of SEQ ID NO: 73, a HCDR 2 of SEQ ID NO: 104, and a HCDR 3 of SEQ ID NO: 75, and a light chain variable region (VL) comprising a light chain complementarity determining region (LCDR) 1 of SEQ ID NO: 76, a LCDR 2 of SEQ ID NO: 77 and a LCDR 3 of SEQ ID NO: 78,
(b) a second antigen binding domain that binds to a second antigen, particularly a target cell antigen, more particularly a tumor cell antigen, and
(c) an Fc domain composed of a first and a second subunit;
wherein the first and the second antigen binding domains are each a Fab molecule;
wherein (i) the first antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain and the second antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the second subunit of the Fc domain, or (ii) the first antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the second subunit of the Fc domain and the first antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain; and
wherein the Fc domain comprises one or more amino acid substitution that reduces binding to an Fc receptor and/or effector function, and/or wherein the antibody does not bind to FcRIIIa (CD16a).
[0355] In one aspect, the invention provides a (multispecific) antibody comprising
a) a first antigen binding domain that binds to NKG2D, wherein the first antigen binding domain is a Fab molecule wherein the variable domains VL and VH or the constant domains CL and CH1 of the Fab light chain and the Fab heavy chain are replaced by each other, and comprises a heavy chain variable region (VH) comprising a heavy chain complementary determining region (HCDR) 1 of SEQ ID NO: 73, a HCDR 2 of SEQ ID NO: 104, and a HCDR 3 of SEQ ID NO: 75, and a light chain variable region (VL) comprising a light chain complementarity determining region (LCDR) 1 of SEQ ID NO: 76, a LCDR 2 of SEQ ID NO: 77 and a LCDR 3 of SEQ ID NO: 78;
b) a second antigen binding domain that binds to a second antigen, particularly a target cell antigen, more particularly a tumor cell antigen, wherein the second antigen binding domain is a (conventional) Fab molecule;
c) an Fc domain composed of a first and a second subunit;
wherein (i) the first antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain and the second antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the second subunit of the Fc domain, or (ii) the first antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the second subunit of the Fc domain and the first antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain.
[0356] In all of the different configurations of the (multispecific) antibody according to the invention, the amino acid substitutions (charge modifications) described herein, if present, may either be in the CH1 and CL domains of the second antigen binding domain/Fab molecule, or in the CH1 and CL domains of the first antigen binding domain/Fab molecule. Preferably, they are in the CH1 and CL domains of the second antigen binding domain/Fab molecule. In accordance with the concept of the invention, if amino acid substitutions as described herein are made in the second antigen binding domain/Fab molecule, no such amino acid substitutions are made in the first antigen binding domain/Fab molecule. Conversely, if amino acid substitutions as described herein are made in the first antigen binding domain/Fab molecule, no such amino acid substitutions are made in the second antigen binding domain/Fab molecule. Amino acid substitutions are preferably made in (multispecific) antibodies comprising a Fab molecule wherein the variable domains VL and VH1 of the Fab light chain and the Fab heavy chain are replaced by each other.
[0357] In preferred aspects of the (multispecific) antibody according to the invention, particularly wherein amino acid substitutions as described herein are made in the second antigen binding domain/Fab molecule, the constant domain CL of the second Fab molecule is of kappa isotype. In other aspects of the (multispecific) antibody according to the invention, particularly wherein amino acid substitutions as described herein are made in the first antigen binding domain/Fab molecule, the constant domain CL of the first antigen binding domain/Fab molecule is of kappa isotype. In some aspects, the constant domain CL of the second antigen binding domain/Fab molecule and the constant domain CL of the first antigen binding domain/Fab molecule are of kappa isotype.
[0358] In one aspect, the invention provides a (multispecific) antibody comprising
a) a first antigen binding domain that binds to NKG2D, wherein the first antigen binding domain is a Fab molecule wherein the variable domains VL and VH of the Fab light chain and the Fab heavy chain are replaced by each other, and comprises a heavy chain variable region (VH) comprising a heavy chain complementary determining region (HCDR) 1 of SEQ ID NO: 73, a HCDR 2 of SEQ ID NO: 104, and a HCDR 3 of SEQ ID NO: 75, and a light chain variable region (VL) comprising a light chain complementarity determining region (LCDR) 1 of SEQ ID NO: 76, a LCDR 2 of SEQ ID NO: 77 and a LCDR 3 of SEQ ID NO: 78;
b) a second antigen binding domain that binds to a second antigen, particularly a target cell antigen, more particularly a tumor cell antigen, wherein the second antigen binding domain is a (conventional) Fab molecule;
c) an Fc domain composed of a first and a second subunit;
wherein in the constant domain CL of the second antigen binding domain under b) the amino acid at position 124 is substituted by lysine (K) (numbering according to Kabat) and the amino acid at position 123 is substituted by lysine (K) or arginine (R) (numbering according to Kabat) (most preferably by arginine (R)), and wherein in the constant domain CH1 of the second antigen binding domain under b) the amino acid at position 147 is substituted by glutamic acid (E) (numbering according to Kabat EU index) and the amino acid at position 213 is substituted by glutamic acid (E) (numbering according to Kabat EU index); and
wherein (i) the first antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain and the second antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the second subunit of the Fc domain, or (ii) the first antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the second subunit of the Fc domain and the first antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain.
[0359] According to any of the above aspects, components of the (multispecific) antibody (e.g. Fab molecules, Fc domain) may be fused directly or through various linkers, particularly peptide linkers comprising one or more amino acids, typically about 2-20 amino acids, that are described herein or are known in the art. Suitable, non-immunogenic peptide linkers include, for example, (G.sub.4S).sub.n, (SG.sub.4).sub.n, (G.sub.4S).sub.n or G.sub.4(SG.sub.4).sub.n peptide linkers, wherein n is generally an integer from 1 to 10, typically from 2 to 4.
[0360] In one aspect according to these aspects of the inventions, the first antigen binding domain comprises a VH comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 112, and/or a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 80.
[0361] In one aspect according to these aspects of the invention, in the first subunit of the Fc domain the threonine residue at position 366 is replaced with a tryptophan residue (T366W), and in the second subunit of the Fc domain the tyrosine residue at position 407 is replaced with a valine residue (Y407V) and optionally the threonine residue at position 366 is replaced with a serine residue (T366S) and the leucine residue at position 368 is replaced with an alanine residue (L368A) (numberings according to Kabat EU index).
[0362] In a further aspect according to these aspects of the invention, in the first subunit of the Fc domain additionally the serine residue at position 354 is replaced with a cysteine residue (S354C) or the glutamic acid residue at position 356 is replaced with a cysteine residue (E356C) (particularly the serine residue at position 354 is replaced with a cysteine residue), and in the second subunit of the Fc domain additionally the tyrosine residue at position 349 is replaced by a cysteine residue (Y349C) (numberings according to Kabat EU index).
[0363] In still a further aspect according to these aspects of the invention, in each of the first and the second subunit of the Fc domain the leucine residue at position 234 is replaced with an alanine residue (L234A), the leucine residue at position 235 is replaced with an alanine residue (L235A) and the proline residue at position 329 is replaced by a glycine residue (P329G) (numbering according to Kabat EU index).
[0364] In still a further aspect according to these aspects of the invention, the Fc domain is a human IgG.sub.1 Fc domain.
[0365] In one aspect the invention provides a (multispecific) antibody that binds to NKG2D and CEA, comprising a polypeptide comprising an amino acid sequence that is at least 95%, 96%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO: 209, a polypeptide comprising an amino acid sequence that is at least 95%, 96%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO: 210, a polypeptide comprising an amino acid sequence that is at least 95%, 96%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO: 211, and a polypeptide comprising an amino acid sequence that is at least 95%, 96%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO: 212. In one aspect the invention provides a (multispecific) antibody that binds to NKG2D and CEA, comprising a polypeptide comprising the amino acid sequence of SEQ ID NO: 209, a polypeptide comprising the amino acid sequence of SEQ ID NO: 210, a polypeptide comprising the amino acid sequence of SEQ ID NO: 211 and a polypeptide comprising the amino acid sequence of SEQ ID NO: 212.
[0366] In another aspect the invention provides a (multispecific) antibody that binds to NKG2D and CEA, comprising a polypeptide comprising an amino acid sequence that is at least 95%, 96%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO: 213, a polypeptide comprising an amino acid sequence that is at least 95%, 96%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO: 214, a polypeptide comprising an amino acid sequence that is at least 95%, 96%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO: 215, and a polypeptide comprising an amino acid sequence that is at least 95%, 96%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO: 216. In one aspect the invention provides a (multispecific) antibody that binds to NKG2D and CEA, comprising a polypeptide comprising the amino acid sequence of SEQ ID NO: 213, a polypeptide comprising the amino acid sequence of SEQ ID NO: 214, a polypeptide comprising the amino acid sequence of SEQ ID NO: 215 and a polypeptide comprising the amino acid sequence of SEQ ID NO: 216.
[0367] In further aspects the invention provides a (multispecific) antibody that binds to NKG2D and CEA, comprising a polypeptide comprising an amino acid sequence that is at least 95%, 96%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO: 213, a polypeptide comprising an amino acid sequence that is at least 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 214 in which the VL region sequence (SEQ ID NO: 193) is replaced by a VL region sequence selected from the group consisting of SEQ ID NO: 185, 187, 189, 191, 195, 197, 199, 201, 203, 205 and 207, a polypeptide comprising an amino acid sequence that is at least 95%, 96%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO: 215, and a polypeptide comprising an amino acid sequence that is at least 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 216 in which the VH region sequence (SEQ ID NO: 192) is replaced by a VH region sequence selected from the group consisting of SEQ ID NO: 184, 186, 188, 190, 194, 196, 198, 200, 202, 204 and 206. In one aspect the invention provides a (multispecific) antibody that binds to NKG2D and CEA, comprising a polypeptide comprising the amino acid sequence of SEQ ID NO: 213, a polypeptide comprising the amino acid sequence of SEQ ID NO: 214 in which the VL region sequence (SEQ ID NO: 193) is replaced by a VL region sequence selected from the group consisting of SEQ ID NO: 185, 187, 189, 191, 195, 197, 199, 201, 203, 205 and 207, a polypeptide comprising the amino acid sequence of SEQ ID NO: 215 and a polypeptide comprising the amino acid sequence of SEQ ID NO: 216 in which the VH region sequence (SEQ ID NO: 192) is replaced by a VH region sequence selected from the group consisting of SEQ ID NO: 184, 186, 188, 190, 194, 196, 198, 200, 202, 204 and 206. Preferably, in the above aspects, the VH and VL regions (SEQ ID NOs 192 and 193) are replaced by pairs of VH and VL regions corresponding to the binders identified in Table 16.
[0368] 2. Fc Domain Variants
[0369] In preferred aspects, the (multispecific) antibody of the invention comprises an Fc domain composed of a first and a second subunit.
[0370] The Fc domain of the (multispecific) antibody consists of a pair of polypeptide chains comprising heavy chain domains of an immunoglobulin molecule. For example, the Fc domain of an immunoglobulin G (IgG) molecule is a dimer, each subunit of which comprises the CH2 and CH3 IgG heavy chain constant domains. The two subunits of the Fc domain are capable of stable association with each other. In one aspect, the (multispecific) antibody of the invention comprises not more than one Fc domain.
[0371] In one aspect, the Fc domain of the (multispecific) antibody is an IgG Fc domain. In a preferred aspect, the Fc domain is an IgG.sub.1 Fc domain. In another aspect the Fc domain is an IgG4 Fc domain. In a more specific aspect, the Fc domain is an IgG4 Fc domain comprising an amino acid substitution at position 5228 (Kabat EU index numbering), particularly the amino acid substitution S228P. This amino acid substitution reduces in vivo Fab arm exchange of IgG4 antibodies (see Stubenrauch et al., Drug Metabolism and Disposition 38, 84-91 (2010)). In a further preferred aspect, the Fc domain is a human Fc domain. In an even more preferred aspect, the Fc domain is a human IgG.sub.1 Fc domain. An exemplary sequence of a human IgG.sub.1 Fc region is given in SEQ ID NO: 86.
[0372] a) Fc Domain Modifications Promoting Heterodimerization
[0373] (Multispecific) antibodies according to the invention comprise different antigen binding domains, which may be fused to one or the other of the two subunits of the Fc domain, thus the two subunits of the Fc domain are typically comprised in two non-identical polypeptide chains. Recombinant co-expression of these polypeptides and subsequent dimerization leads to several possible combinations of the two polypeptides. To improve the yield and purity of (multispecific) antibodies in recombinant production, it will thus be advantageous to introduce in the Fc domain of the (multispecific) antibody a modification promoting the association of the desired polypeptides.
[0374] Accordingly, in preferred aspects, the Fc domain of the (multispecific) antibody according to the invention comprises a modification promoting the association of the first and the second subunit of the Fc domain. The site of most extensive protein-protein interaction between the two subunits of a human IgG Fc domain is in the CH3 domain of the Fc domain. Thus, in one aspect said modification is in the CH3 domain of the Fc domain.
[0375] There exist several approaches for modifications in the CH3 domain of the Fc domain in order to enforce heterodimerization, which are well described e.g. in WO 96/27011, WO 98/050431, EP 1870459, WO 2007/110205, WO 2007/147901, WO 2009/089004, WO 2010/129304, WO 2011/90754, WO 2011/143545, WO 2012058768, WO 2013157954, WO 2013096291. Typically, in all such approaches the CH3 domain of the first subunit of the Fc domain and the CH3 domain of the second subunit of the Fc domain are both engineered in a complementary manner so that each CH3 domain (or the heavy chain comprising it) can no longer homodimerize with itself but is forced to heterodimerize with the complementarily engineered other CH3 domain (so that the first and second CH3 domain heterodimerize and no homdimers between the two first or the two second CH3 domains are formed). These different approaches for improved heavy chain heterodimerization are contemplated as different alternatives in combination with the heavy-light chain modifications (e.g. VH and VL exchange/replacement in one binding arm and the introduction of substitutions of charged amino acids with opposite charges in the CH1/CL interface) in the (multispecific) antibody which reduce heavy/light chain mispairing and Bence Jones-type side products.
[0376] In a specific aspect said modification promoting the association of the first and the second subunit of the Fc domain is a so-called knob-into-hole modification, comprising a knob modification in one of the two subunits of the Fc domain and a hole modification in the other one of the two subunits of the Fc domain.
[0377] The knob-into-hole technology is described e.g. in U.S. Pat. Nos. 5,731,168; 7,695,936; Ridgway et al., Prot Eng 9, 617-621 (1996) and Carter, J Immunol Meth 248, 7-15 (2001). Generally, the method involves introducing a protuberance (knob) at the interface of a first polypeptide and a corresponding cavity (hole) in the interface of a second polypeptide, such that the protuberance can be positioned in the cavity so as to promote heterodimer formation and hinder homodimer formation. Protuberances are constructed by replacing small amino acid side chains from the interface of the first polypeptide with larger side chains (e.g. tyrosine or tryptophan). Compensatory cavities of identical or similar size to the protuberances are created in the interface of the second polypeptide by replacing large amino acid side chains with smaller ones (e.g. alanine or threonine).
[0378] Accordingly, in a preferred aspect, in the CH3 domain of the first subunit of the Fc domain of the (multispecific) antibody an amino acid residue is replaced with an amino acid residue having a larger side chain volume, thereby generating a protuberance within the CH3 domain of the first subunit which is positionable in a cavity within the CH3 domain of the second subunit, and in the CH3 domain of the second subunit of the Fc domain an amino acid residue is replaced with an amino acid residue having a smaller side chain volume, thereby generating a cavity within the CH3 domain of the second subunit within which the protuberance within the CH3 domain of the first subunit is positionable.
[0379] Preferably said amino acid residue having a larger side chain volume is selected from the group consisting of arginine (R), phenylalanine (F), tyrosine (Y), and tryptophan (W).
[0380] Preferably said amino acid residue having a smaller side chain volume is selected from the group consisting of alanine (A), serine (S), threonine (T), and valine (V).
[0381] The protuberance and cavity can be made by altering the nucleic acid encoding the polypeptides, e.g. by site-specific mutagenesis, or by peptide synthesis.
[0382] In a specific aspect, in (the CH3 domain of) the first subunit of the Fc domain (the knobs subunit) the threonine residue at position 366 is replaced with a tryptophan residue (T366W), and in (the CH3 domain of) the second subunit of the Fc domain (the hole subunit) the tyrosine residue at position 407 is replaced with a valine residue (Y407V). In one aspect, in the second subunit of the Fc domain additionally the threonine residue at position 366 is replaced with a serine residue (T366S) and the leucine residue at position 368 is replaced with an alanine residue (L368A) (numberings according to Kabat EU index).
[0383] In yet a further aspect, in the first subunit of the Fc domain additionally the serine residue at position 354 is replaced with a cysteine residue (S354C) or the glutamic acid residue at position 356 is replaced with a cysteine residue (E356C) (particularly the serine residue at position 354 is replaced with a cysteine residue), and in the second subunit of the Fc domain additionally the tyrosine residue at position 349 is replaced by a cysteine residue (Y349C) (numberings according to Kabat EU index). Introduction of these two cysteine residues results in formation of a disulfide bridge between the two subunits of the Fc domain, further stabilizing the dimer (Carter, J Immunol Methods 248, 7-15 (2001)).
[0384] In a preferred aspect, the first subunit of the Fc domain comprises the amino acid substitutions S354C and T366W, and the second subunit of the Fc domain comprises the amino acid substitutions Y349C, T366S, L368A and Y407V (numbering according to Kabat EU index).
[0385] In a preferred aspect the antigen binding domain that binds to CD3 is fused (optionally via the second antigen binding domain, that binds to a second antigen, and/or a peptide linker) to the first subunit of the Fc domain (comprising the knob modification). Without wishing to be bound by theory, fusion of the antigen binding domain that binds CD3 to the knob-containing subunit of the Fc domain will (further) minimize the generation of antibodies comprising two antigen binding domains that bind to CD3 (steric clash of two knob-containing polypeptides).
[0386] Other techniques of CH3-modification for enforcing the heterodimerization are contemplated as alternatives according to the invention and are described e.g. in WO 96/27011, WO 98/050431, EP 1870459, WO 2007/110205, WO 2007/147901, WO 2009/089004, WO 2010/129304, WO 2011/90754, WO 2011/143545, WO 2012/058768, WO 2013/157954, WO 2013/096291.
[0387] In one aspect, the heterodimerization approach described in EP 1870459, is used alternatively. This approach is based on the introduction of charged amino acids with opposite charges at specific amino acid positions in the CH3/CH3 domain interface between the two subunits of the Fc domain. A particular aspect for the (multispecific) antibody of the invention are amino acid mutations R409D; K370E in one of the two CH3 domains (of the Fc domain) and amino acid mutations D399K; E357K in the other one of the CH3 domains of the Fc domain (numbering according to Kabat EU index).
[0388] In another aspect, the (multispecific) antibody of the invention comprises amino acid mutation T366W in the CH3 domain of the first subunit of the Fc domain and amino acid mutations T366S, L368A, Y407V in the CH3 domain of the second subunit of the Fc domain, and additionally amino acid mutations R409D; K370E in the CH3 domain of the first subunit of the Fc domain and amino acid mutations D399K; E357K in the CH3 domain of the second subunit of the Fc domain (numberings according to Kabat EU index).
[0389] In another aspect, the (multispecific) antibody of the invention comprises amino acid mutations S354C, T366W in the CH3 domain of the first subunit of the Fc domain and amino acid mutations Y349C, T366S, L368A, Y407V in the CH3 domain of the second subunit of the Fc domain, or said (multispecific) antibody comprises amino acid mutations Y349C, T366W in the CH3 domain of the first subunit of the Fc domain and amino acid mutations S354C, T366S, L368A, Y407V in the CH3 domains of the second subunit of the Fc domain and additionally amino acid mutations R409D; K370E in the CH3 domain of the first subunit of the Fc domain and amino acid mutations D399K; E357K in the CH3 domain of the second subunit of the Fc domain (all numberings according to Kabat EU index).
[0390] In one aspect, the heterodimerization approach described in WO 2013/157953 is used alternatively. In one aspect, a first CH3 domain comprises amino acid mutation T366K and a second CH3 domain comprises amino acid mutation L351D (numberings according to Kabat EU index). In a further aspect, the first CH3 domain comprises further amino acid mutation L351K. In a further aspect, the second CH3 domain comprises further an amino acid mutation selected from Y349E, Y349D and L368E (particularly L368E) (numberings according to Kabat EU index).
[0391] In one aspect, the heterodimerization approach described in WO 2012/058768 is used alternatively. In one aspect a first CH3 domain comprises amino acid mutations L351Y, Y407A and a second CH3 domain comprises amino acid mutations T366A, K409F. In a further aspect the second CH3 domain comprises a further amino acid mutation at position T411, D399, 5400, F405, N390, or K392, e.g. selected from a) T411N, T411R, T411Q, T411K, T411D, T411E or T411W, b) D399R, D399W, D399Y or D399K, c) S400E, S400D, S400R, or S400K, d) F4051, F405M, F405T, F405S, F405V or F405W, e) N390R, N390K or N390D, f) K392V, K392M, K392R, K392L, K392F or K392E (numberings according to Kabat EU index). In a further aspect a first CH3 domain comprises amino acid mutations L351Y, Y407A and a second CH3 domain comprises amino acid mutations T366V, K409F. In a further aspect, a first CH3 domain comprises amino acid mutation Y407A and a second CH3 domain comprises amino acid mutations T366A, K409F. In a further aspect, the second CH3 domain further comprises amino acid mutations K392E, T411E, D399R and S400R (numberings according to Kabat EU index).
[0392] In one aspect, the heterodimerization approach described in WO 2011/143545 is used alternatively, e.g. with the amino acid modification at a position selected from the group consisting of 368 and 409 (numbering according to Kabat EU index).
[0393] In one aspect, the heterodimerization approach described in WO 2011/090762, which also uses the knobs-into-holes technology described above, is used alternatively. In one aspect a first CH3 domain comprises amino acid mutation T366W and a second CH3 domain comprises amino acid mutation Y407A. In one aspect, a first CH3 domain comprises amino acid mutation T366Y and a second CH3 domain comprises amino acid mutation Y407T (numberings according to Kabat EU index).
[0394] In one aspect, the (multispecific) antibody or its Fc domain is of IgG2 subclass and the heterodimerization approach described in WO 2010/129304 is used alternatively.
[0395] In an alternative aspect, a modification promoting association of the first and the second subunit of the Fc domain comprises a modification mediating electrostatic steering effects, e.g. as described in PCT publication WO 2009/089004. Generally, this method involves replacement of one or more amino acid residues at the interface of the two Fc domain subunits by charged amino acid residues so that homodimer formation becomes electrostatically unfavorable but heterodimerization electrostatically favorable. In one such aspect, a first CH3 domain comprises amino acid substitution of K392 or N392 with a negatively charged amino acid (e.g. glutamic acid (E), or aspartic acid (D), particularly K392D or N392D) and a second CH3 domain comprises amino acid substitution of D399, E356, D356, or E357 with a positively charged amino acid (e.g. lysine (K) or arginine (R), particularly D399K, E356K, D356K, or E357K, and more particularly D399K and E356K). In a further aspect, the first CH3 domain further comprises amino acid substitution of K409 or R409 with a negatively charged amino acid (e.g. glutamic acid (E), or aspartic acid (D), particularly K409D or R409D). In a further aspect the first CH3 domain further or alternatively comprises amino acid substitution of K439 and/or K370 with a negatively charged amino acid (e.g. glutamic acid (E), or aspartic acid (D)) (all numberings according to Kabat EU index).
[0396] In yet a further aspect, the heterodimerization approach described in WO 2007/147901 is used alternatively. In one aspect, a first CH3 domain comprises amino acid mutations K253E, D282K, and K322D and a second CH3 domain comprises amino acid mutations D239K, E240K, and K292D (numberings according to Kabat EU index).
[0397] In still another aspect, the heterodimerization approach described in WO 2007/110205 can be used alternatively.
[0398] In one aspect, the first subunit of the Fc domain comprises amino acid substitutions K392D and K409D, and the second subunit of the Fc domain comprises amino acid substitutions D356K and D399K (numbering according to Kabat EU index).
[0399] b) Fc Domain Modifications Reducing Fc Receptor Binding and/or Effector Function
[0400] The Fc domain confers to the (multispecific) antibody favorable pharmacokinetic properties, including a long serum half-life which contributes to good accumulation in the target tissue and a favorable tissue-blood distribution ratio. At the same time, binding of the (multispecific) antibody, via its Fc domain, to cells expressing Fc receptors may lead to cross-linking of Fc receptor-expressing cells (such as NK cells) with other NKG2D-expressing cells (such as CD8 T cells), and thereby to undesirable toxicity upon systemic administration. Moreover, the co-activation of Fc receptor signaling pathways may lead to cytokine release which, in combination with the T-cell activating properties and the long half-life of the (multispecific) antibody, results in excessive activation of cytokine receptors and severe side effects upon systemic administration. Activation of (Fc receptor-bearing) immune cells other than T cells may even reduce efficacy of the (multispecific) antibody due to the potential destruction of T cells e.g. by NK cells.
[0401] Accordingly, in preferred aspects, the Fc domain of the (multispecific) antibody according to the invention exhibits reduced binding affinity to an Fc receptor and/or reduced effector function, as compared to a native IgG.sub.1 Fc domain. In one such aspect the Fc domain (or the (multispecific) antibody comprising said Fc domain) exhibits less than 50%, particularly less than 20%, more particularly less than 10% and most particularly less than 5% of the binding affinity to an Fc receptor, as compared to a native IgG.sub.1 Fc domain (or a (multispecific) antibody comprising a native IgG.sub.1 Fc domain), and/or less than 50%, particularly less than 20%, more particularly less than 10% and most particularly less than 5% of the effector function, as compared to a native IgG.sub.1 Fc domain domain (or a (multispecific) antibody comprising a native IgG.sub.1 Fc domain). In one aspect, the Fc domain (or the (multispecific) antibody comprising said Fc domain) does not substantially bind to an Fc receptor and/or induce effector function. In a preferred aspect the Fc receptor is an Fc receptor. In one aspect the Fc receptor is a human Fc receptor. In one aspect the Fc receptor is an activating Fc receptor. In a specific aspect the Fc receptor is an activating human Fc receptor, more specifically human FcRIIIa, FcRI or FcRIIa, most specifically human FcRIIIa (CD16a). In one aspect the effector function is one or more selected from the group of CDC, ADCC, ADCP, and cytokine secretion. In a preferred aspect, the effector function is ADCC. In one aspect, the Fc domain domain exhibits substantially similar binding affinity to neonatal Fc receptor (FcRn), as compared to a native IgG.sub.1 Fc domain. Substantially similar binding to FcRn is achieved when the Fc domain (or the (multispecific) antibody comprising said Fc domain) exhibits greater than about 70%, particularly greater than about 80%, more particularly greater than about 90% of the binding affinity of a native IgG.sub.1 Fc domain (or the (multispecific) antibody comprising a native IgG.sub.1 Fc domain) to FcRn.
[0402] In certain aspects the Fc domain is engineered to have reduced binding affinity to an Fc receptor and/or reduced effector function, as compared to a non-engineered Fc domain. In preferred aspects, the Fc domain of the (multispecific) antibody comprises one or more amino acid mutation that reduces the binding affinity of the Fc domain to an Fc receptor and/or effector function. Typically, the same one or more amino acid mutation is present in each of the two subunits of the Fc domain. In one aspect, the amino acid mutation reduces the binding affinity of the Fc domain to an Fc receptor. In one aspect, the amino acid mutation reduces the binding affinity of the Fc domain to an Fc receptor by at least 2-fold, at least 5-fold, or at least 10-fold. In aspects where there is more than one amino acid mutation that reduces the binding affinity of the Fc domain to the Fc receptor, the combination of these amino acid mutations may reduce the binding affinity of the Fc domain to an Fc receptor by at least 10-fold, at least 20-fold, or even at least 50-fold. In one aspect the (multispecific) antibody comprising an engineered Fc domain exhibits less than 20%, particularly less than 10%, more particularly less than 5% of the binding affinity to an Fc receptor as compared to a (multispecific) antibody comprising a non-engineered Fc domain. In a preferred aspect, the Fc receptor is an Fc receptor. In some aspects, the Fc receptor is a human Fc receptor. In some aspects, the Fc receptor is an activating Fc receptor. In a specific aspect, the Fc receptor is an activating human Fc receptor, more specifically human FcRIIIa, FcRI or FcRIIa, most specifically human FcRIIIa (CD16a). Preferably, binding to each of these receptors is reduced. In some aspects, binding affinity to a complement component, specifically binding affinity to C1q, is also reduced. In one aspect, binding affinity to neonatal Fc receptor (FcRn) is not reduced. Substantially similar binding to FcRn, i.e. preservation of the binding affinity of the Fc domain to said receptor, is achieved when the Fc domain (or the (multispecific) antibody comprising said Fc domain) exhibits greater than about 70% of the binding affinity of a non-engineered form of the Fc domain (or the (multispecific) antibody comprising said non-engineered form of the Fc domain) to FcRn. The Fc domain, or (multispecific) antibodies of the invention comprising said Fc domain, may exhibit greater than about 80% and even greater than about 90% of such affinity. In certain aspects, the Fc domain of the (multispecific) antibody is engineered to have reduced effector function, as compared to a non-engineered Fc domain. The reduced effector function can include, but is not limited to, one or more of the following: reduced complement dependent cytotoxicity (CDC), reduced antibody-dependent cell-mediated cytotoxicity (ADCC), reduced antibody-dependent cellular phagocytosis (ADCP), reduced cytokine secretion, reduced immune complex-mediated antigen uptake by antigen-presenting cells, reduced binding to NK cells, reduced binding to macrophages, reduced binding to monocytes, reduced binding to polymorphonuclear cells, reduced direct signaling inducing apoptosis, reduced crosslinking of target-bound antibodies, reduced dendritic cell maturation, or reduced T cell priming. In one aspect, the reduced effector function is one or more selected from the group of reduced CDC, reduced ADCC, reduced ADCP, and reduced cytokine secretion. In a preferred aspect, the reduced effector function is reduced ADCC. In one aspect the reduced ADCC is less than 20% of the ADCC induced by a non-engineered Fc domain (or a (multispecific) antibody comprising a non-engineered Fc domain).
[0403] In one aspect, the amino acid mutation that reduces the binding affinity of the Fc domain to an Fc receptor and/or effector function is an amino acid substitution. In one aspect, the Fc domain comprises an amino acid substitution at a position selected from the group of E233, L234, L235, N297, P331 and P329 (numberings according to Kabat EU index). In a more specific aspect, the Fc domain comprises an amino acid substitution at a position selected from the group of L234, L235 and P329 (numberings according to Kabat EU index). In some aspects, the Fc domain comprises the amino acid substitutions L234A and L235A (numberings according to Kabat EU index). In one such aspect, the Fc domain is an IgG.sub.1 Fc domain, particularly a human IgG.sub.1 Fc domain. In one aspect, the Fc domain comprises an amino acid substitution at position P329. In a more specific aspect, the amino acid substitution is P329A or P329G, particularly P329G (numberings according to Kabat EU index). In one aspect, the Fc domain comprises an amino acid substitution at position P329 and a further amino acid substitution at a position selected from E233, L234, L235, N297 and P331 (numberings according to Kabat EU index). In a more specific aspect, the further amino acid substitution is E233P, L234A, L235A, L235E, N297A, N297D or P331S. In preferred aspects, the Fc domain comprises amino acid substitutions at positions P329, L234 and L235 (numberings according to Kabat EU index). In more preferred aspects, the Fc domain comprises the amino acid mutations L234A, L235A and P329G (P329G LALA, PGLALA or LALAPG). Specifically, in preferred aspects, each subunit of the Fc domain comprises the amino acid substitutions L234A, L235A and P329G (Kabat EU index numbering), i.e. in each of the first and the second subunit of the Fc domain the leucine residue at position 234 is replaced with an alanine residue (L234A), the leucine residue at position 235 is replaced with an alanine residue (L235A) and the proline residue at position 329 is replaced by a glycine residue (P329G) (numbering according to Kabat EU index).
[0404] In one such aspect, the Fc domain is an IgG.sub.1 Fc domain, particularly a human IgG.sub.1 Fc domain. The P329G LALA combination of amino acid substitutions almost completely abolishes Fc receptor (as well as complement) binding of a human IgG.sub.1 Fc domain, as described in PCT publication no. WO 2012/130831, which is incorporated herein by reference in its entirety. WO 2012/130831 also describes methods of preparing such mutant Fc domains and methods for determining its properties such as Fc receptor binding or effector functions.
[0405] IgG4 antibodies exhibit reduced binding affinity to Fc receptors and reduced effector functions as compared to IgG.sub.1 antibodies. Hence, in some aspects, the Fc domain of the (multispecific) antibodies of the invention is an IgG4 Fc domain, particularly a human IgG4 Fc domain. In one aspect, the IgG4 Fc domain comprises an amino acid substitution at position 5228, specifically the amino acid substitution S228P (numberings according to Kabat EU index). To further reduce its binding affinity to an Fc receptor and/or its effector function, in one aspect, the IgG4 Fc domain comprises an amino acid substitution at position L235, specifically the amino acid substitution L235E (numberings according to Kabat EU index). In another aspect, the IgG4 Fc domain comprises an amino acid substitution at position P329, specifically the amino acid substitution P329G (numberings according to Kabat EU index). In a preferred aspect, the IgG4 Fc domain comprises amino acid substitutions at positions S228, L235 and P329, specifically amino acid substitutions S228P, L235E and P329G (numberings according to Kabat EU index). Such IgG4 Fc domain mutants and their Fc receptor binding properties are described in PCT publication no. WO 2012/130831, incorporated herein by reference in its entirety.
[0406] In a preferred aspect, the Fc domain exhibiting reduced binding affinity to an Fc receptor and/or reduced effector function, as compared to a native IgG.sub.1 Fc domain, is a human IgG.sub.1 Fc domain comprising the amino acid substitutions L234A, L235A and optionally P329G, or a human IgG4 Fc domain comprising the amino acid substitutions S228P, L235E and optionally P329G (numberings according to Kabat EU index).
[0407] In certain aspects, N-glycosylation of the Fc domain has been eliminated. In one such aspect, the Fc domain comprises an amino acid mutation at position N297, particularly an amino acid substitution replacing asparagine by alanine (N297A) or aspartic acid (N297D) (numberings according to Kabat EU index).
[0408] In addition to the Fc domains described hereinabove and in PCT publication no. WO 2012/130831, Fc domains with reduced Fc receptor binding and/or effector function also include those with substitution of one or more of Fc domain residues 238, 265, 269, 270, 297, 327 and 329 (U.S. Pat. No. 6,737,056) (numberings according to Kabat EU index). Such Fc mutants include Fc mutants with substitutions at two or more of amino acid positions 265, 269, 270, 297 and 327, including the so-called DANA Fc mutant with substitution of residues 265 and 297 to alanine (U.S. Pat. No. 7,332,581).
[0409] Mutant Fc domains can be prepared by amino acid deletion, substitution, insertion or modification using genetic or chemical methods well known in the art. Genetic methods may include site-specific mutagenesis of the encoding DNA sequence, PCR, gene synthesis, and the like. The correct nucleotide changes can be verified for example by sequencing.
[0410] Binding to Fc receptors can be easily determined e.g. by ELISA, or by Surface Plasmon Resonance (SPR) using standard instrumentation such as a BIAcore instrument (GE Healthcare), and Fc receptors such as may be obtained by recombinant expression. Alternatively, binding affinity of Fc domains or (multispecific) antibodies comprising an Fc domain for Fc receptors may be evaluated using cell lines known to express particular Fc receptors, such as human NK cells expressing FcIIIa receptor.
[0411] Effector function of an Fc domain, or a (multispecific) antibody comprising an Fc domain, can be measured by methods known in the art. Examples of in vitro assays to assess ADCC activity of a molecule of interest are described in U.S. Pat. No. 5,500,362; Hellstrom et al. Proc Natl Acad Sci USA 83, 7059-7063 (1986) and Hellstrom et al., Proc Natl Acad Sci USA 82, 1499-1502 (1985); U.S. Pat. No. 5,821,337; Bruggemann et al., J Exp Med 166, 1351-1361 (1987). Alternatively, non-radioactive assays may be employed (see, for example, ACTI non-radioactive cytotoxicity assay for flow cytometry (CellTechnology, Inc. Mountain View, Calif.); and CytoTox 96 non-radioactive cytotoxicity assay (Promega, Madison, Wis.)). Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells. Alternatively, or additionally, ADCC activity of the molecule of interest may be assessed in vivo, e.g. in an animal model such as that disclosed in Clynes et al., Proc Natl Acad Sci USA 95, 652-656 (1998).
[0412] In some aspects, binding of the Fc domain to a complement component, specifically to C1q, is reduced. Accordingly, in some aspects wherein the Fc domain is engineered to have reduced effector function, said reduced effector function includes reduced CDC. C1q binding assays may be carried out to determine whether the Fc domain, or the (multispecific) antibody comprising the Fc domain, is able to bind C1q and hence has CDC activity. See e.g., C1q and C3c binding ELISA in WO 2006/029879 and WO 2005/100402. To assess complement activation, a CDC assay may be performed (see, for example, Gazzano-Santoro et al., J Immunol Methods 202, 163 (1996); Cragg et al., Blood 101, 1045-1052 (2003); and Cragg and Glennie, Blood 103, 2738-2743 (2004)).
[0413] FcRn binding and in vivo clearance/half-life determinations can also be performed using methods known in the art (see, e.g., Petkova, S. B. et al., Int'l. Immunol. 18(12):1759-1769 (2006); WO 2013/120929).
[0414] B. Polynucleotides
[0415] The invention further provides an isolated polynucleotide encoding an antibody of the invention. Such isolated polynucleotide may be a single polynucleotide or a plurality of polynucleotides.
[0416] The polynucleotides encoding (multispecific) antibodies of the invention may be expressed as a single polynucleotide that encodes the entire antibody or as multiple (e.g., two or more) polynucleotides that are co-expressed. Polypeptides encoded by polynucleotides that are co-expressed may associate through, e.g., disulfide bonds or other means to form a functional antibody. For example, the light chain portion of an antibody may be encoded by a separate polynucleotide from the portion of the antibody comprising the heavy chain of the antibody. When co-expressed, the heavy chain polypeptides will associate with the light chain polypeptides to form the antibody. In another example, the portion of the antibody comprising one of the two Fc domain subunits and optionally (part of) one or more Fab molecules could be encoded by a separate polynucleotide from the portion of the antibody comprising the other of the two Fc domain subunits and optionally (part of) a Fab molecule. When co-expressed, the Fc domain subunits will associate to form the Fc domain.
[0417] In some aspects, the isolated polynucleotide encodes the entire antibody molecule according to the invention as described herein. In other aspects, the isolated polynucleotide encodes a polypeptide comprised in the antibody according to the invention as described herein.
[0418] In certain aspects the polynucleotide or nucleic acid is DNA. In other aspects, a polynucleotide of the present invention is RNA, for example, in the form of messenger RNA (mRNA). RNA of the present invention may be single stranded or double stranded.
[0419] C. Recombinant Methods
[0420] Antibodies of the invention may be obtained, for example, by solid-state peptide synthesis (e.g. Merrifield solid phase synthesis) or recombinant production. For recombinant production one or more polynucleotide encoding the antibody, e.g., as described above, is isolated and inserted into one or more vectors for further cloning and/or expression in a host cell. Such polynucleotide may be readily isolated and sequenced using conventional procedures. In one aspect a vector, particularly an expression vector, comprising the polynucleotide (i.a. a single polynucleotide or a plurality of polynucleotides) of the invention is provided. Methods which are well known to those skilled in the art can be used to construct expression vectors containing the coding sequence of an antibody along with appropriate transcriptional/translational control signals. These methods include in vitro recombinant DNA techniques, synthetic techniques and in vivo recombination/genetic recombination. See, for example, the techniques described in Maniatis et al., M
[0421] Polynucleotide and nucleic acid coding regions of the present invention may be associated with additional coding regions which encode secretory or signal peptides, which direct the secretion of a polypeptide encoded by a polynucleotide of the present invention. For example, if secretion of the antibody is desired, DNA encoding a signal sequence may be placed upstream of the nucleic acid encoding an antibody of the invention or a fragment thereof. According to the signal hypothesis, proteins secreted by mammalian cells have a signal peptide or secretory leader sequence which is cleaved from the mature protein once export of the growing protein chain across the rough endoplasmic reticulum has been initiated. Those of ordinary skill in the art are aware that polypeptides secreted by vertebrate cells generally have a signal peptide fused to the N-terminus of the polypeptide, which is cleaved from the translated polypeptide to produce a secreted or mature form of the polypeptide. In certain aspects, the native signal peptide, e.g. an immunoglobulin heavy chain or light chain signal peptide is used, or a functional derivative of that sequence that retains the ability to direct the secretion of the polypeptide that is operably associated with it. Alternatively, a heterologous mammalian signal peptide, or a functional derivative thereof, may be used. For example, the wild-type leader sequence may be substituted with the leader sequence of human tissue plasminogen activator (TPA) or mouse -glucuronidase.
[0422] DNA encoding a short protein sequence that could be used to facilitate later purification (e.g. a histidine tag) or assist in labeling the antibody may be included within or at the ends of the antibody (fragment) encoding polynucleotide.
[0423] In a further aspect, a host cell comprising a polynucleotide (i.e. a single polynucleotide or a plurality of polynucleotides) of the invention is provided. In certain aspects a host cell comprising a vector of the invention is provided. The polynucleotides and vectors may incorporate any of the features, singly or in combination, described herein in relation to polynucleotides and vectors, respectively. In one such aspect a host cell comprises (e.g. has been transformed or transfected with) one or more vector comprising one or more polynucleotide that encodes (part of) an antibody of the invention. As used herein, the term host cell refers to any kind of cellular system which can be engineered to generate the antibody of the invention or fragments thereof. Host cells suitable for replicating and for supporting expression of antibodies are well known in the art. Such cells may be transfected or transduced as appropriate with the particular expression vector and large quantities of vector containing cells can be grown for seeding large scale fermenters to obtain sufficient quantities of the antibody for clinical applications. Suitable host cells include prokaryotic microorganisms, such as E. coli, or various eukaryotic cells, such as Chinese hamster ovary cells (CHO), insect cells, or the like. For example, polypeptides may be produced in bacteria in particular when glycosylation is not needed. After expression, the polypeptide may be isolated from the bacterial cell paste in a soluble fraction and can be further purified. In addition to prokaryotes, eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for polypeptide-encoding vectors, including fungi and yeast strains whose glycosylation pathways have been humanized, resulting in the production of a polypeptide with a partially or fully human glycosylation pattern. See Gerngross, Nat Biotech 22, 1409-1414 (2004), and Li et al., Nat Biotech 24, 210-215 (2006). Suitable host cells for the expression of (glycosylated) polypeptides are also derived from multicellular organisms (invertebrates and vertebrates). Examples of invertebrate cells include plant and insect cells. Numerous baculoviral strains have been identified which may be used in conjunction with insect cells, particularly for transfection of Spodoptera frugiperda cells. Plant cell cultures can also be utilized as hosts. See e.g. U.S. Pat. Nos. 5,959,177, 6,040,498, 6,420,548, 7,125,978, and 6,417,429 (describing PLANTIBODIES technology for producing antibodies in transgenic plants). Vertebrate cells may also be used as hosts. For example, mammalian cell lines that are adapted to grow in suspension may be useful. Other examples of useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7); human embryonic kidney line (293 or 293T cells as described, e.g., in Graham et al., J Gen Virol 36, 59 (1977)), baby hamster kidney cells (BHK), mouse sertoli cells (TM4 cells as described, e.g., in Mather, Biol Reprod 23, 243-251 (1980)), monkey kidney cells (CV1), African green monkey kidney cells (VERO-76), human cervical carcinoma cells (HELA), canine kidney cells (MDCK), buffalo rat liver cells (BRL 3A), human lung cells (W138), human liver cells (Hep G2), mouse mammary tumor cells (MMT 060562), TRI cells (as described, e.g., in Mather et al., Annals N.Y. Acad Sci 383, 44-68 (1982)), MRC 5 cells, and FS4 cells. Other useful mammalian host cell lines include Chinese hamster ovary (CHO) cells, including dhfr CHO cells (Urlaub et al., Proc Natl Acad Sci USA 77, 4216 (1980)); and myeloma cell lines such as YO, NS0, P3X63 and Sp2/0. For a review of certain mammalian host cell lines suitable for protein production, see, e.g., Yazaki and Wu, Methods in Molecular Biology, Vol. 248 (B. K. C. Lo, ed., Humana Press, Totowa, N.J.), pp. 255-268 (2003). Host cells include cultured cells, e.g., mammalian cultured cells, yeast cells, insect cells, bacterial cells and plant cells, to name only a few, but also cells comprised within a transgenic animal, transgenic plant or cultured plant or animal tissue. In one aspect, the host cell is a eukaryotic cell, particularly a mammalian cell, such as a Chinese Hamster Ovary (CHO) cell, a human embryonic kidney (HEK) cell or a lymphoid cell (e.g., Y0, NS0, Sp20 cell). In one aspect, the host cell is not a cell within a human body.
[0424] Standard technologies are known in the art to express foreign genes in these systems. Cells expressing a polypeptide comprising either the heavy or the light chain of an antigen binding domain such as an antibody, may be engineered so as to also express the other of the antibody chains such that the expressed product is an antibody that has both a heavy and a light chain.
[0425] In one aspect, a method of producing an antibody according to the invention is provided, wherein the method comprises culturing a host cell comprising a polynucleotide encoding the antibody, as provided herein, under conditions suitable for expression of the antibody, and optionally recovering the antibody from the host cell (or host cell culture medium).
[0426] The components of the (multispecific) antibody of the invention may be genetically fused to each other. The (multispecific) antibody can be designed such that its components are fused directly to each other or indirectly through a linker sequence. The composition and length of the linker may be determined in accordance with methods well known in the art and may be tested for efficacy. Examples of linker sequences between different components of (multispecific) antibodies are provided herein. Additional sequences may also be included to incorporate a cleavage site to separate the individual components of the fusion if desired, for example an endopeptidase recognition sequence.
[0427] Antibodies prepared as described herein may be purified by art-known techniques such as high performance liquid chromatography, ion exchange chromatography, gel electrophoresis, affinity chromatography, size exclusion chromatography, and the like. The actual conditions used to purify a particular protein will depend, in part, on factors such as net charge, hydrophobicity, hydrophilicity etc., and will be apparent to those having skill in the art. For affinity chromatography purification, an antibody, ligand, receptor or antigen can be used to which the antibody binds. For example, for affinity chromatography purification of antibodies of the invention, a matrix with protein A or protein G may be used. Sequential Protein A or G affinity chromatography and size exclusion chromatography can be used to isolate an antibody essentially as described in the Examples. The purity of the antibody can be determined by any of a variety of well-known analytical methods including gel electrophoresis, high pressure liquid chromatography, and the like.
[0428] D. Assays
[0429] Antibodies provided herein may be identified, screened for, or characterized for their physical/chemical properties and/or biological activities by various assays known in the art.
[0430] 1. Binding Assays
[0431] The binding (affinity) of the antibody to a target antigen or an Fc receptor can be determined for example by surface plasmon resonance (SPR), using standard instrumentation such as a BIAcore instrument (GE Healthcare), and receptors or target proteins such as may be obtained by recombinant expression. Alternatively, binding of antibodies to different receptors or target antigens may be evaluated using cell lines expressing the particular receptor or target antigen, for example by flow cytometry (FACS). A specific illustrative and exemplary aspect for measuring binding activity to human or cynomolgus NKG2D is described in the following.
[0432] In one aspect, the binding activity to NKG2D is determined by SPR as follows:
[0433] SPR is performed on a Biacore B4000 instrument (GE Healthcare). Anti-Fab capturing antibody (GE Healthcare, #28958325) is immobilized on a Series S Sensor Chip CMS (GE Healthcare) using standard amine coupling chemistry, at a surface density of about 1500 resonance units (RU). As running and dilution buffer, PBS-T (10 mM phosphate buffered saline including 0.05% Tween20, pH 7.4) is used. The flow cells are set to 25 C. and primed twice with running buffer.
[0434] Antibody is captured by injecting a 10 g/ml solution for 60 sec at a flow rate of 10 l/min. Association is measured by injection of di huNKG2D ECD Fc avi (SEQ ID NO: 96) or di cyNKG2D ECD Fc avi (SEQ ID NO: 97) in various concentrations in solution for 180 s at a flow rate of 30 l/min starting with 600 nM, 300 nM, 150 nM following 1:3 dilutions. The dissociation phase is monitored for up to 450 s and triggered by switching from the sample solution to running buffer. The surface is regenerated by washing for 290 s with 10 mM glycine pH 2.1 at a flow rate of 30 l/min and an additional stabilization period of 180 s. Bulk refractive index differences are corrected by subtracting the response obtained from the surface with the capturing antibody alone. Blank injections are also subtracted (=double referencing). For calculation of K.sub.D, k.sub.a and k.sub.d, the Langmuir 1:1 model in the Biacore 4000 Evaluation software 1.1 (GE Healthcare) or TraceDrawer 1.6.1 (Ridgeview Instruments AB) is used.
[0435] 2. Activity Assays
[0436] Biological activity of the (multispecific) antibodies of the invention can be measured by various assays as described in the Examples. Biological activities may for example include the induction of proliferation of NKG2D-expressing cells, the induction of signaling in NKG2D-expressing cells, the induction of expression of activation markers in NKG2D-expressing cells, the induction of cytokine secretion by NKG2D-expressing cells, the induction of lysis of target cells such as tumor cells, and the induction of tumor regression and/or the improvement of survival.
[0437] E. Compositions, Formulations, and Routes of Administration
[0438] In a further aspect, the invention provides pharmaceutical compositions comprising any of the antibodies provided herein, e.g., for use in any of the below therapeutic methods. In one aspect, a pharmaceutical composition comprises an antibody according to the invention and a pharmaceutically acceptable carrier. In another aspect, a pharmaceutical composition comprises an antibody according to the invention and at least one additional therapeutic agent, e.g., as described below.
[0439] Further provided is a method of producing an antibody of the invention in a form suitable for administration in vivo, the method comprising (a) obtaining an antibody according to the invention, and (b) formulating the antibody with at least one pharmaceutically acceptable carrier, whereby a preparation of antibody is formulated for administration in vivo.
[0440] Pharmaceutical compositions of the present invention comprise an effective amount of antibody dissolved or dispersed in a pharmaceutically acceptable carrier. The phrase pharmaceutically acceptable refers to molecular entities and compositions that are generally non-toxic to recipients at the dosages and concentrations employed, i.e. do not produce an adverse, allergic or other untoward reaction when administered to an animal, such as, for example, a human, as appropriate. The preparation of a pharmaceutical composition that contains an antibody and optionally an additional active ingredient will be known to those of skill in the art in light of the present disclosure, as exemplified by Remington's Pharmaceutical Sciences, 18th Ed. Mack Printing Company, 1990, incorporated herein by reference. Moreover, for animal (e.g., human) administration, it will be understood that preparations should meet sterility, pyrogenicity, general safety and purity standards as required by FDA Office of Biological Standards or corresponding authorities in other countries. Preferred compositions are lyophilized formulations or aqueous solutions. As used herein, pharmaceutically acceptable carrier includes any and all solvents, buffers, dispersion media, coatings, surfactants, antioxidants, preservatives (e.g. antibacterial agents, antifungal agents), isotonic agents, absorption delaying agents, salts, preservatives, antioxidants, proteins, drugs, drug stabilizers, polymers, gels, binders, excipients, disintegration agents, lubricants, sweetening agents, flavoring agents, dyes, such like materials and combinations thereof, as would be known to one of ordinary skill in the art (see, for example, Remington's Pharmaceutical Sciences, 18th Ed. Mack Printing Company, 1990, pp. 1289-1329, incorporated herein by reference). Except insofar as any conventional carrier is incompatible with the active ingredient, its use in the pharmaceutical compositions is contemplated.
[0441] An antibody of the invention (and any additional therapeutic agent) can be administered by any suitable means, including parenteral, intrapulmonary, and intranasal, and, if desired for local treatment, intralesional administration. Parenteral infusions include intramuscular, intravenous, intraarterial, intraperitoneal, or subcutaneous administration. Dosing can be by any suitable route, e.g. by injections, such as intravenous or subcutaneous injections, depending in part on whether the administration is brief or chronic.
[0442] Parenteral compositions include those designed for administration by injection, e.g. subcutaneous, intradermal, intralesional, intravenous, intraarterial intramuscular, intrathecal or intraperitoneal injection. For injection, the antibodies of the invention may be formulated in aqueous solutions, particularly in physiologically compatible buffers such as Hanks' solution, Ringer's solution, or physiological saline buffer. The solution may contain formulatory agents such as suspending, stabilizing and/or dispersing agents. Alternatively, the antibodies may be in powder form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use. Sterile injectable solutions are prepared by incorporating the antibodies of the invention in the required amount in the appropriate solvent with various of the other ingredients enumerated below, as required. Sterility may be readily accomplished, e.g., by filtration through sterile filtration membranes. Generally, dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and/or the other ingredients. In the case of sterile powders for the preparation of sterile injectable solutions, suspensions or emulsion, the preferred methods of preparation are vacuum-drying or freeze-drying techniques which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered liquid medium thereof. The liquid medium should be suitably buffered if necessary and the liquid diluent first rendered isotonic prior to injection with sufficient saline or glucose. The composition must be stable under the conditions of manufacture and storage, and preserved against the contaminating action of microorganisms, such as bacteria and fungi. It will be appreciated that endotoxin contamination should be kept minimally at a safe level, for example, less than 0.5 ng/mg protein. Suitable pharmaceutically acceptable carriers include, but are not limited to: buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g. Zn-protein complexes); and/or non-ionic surfactants such as polyethylene glycol (PEG). Aqueous injection suspensions may contain compounds which increase the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol, dextran, or the like. Optionally, the suspension may also contain suitable stabilizers or agents which increase the solubility of the compounds to allow for the preparation of highly concentrated solutions. Additionally, suspensions of the active compounds may be prepared as appropriate oily injection suspensions. Suitable lipophilic solvents or vehicles include fatty oils such as sesame oil, or synthetic fatty acid esters, such as ethyl cleats or triglycerides, or liposomes.
[0443] Active ingredients may be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions. Such techniques are disclosed in Remington's Pharmaceutical Sciences (18th Ed. Mack Printing Company, 1990). Sustained-release preparations may be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the polypeptide, which matrices are in the form of shaped articles, e.g. films, or microcapsules. In particular aspects, prolonged absorption of an injectable composition can be brought about by the use in the compositions of agents delaying absorption, such as, for example, aluminum monostearate, gelatin or combinations thereof.
[0444] In addition to the compositions described previously, the antibodies may also be formulated as a depot preparation. Such long acting formulations may be administered by implantation (for example subcutaneously or intramuscularly) or by intramuscular injection. Thus, for example, the antibodies may be formulated with suitable polymeric or hydrophobic materials (for example as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives, for example, as a sparingly soluble salt.
[0445] Pharmaceutical compositions comprising the antibodies of the invention may be manufactured by means of conventional mixing, dissolving, emulsifying, encapsulating, entrapping or lyophilizing processes. Pharmaceutical compositions may be formulated in conventional manner using one or more physiologically acceptable carriers, diluents, excipients or auxiliaries which facilitate processing of the proteins into preparations that can be used pharmaceutically. Proper formulation is dependent upon the route of administration chosen.
[0446] The antibodies may be formulated into a composition in a free acid or base, neutral or salt form. Pharmaceutically acceptable salts are salts that substantially retain the biological activity of the free acid or base. These include the acid addition salts, e.g., those formed with the free amino groups of a proteinaceous composition, or which are formed with inorganic acids such as for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric or mandelic acid. Salts formed with the free carboxyl groups can also be derived from inorganic bases such as for example, sodium, potassium, ammonium, calcium or ferric hydroxides; or such organic bases as isopropylamine, trimethylamine, histidine or procaine. Pharmaceutical salts tend to be more soluble in aqueous and other protic solvents than are the corresponding free base forms.
[0447] F. Therapeutic Methods and Compositions
[0448] Any of the antibodies provided herein may be used in therapeutic methods. Antibodies of the invention may be used as immunotherapeutic agents, for example in the treatment of cancers.
[0449] For use in therapeutic methods, antibodies of the invention would be formulated, dosed, and administered in a fashion consistent with good medical practice. Factors for consideration in this context include the particular disorder being treated, the particular mammal being treated, the clinical condition of the individual patient, the cause of the disorder, the site of delivery of the agent, the method of administration, the scheduling of administration, and other factors known to medical practitioners.
[0450] In one aspect, antibodies of the invention for use as a medicament are provided. In further aspects, antibodies of the invention for use in treating a disease are provided. In certain aspects, antibodies of the invention for use in a method of treatment are provided. In one aspect, the invention provides an antibody of the invention for use in the treatment of a disease in an individual in need thereof. In certain aspects, the invention provides an antibody for use in a method of treating an individual having a disease comprising administering to the individual an effective amount of the antibody. In certain aspects the disease to be treated is a proliferative disorder. In a preferred aspect the disease is cancer. In certain aspects the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent, e.g., an anti-cancer agent if the disease to be treated is cancer. In further aspects, the invention provides an antibody of the invention for use in inducing lysis of a target cell, particularly a tumor cell. In certain aspects, the invention provides an antibody of the invention for use in a method of inducing lysis of a target cell, particularly a tumor cell, in an individual comprising administering to the individual an effective amount of the antibody to induce lysis of a target cell. In certain aspects, the method further comprises administering a T-cell activating agent, such as an antibody that binds to CD3, particularly a bispecific antibody that binds to CD3 and a target cell antigen, particularly a tumor cell antigen. In certain aspects, the use is in combination with a T-cell activating agent, such as an antibody that binds to CD3, particularly a bispecific antibody that binds to CD3 and a target cell antigen, particularly a tumor cell antigen. An individual according to any of the above aspects is a mammal, preferably a human.
[0451] In a further aspect, the invention provides for the use of an antibody of the invention in the manufacture or preparation of a medicament. In one aspect the medicament is for the treatment of a disease in an individual in need thereof. In a further aspect, the medicament is for use in a method of treating a disease comprising administering to an individual having the disease an effective amount of the medicament. In certain aspects the disease to be treated is a proliferative disorder. In a preferred aspect the disease is cancer. In one aspect, the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent, e.g., an anti-cancer agent if the disease to be treated is cancer. In a further aspect, the medicament is for inducing lysis of a target cell, particularly a tumor cell. In still a further aspect, the medicament is for use in a method of inducing lysis of a target cell, particularly a tumor cell, in an individual comprising administering to the individual an effective amount of the medicament to induce lysis of a target cell. In certain aspects, the method further comprises administering a T-cell activating agent, such as an antibody that binds to CD3, particularly a bispecific antibody that binds to CD3 and a target cell antigen, particularly a tumor cell antigen. In certain aspects, the treatment is in combination with a T-cell activating agent, such as an antibody that binds to CD3, particularly a bispecific antibody that binds to CD3 and a target cell antigen, particularly a tumor cell antigen. An individual according to any of the above aspects may be a mammal, preferably a human.
[0452] In a further aspect, the invention provides a method for treating a disease. In one aspect, the method comprises administering to an individual having such disease an effective amount of an antibody of the invention. In one aspect a composition is administered to said individual, comprising the antibody of the invention in a pharmaceutically acceptable form. In certain aspects the disease to be treated is a proliferative disorder. In a preferred aspect the disease is cancer. In certain aspects the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent, e.g., an anti-cancer agent if the disease to be treated is cancer. In certain aspects, the method further comprises administering a T-cell activating agent, such as an antibody that binds to CD3, particularly a bispecific antibody that binds to CD3 and a target cell antigen, particularly a tumor cell antigen. An individual according to any of the above aspects may be a mammal, preferably a human.
[0453] In a further aspect, the invention provides a method for inducing lysis of a target cell, particularly a tumor cell. In one aspect the method comprises contacting a target cell with an antibody of the invention in the presence of a T cell, particularly a cytotoxic T cell. In a further aspect, a method for inducing lysis of a target cell, particularly a tumor cell, in an individual is provided. In one such aspect, the method comprises administering to the individual an effective amount of an antibody of the invention to induce lysis of a target cell. In certain aspects, the method further comprises administering a T-cell activating agent, such as an antibody that binds to CD3, particularly a bispecific antibody that binds to CD3 and a target cell antigen, particularly a tumor cell antigen. In one aspect, an individual is a human.
[0454] In certain aspects, the disease to be treated is a proliferative disorder, particularly cancer. Non-limiting examples of cancers include bladder cancer, brain cancer, head and neck cancer, pancreatic cancer, lung cancer, breast cancer, ovarian cancer, uterine cancer, cervical cancer, endometrial cancer, esophageal cancer, colon cancer, colorectal cancer, rectal cancer, gastric cancer, prostate cancer, blood cancer, skin cancer, squamous cell carcinoma, bone cancer, and kidney cancer. Other cell proliferation disorders that may be treated using an antibody of the present invention include, but are not limited to neoplasms located in the: abdomen, bone, breast, digestive system, liver, pancreas, peritoneum, endocrine glands (adrenal, parathyroid, pituitary, testicles, ovary, thymus, thyroid), eye, head and neck, nervous system (central and peripheral), lymphatic system, pelvic, skin, soft tissue, spleen, thoracic region, and urogenital system. Also included are pre-cancerous conditions or lesions and cancer metastases. In certain aspects, the cancer is selected from the group consisting of kidney cancer, bladder cancer, skin cancer, lung cancer, colorectal cancer, breast cancer, brain cancer, head and neck cancer and prostate cancer. In one aspect, the cancer in a cancer expressing the second antigen. A skilled artisan readily recognizes that in many cases the antibody may not provide a cure but may only provide partial benefit. In some aspects, a physiological change having some benefit is also considered therapeutically beneficial. Thus, in some aspects, an amount of antibody that provides a physiological change is considered an effective amount. The subject, patient, or individual in need of treatment is typically a mammal, more specifically a human.
[0455] In some aspects, an effective amount of an antibody of the invention is administered to an individual for the treatment of disease.
[0456] For the prevention or treatment of disease, the appropriate dosage of an antibody of the invention (when used alone or in combination with one or more other additional therapeutic agents) will depend on the type of disease to be treated, the route of administration, the body weight of the patient, the type of antibody, the severity and course of the disease, whether the antibody is administered for preventive or therapeutic purposes, previous or concurrent therapeutic interventions, the patient's clinical history and response to the antibody, and the discretion of the attending physician. The practitioner responsible for administration will, in any event, determine the concentration of active ingredient(s) in a composition and appropriate dose(s) for the individual subject. Various dosing schedules including but not limited to single or multiple administrations over various time-points, bolus administration, and pulse infusion are contemplated herein.
[0457] The antibody is suitably administered to the patient at one time or over a series of treatments. Depending on the type and severity of the disease, about 1 g/kg to 15 mg/kg (e.g. 0.1 mg/kg-10 mg/kg) of antibody can be an initial candidate dosage for administration to the patient, whether, for example, by one or more separate administrations, or by continuous infusion. One typical daily dosage might range from about 1 g/kg to 100 mg/kg or more, depending on the factors mentioned above. For repeated administrations over several days or longer, depending on the condition, the treatment would generally be sustained until a desired suppression of disease symptoms occurs. One exemplary dosage of the antibody would be in the range from about 0.005 mg/kg to about 10 mg/kg. In other non-limiting examples, a dose may also comprise from about 1 microgram/kg body weight, about 5 microgram/kg body weight, about 10 microgram/kg body weight, about 50 microgram/kg body weight, about 100 microgram/kg body weight, about 200 microgram/kg body weight, about 350 microgram/kg body weight, about 500 microgram/kg body weight, about 1 milligram/kg body weight, about 5 milligram/kg body weight, about 10 milligram/kg body weight, about 50 milligram/kg body weight, about 100 milligram/kg body weight, about 200 milligram/kg body weight, about 350 milligram/kg body weight, about 500 milligram/kg body weight, to about 1000 mg/kg body weight or more per administration, and any range derivable therein. In non-limiting examples of a derivable range from the numbers listed herein, a range of about 5 mg/kg body weight to about 100 mg/kg body weight, about 5 microgram/kg body weight to about 500 milligram/kg body weight, etc., can be administered, based on the numbers described above. Thus, one or more doses of about 0.5 mg/kg, 2.0 mg/kg, 5.0 mg/kg or 10 mg/kg (or any combination thereof) may be administered to the patient. Such doses may be administered intermittently, e.g. every week or every three weeks (e.g. such that the patient receives from about two to about twenty, or e.g. about six doses of the antibody). An initial higher loading dose, followed by one or more lower doses may be administered. However, other dosage regimens may be useful. The progress of this therapy is easily monitored by conventional techniques and assays.
[0458] The antibodies of the invention will generally be used in an amount effective to achieve the intended purpose. For use to treat or prevent a disease condition, the antibodies of the invention, or pharmaceutical compositions thereof, are administered or applied in an effective amount.
[0459] For systemic administration, an effective dose can be estimated initially from in vitro assays, such as cell culture assays. A dose can then be formulated in animal models to achieve a circulating concentration range that includes the IC.sub.50 as determined in cell culture. Such information can be used to more accurately determine useful doses in humans.
[0460] Initial dosages can also be estimated from in vivo data, e.g., animal models, using techniques that are well known in the art.
[0461] Dosage amount and interval may be adjusted individually to provide plasma levels of the antibodies which are sufficient to maintain therapeutic effect. Usual patient dosages for administration by injection range from about 0.1 to 50 mg/kg/day, typically from about 0.5 to 1 mg/kg/day. Therapeutically effective plasma levels may be achieved by administering multiple doses each day. Levels in plasma may be measured, for example, by HPLC.
[0462] An effective dose of the antibodies of the invention will generally provide therapeutic benefit without causing substantial toxicity. Toxicity and therapeutic efficacy of an antibody can be determined by standard pharmaceutical procedures in cell culture or experimental animals. Cell culture assays and animal studies can be used to determine the LD.sub.50 (the dose lethal to 50% of a population) and the ED.sub.50 (the dose therapeutically effective in 50% of a population). The dose ratio between toxic and therapeutic effects is the therapeutic index, which can be expressed as the ratio LD.sub.50/ED.sub.50. Antibodies that exhibit large therapeutic indices are preferred. In one aspect, the antibody according to the present invention exhibits a high therapeutic index. The data obtained from cell culture assays and animal studies can be used in formulating a range of dosages suitable for use in humans. The dosage lies preferably within a range of circulating concentrations that include the ED.sub.50 with little or no toxicity. The dosage may vary within this range depending upon a variety of factors, e.g., the dosage form employed, the route of administration utilized, the condition of the subject, and the like. The exact formulation, route of administration and dosage can be chosen by the individual physician in view of the patient's condition (see, e.g., Fingl et al., 1975, in: The Pharmacological Basis of Therapeutics, Ch. 1, p. 1, incorporated herein by reference in its entirety).
[0463] The attending physician for patients treated with antibodies of the invention would know how and when to terminate, interrupt, or adjust administration due to toxicity, organ dysfunction, and the like. Conversely, the attending physician would also know to adjust treatment to higher levels if the clinical response were not adequate (precluding toxicity). The magnitude of an administered dose in the management of the disorder of interest will vary with the severity of the condition to be treated, with the route of administration, and the like. The severity of the condition may, for example, be evaluated, in part, by standard prognostic evaluation methods. Further, the dose and perhaps dose frequency will also vary according to the age, body weight, and response of the individual patient.
[0464] The antibodies of the invention may be administered in combination with one or more other agents in therapy. For instance, an antibody of the invention may be co-administered with at least one additional therapeutic agent. The term therapeutic agent encompasses any agent administered to treat a symptom or disease in an individual in need of such treatment. Such additional therapeutic agent may comprise any active ingredients suitable for the particular disease being treated, preferably those with complementary activities that do not adversely affect each other. In certain aspects, an additional therapeutic agent is an immunomodulatory agent, a cytostatic agent, an inhibitor of cell adhesion, a cytotoxic agent, an activator of cell apoptosis, or an agent that increases the sensitivity of cells to apoptotic inducers. In one aspect, the additional therapeutic agent is an anti-cancer agent, for example a microtubule disruptor, an antimetabolite, a topoisomerase inhibitor, a DNA intercalator, an alkylating agent, a hormonal therapy, a kinase inhibitor, a receptor antagonist, an activator of tumor cell apoptosis, or an antiangiogenic agent. In preferred aspects, the additional therapeutic agent is a T-cell activating agent. In one such aspect, the additional therapeutic agent is an antibody that binds to CD3, particularly a bispecific antibody that binds to CD3 and a target cell antigen, particularly a tumor cell antigen. In one aspect, the target cell antigen to which the additional therapeutic agent binds is the same as the second antigen, and/or is co-expressed (e.g. on the same target cell) like the second antigen.
[0465] In one aspect, the additional therapeutic agent is a CD3CEA bispecific antibody. Further aspects of the CD3CEA bispecific antibodies that may be used in combination with the anti-NKG2D (multispecific) antibodies of the invention are described hereinbelow. In a specific aspect, the additional therapeutic agent is CEA-TCB (CDR sequences of SEQ ID NOs 130-135 (CD3) and 138-143 (CEA), variable region sequences of SEQ ID NOs 136 and 137 (CD3) and 144 and 145 (CEA), full sequences of SEQ ID NOs 154-157) or CEA-TCB (2) (CDR sequences of SEQ ID NOs 130-135 (CD3) and 146-151 (CEA), variable region sequences of SEQ ID NOs 136 and 137 (CD3) and 152 and 153 (CEA), full sequences of SEQ ID NOs 158-161).
[0466] Such other agents are suitably present in combination in amounts that are effective for the purpose intended. The effective amount of such other agents depends on the amount of antibody used, the type of disorder or treatment, and other factors discussed above. The antibodies are generally used in the same dosages and with administration routes as described herein, or about from 1 to 99% of the dosages described herein, or in any dosage and by any route that is empirically/clinically determined to be appropriate.
[0467] Such combination therapies noted above encompass combined administration (where two or more therapeutic agents are included in the same or separate compositions), and separate administration, in which case, administration of the antibody of the invention can occur prior to, simultaneously, and/or following, administration of the additional therapeutic agent and/or adjuvant. Antibodies of the invention may also be used in combination with radiation therapy.
CD3CEA Bispecific Antibodies for Combination with Antibodies of the Invention
[0468] The CD3CEA bispecific antibody comprises a first antigen binding moiety that specifically binds to CD3, and a second antigen binding moiety that specifically binds to CEA.
[0469] In one aspect, the first antigen binding moiety comprises a heavy chain variable region comprising the heavy chain CDR (HCDR) 1 of SEQ ID NO: 130, the HCDR2 of SEQ ID NO: 131, and the HCDR3 of SEQ ID NO: 132; and a light chain variable region comprising the light chain CDR (LCDR) 1 of SEQ ID NO: 133, the LCDR2 of SEQ ID NO: 134 and the LCDR3 of SEQ ID NO: 135.
[0470] In one aspect, the second antigen binding moiety comprises a heavy chain variable region comprising the heavy chain CDR (HCDR) 1 of SEQ ID NO: 138, the HCDR2 of SEQ ID NO: 139, and the HCDR3 of SEQ ID NO: 140; and a light chain variable region comprising the light chain CDR (LCDR) 1 of SEQ ID NO: 141, the LCDR2 of SEQ ID NO: 142 and the LCDR3 of SEQ ID NO: 143; or (ii) a heavy chain variable region comprising the heavy chain CDR (HCDR) 1 of SEQ ID NO: 146, the HCDR2 of SEQ ID NO: 147, and the HCDR3 of SEQ ID NO: 148; and a light chain variable region comprising the light chain CDR (LCDR) 1 of SEQ ID NO: 149, the LCDR2 of SEQ ID NO: 150 and the LCDR3 of SEQ ID NO: 151.
[0471] In a particular aspect, the CD3CEA bispecific antibody comprises
(i) a first antigen binding moiety that specifically binds to CD3 and comprises a heavy chain variable region comprising the heavy chain CDR (HCDR) 1 of SEQ ID NO: 130, the HCDR2 of SEQ ID NO: 131, and the HCDR3 of SEQ ID NO: 132; and a light chain variable region comprising the light chain CDR (LCDR) 1 of SEQ ID NO: 133, the LCDR2 of SEQ ID NO: 134 and the LCDR3 of SEQ ID NO: 135; and
(ii) a second antigen binding moiety that specifically binds to CEA and comprises a heavy chain variable region comprising the heavy chain CDR (HCDR) 1 of SEQ ID NO: 138, the HCDR2 of SEQ ID NO: 139, and the HCDR3 of SEQ ID NO: 140; and a light chain variable region comprising the light chain CDR (LCDR) 1 of SEQ ID NO: 141, the LCDR2 of SEQ ID NO: 142 and the LCDR3 of SEQ ID NO: 143; or (ii) a heavy chain variable region comprising the heavy chain CDR (HCDR) 1 of SEQ ID NO: 146, the HCDR2 of SEQ ID NO: 147, and the HCDR3 of SEQ ID NO: 148; and a light chain variable region comprising the light chain CDR (LCDR) 1 of SEQ ID NO: 149, the LCDR2 of SEQ ID NO: 150 and the LCDR3 of SEQ ID NO: 151.
[0472] In one aspect, the first antigen binding moiety comprises a heavy chain variable region sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 136 and a light chain variable region sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 137.
[0473] In one aspect, the first antigen binding moiety comprises the heavy chain variable region sequence of SEQ ID NO: 136 and the light chain variable region sequence of SEQ ID NO: 137.
[0474] In one aspect, the second antigen binding moiety comprises a heavy chain variable region sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 144 and a light chain variable region sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 145; or (ii) a heavy chain variable region sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 152 and a light chain variable region sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 153.
[0475] In one aspect, the second antigen binding moiety comprises the heavy chain variable region sequence of SEQ ID NO: 144 and the light chain variable region sequence of SEQ ID NO: 145; or (ii) the heavy chain variable region sequence of SEQ ID NO: 152 and the light chain variable region sequence of SEQ ID NO: 153.
[0476] In some aspects, the first and/or the second antigen binding moiety is a Fab molecule. In some aspects, the first antigen binding moiety is a crossover Fab molecule wherein either the variable or the constant regions of the Fab light chain and the Fab heavy chain are exchanged. In such aspects, the second antigen binding moiety preferably is a conventional Fab molecule.
[0477] In some aspects wherein the first and the second antigen binding moiety of the bispecific antibody are both Fab molecules, and in one of the antigen binding moieties (particularly the first antigen binding moiety) the variable domains VL and VH of the Fab light chain and the Fab heavy chain are replaced by each other,
i) in the constant domain CL of the first antigen binding moiety the amino acid at position 124 is substituted by a positively charged amino acid (numbering according to Kabat), and wherein in the constant domain CH1 of the first antigen binding moiety the amino acid at position 147 or the amino acid at position 213 is substituted by a negatively charged amino acid (numbering according to Kabat EU index); or
ii) in the constant domain CL of the second antigen binding moiety the amino acid at position 124 is substituted by a positively charged amino acid (numbering according to Kabat), and wherein in the constant domain CH1 of the second antigen binding moiety the amino acid at position 147 or the amino acid at position 213 is substituted by a negatively charged amino acid (numbering according to Kabat EU index).
[0478] The bispecific antibody does not comprise both modifications mentioned under i) and ii). The constant domains CL and CH1 of the antigen binding moiety having the VH/VL exchange are not replaced by each other (i.e. remain unexchanged).
[0479] In a more specific aspect,
i) in the constant domain CL of the first antigen binding moiety the amino acid at position 124 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat), and in the constant domain CH1 of the first antigen binding moiety the amino acid at position 147 or the amino acid at position 213 is substituted independently by glutamic acid (E), or aspartic acid (D) (numbering according to Kabat EU index); or
ii) in the constant domain CL of the second antigen binding moiety the amino acid at position 124 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat), and in the constant domain CH1 of the second antigen binding moiety the amino acid at position 147 or the amino acid at position 213 is substituted independently by glutamic acid (E), or aspartic acid (D) (numbering according to Kabat EU index).
[0480] In one such aspect, in the constant domain CL of the second antigen binding moiety the amino acid at position 124 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat), and in the constant domain CH1 of the second antigen binding moiety the amino acid at position 147 or the amino acid at position 213 is substituted independently by glutamic acid (E), or aspartic acid (D) (numbering according to Kabat EU index).
[0481] In a further aspect, in the constant domain CL of the second antigen binding moiety the amino acid at position 124 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat), and in the constant domain CH1 of the second antigen binding moiety the amino acid at position 147 is substituted independently by glutamic acid (E), or aspartic acid (D) (numbering according to Kabat EU index).
[0482] In a particular aspect, in the constant domain CL of the second antigen binding moiety the amino acid at position 124 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat) and the amino acid at position 123 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat), and in the constant domain CH1 of the second antigen binding moiety the amino acid at position 147 is substituted independently by glutamic acid (E), or aspartic acid (D) (numbering according to Kabat EU index) and the amino acid at position 213 is substituted independently by glutamic acid (E), or aspartic acid (D) (numbering according to Kabat EU index).
[0483] In a more particular aspect, in the constant domain CL of the second antigen binding moiety the amino acid at position 124 is substituted by lysine (K) (numbering according to Kabat) and the amino acid at position 123 is substituted by lysine (K) (numbering according to Kabat), and in the constant domain CH1 of the second antigen binding moiety the amino acid at position 147 is substituted by glutamic acid (E) (numbering according to Kabat EU index) and the amino acid at position 213 is substituted by glutamic acid (E) (numbering according to Kabat EU index).
[0484] In an even more particular aspect, in the constant domain CL of the second antigen binding moiety the amino acid at position 124 is substituted by lysine (K) (numbering according to Kabat) and the amino acid at position 123 is substituted by arginine (R) (numbering according to Kabat), and in the constant domain CH1 of the second antigen binding moiety the amino acid at position 147 is substituted by glutamic acid (E) (numbering according to Kabat EU index) and the amino acid at position 213 is substituted by glutamic acid (E) (numbering according to Kabat EU index).
[0485] In particular aspects, if amino acid substitutions according to the above aspects are made in the constant domain CL and the constant domain CH1 of the second antigen binding moiety, the constant domain CL of the second antigen binding moiety is of kappa isotype.
[0486] In some aspects, the first and the second antigen binding moiety are fused to each other, optionally via a peptide linker.
[0487] In some aspects, the first and the second antigen binding moiety are each a Fab molecule and either (i) the second antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the Fab heavy chain of the first antigen binding moiety, or (ii) the first antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the Fab heavy chain of the second antigen binding moiety.
[0488] In some aspects, the CD3CEA bispecific antibody provides monovalent binding to CD3.
[0489] In particular aspects, the CD3CEA bispecific antibody comprises a single antigen binding moiety that specifically binds to CD3, and two antigen binding moieties that specifically bind to CEA. Thus, in some aspects, the CD3CEA bispecific antibody comprises a third antigen binding moiety that specifically binds to CEA. In some aspects, the third antigen moiety is identical to the first antigen binding moiety (e.g. is also a Fab molecule and comprises the same amino acid sequences).
[0490] In particular aspects, the CD3CEA bispecific antibody further comprises an Fc domain composed of a first and a second subunit. In one aspect, the Fc domain is an IgG Fc domain. In a particular aspect, the Fc domain is an IgG.sub.1 Fc domain. In another aspect the Fc domain is an IgG.sub.4 Fc domain. In a more specific aspect, the Fc domain is an IgG4 Fc domain comprising an amino acid substitution at position 5228 (Kabat EU index numbering), particularly the amino acid substitution S228P. This amino acid substitution reduces in vivo Fab arm exchange of IgG4 antibodies (see Stubenrauch et al., Drug Metabolism and Disposition 38, 84-91 (2010)). In a further particular aspect, the Fc domain is a human Fc domain. In a particularly preferred aspect, the Fc domain is a human IgG.sub.1 Fc domain. An exemplary sequence of a human IgG.sub.1 Fc region is given in SEQ ID NO: 86.
[0491] In some aspects wherein the first, the second and, where present, the third antigen binding moiety are each a Fab molecule, (a) either (i) the second antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the Fab heavy chain of the first antigen binding moiety and the first antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain, or (ii) the first antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the Fab heavy chain of the second antigen binding moiety and the second antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain; and (b) the third antigen binding moiety, where present, is fused at the C-terminus of the Fab heavy chain to the N-terminus of the second subunit of the Fc domain.
[0492] In particular aspects, the Fc domain comprises a modification promoting the association of the first and the second subunit of the Fc domain. The site of most extensive protein-protein interaction between the two subunits of a human IgG Fc domain is in the CH3 domain. Thus, in one aspect said modification is in the CH3 domain of the Fc domain.
[0493] In a specific aspect said modification promoting the association of the first and the second subunit of the Fc domain is a so-called knob-into-hole modification, comprising a knob modification in one of the two subunits of the Fc domain and a hole modification in the other one of the two subunits of the Fc domain. The knob-into-hole technology is described e.g. in U.S. Pat. Nos. 5,731,168; 7,695,936; Ridgway et al., Prot Eng 9, 617-621 (1996) and Carter, J Immunol Meth 248, 7-15 (2001). Generally, the method involves introducing a protuberance (knob) at the interface of a first polypeptide and a corresponding cavity (hole) in the interface of a second polypeptide, such that the protuberance can be positioned in the cavity so as to promote heterodimer formation and hinder homodimer formation. Protuberances are constructed by replacing small amino acid side chains from the interface of the first polypeptide with larger side chains (e.g. tyrosine or tryptophan). Compensatory cavities of identical or similar size to the protuberances are created in the interface of the second polypeptide by replacing large amino acid side chains with smaller ones (e.g. alanine or threonine).
[0494] Accordingly, in some aspects, an amino acid residue in the CH3 domain of the first subunit of the Fc domain is replaced with an amino acid residue having a larger side chain volume, thereby generating a protuberance within the CH3 domain of the first subunit which is positionable in a cavity within the CH3 domain of the second subunit, and an amino acid residue in the CH3 domain of the second subunit of the Fc domain is replaced with an amino acid residue having a smaller side chain volume, thereby generating a cavity within the CH3 domain of the second subunit within which the protuberance within the CH3 domain of the first subunit is positionable. Preferably said amino acid residue having a larger side chain volume is selected from the group consisting of arginine (R), phenylalanine (F), tyrosine (Y), and tryptophan (W). Preferably said amino acid residue having a smaller side chain volume is selected from the group consisting of alanine (A), serine (S), threonine (T), and valine (V). The protuberance and cavity can be made by altering the nucleic acid encoding the polypeptides, e.g. by site-specific mutagenesis, or by peptide synthesis.
[0495] In a specific such aspect, in the first subunit of the Fc domain the threonine residue at position 366 is replaced with a tryptophan residue (T366W), and in the second subunit of the Fc domain the tyrosine residue at position 407 is replaced with a valine residue (Y407V) and optionally the threonine residue at position 366 is replaced with a serine residue (T366S) and the leucine residue at position 368 is replaced with an alanine residue (L368A) (numbering according to Kabat EU index). In a further aspect, in the first subunit of the Fc domain additionally the serine residue at position 354 is replaced with a cysteine residue (S354C) or the glutamic acid residue at position 356 is replaced with a cysteine residue (E356C) (particularly the serine residue at position 354 is replaced with a cysteine residue), and in the second subunit of the Fc domain additionally the tyrosine residue at position 349 is replaced by a cysteine residue (Y349C) (numbering according to Kabat EU index). In a preferred aspect, the first subunit of the Fc domain comprises the amino acid substitutions S354C and T366W, and the second subunit of the Fc domain comprises the amino acid substitutions Y349C, T366S, L368A and Y407V (numbering according to Kabat EU index).
[0496] In some aspects, the Fc domain comprises one or more amino acid substitution that reduces binding to an Fc receptor and/or effector function.
[0497] In a particular aspect the Fc receptor is an Fc receptor. In one aspect the Fc receptor is a human Fc receptor. In one aspect the Fc receptor is an activating Fc receptor. In a specific aspect the Fc receptor is an activating human Fc receptor, more specifically human FcRIIIa, FcRI or FcRIIa, most specifically human FcRIIIa (CD16a). In one aspect the effector function is one or more selected from the group of complement dependent cytotoxicity (CDC), antibody-dependent cell-mediated cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), and cytokine secretion. In a particular aspect, the effector function is ADCC.
[0498] Typically, the same one or more amino acid substitution is present in each of the two subunits of the Fc domain. In one aspect, the one or more amino acid substitution reduces the binding affinity of the Fc domain to an Fc receptor. In one aspect, the one or more amino acid substitution reduces the binding affinity of the Fc domain to an Fc receptor by at least 2-fold, at least 5-fold, or at least 10-fold.
[0499] In one aspect, the Fc domain comprises an amino acid substitution at a position selected from the group of E233, L234, L235, N297, P331 and P329 (numberings according to Kabat EU index). In a more specific aspect, the Fc domain comprises an amino acid substitution at a position selected from the group of L234, L235 and P329 (numberings according to Kabat EU index). In some aspects, the Fc domain comprises the amino acid substitutions L234A and L235A (numberings according to Kabat EU index). In one such aspect, the Fc domain is an IgG.sub.1 Fc domain, particularly a human IgG.sub.1 Fc domain. In one aspect, the Fc domain comprises an amino acid substitution at position P329. In a more specific aspect, the amino acid substitution is P329A or P329G, particularly P329G (numberings according to Kabat EU index). In one aspect, the Fc domain comprises an amino acid substitution at position P329 and a further amino acid substitution at a position selected from E233, L234, L235, N297 and P331 (numberings according to Kabat EU index). In a more specific aspect, the further amino acid substitution is E233P, L234A, L235A, L235E, N297A, N297D or P331S. In particular aspects, the Fc domain comprises amino acid substitutions at positions P329, L234 and L235 (numberings according to Kabat EU index). In more particular aspects, the Fc domain comprises the amino acid mutations L234A, L235A and P329G (P329G LALA, PGLALA or LALAPG). Specifically, in preferred aspects, each subunit of the Fc domain comprises the amino acid substitutions L234A, L235A and P329G (Kabat EU index numbering), i.e. in each of the first and the second subunit of the Fc domain the leucine residue at position 234 is replaced with an alanine residue (L234A), the leucine residue at position 235 is replaced with an alanine residue (L235A) and the proline residue at position 329 is replaced by a glycine residue (P329G) (numbering according to Kabat EU index). In one such aspect, the Fc domain is an IgG.sub.1 Fc domain, particularly a human IgG.sub.1 Fc domain.
[0500] In a preferred aspect, the CD3CEA bispecific antibody comprises
(i) a first antigen binding moiety that specifically binds to CD3, comprising a heavy chain variable region comprising the heavy chain CDR (HCDR) 1 of SEQ ID NO: 130, the HCDR2 of SEQ ID NO: 131, and the HCDR3 of SEQ ID NO: 132; and a light chain variable region comprising the light chain CDR (LCDR) 1 of SEQ ID NO: 133, the LCDR2 of SEQ ID NO: 134 and the LCDR3 of SEQ ID NO: 135, wherein the first antigen binding moiety is a crossover Fab molecule wherein either the variable or the constant regions, particularly the constant regions, of the Fab light chain and the Fab heavy chain are exchanged;
(ii) a second and a third antigen binding moiety that specifically bind to CEA, comprising a heavy chain variable region comprising the heavy chain CDR (HCDR) 1 of SEQ ID NO: 138, the HCDR2 of SEQ ID NO: 139, and the HCDR3 of SEQ ID NO: 140; and a light chain variable region comprising the light chain CDR (LCDR) 1 of SEQ ID NO: 141, the LCDR2 of SEQ ID NO: 142 and the LCDR3 of SEQ ID NO: 143, wherein the second and third antigen binding moiety are each a Fab molecule, particularly a conventional Fab molecule;
(iii) an Fc domain composed of a first and a second subunit,
wherein the second antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the Fab heavy chain of the first antigen binding moiety, and the first antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain, and wherein the third antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the second subunit of the Fc domain.
[0501] In one aspect, the first antigen binding moiety comprises a heavy chain variable region sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 136 and a light chain variable region sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 137.
[0502] In one aspect, the first antigen binding moiety comprises the heavy chain variable region sequence of SEQ ID NO: 136 and the light chain variable region sequence of SEQ ID NO: 137.
[0503] In one aspect, the second and third antigen binding moiety comprise a heavy chain variable region sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 144 and a light chain variable region sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 145.
[0504] In one aspect, the second and third antigen binding moieties comprise the heavy chain variable region of SEQ ID NO: 144 and the light chain variable region of SEQ ID NO: 145.
[0505] The Fc domain according to the above aspects may incorporate, singly or in combination, all of the features described hereinabove in relation to Fc domains.
[0506] In one aspect, the antigen binding moieties and the Fc region are fused to each other by peptide linkers, particularly by peptide linkers as in SEQ ID NO: 154 and SEQ ID NO: 155.
[0507] In one aspect, the CD3CEA bispecific antibody comprises a polypeptide comprising a sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO: 154, a polypeptide comprising a sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO: 155, a polypeptide comprising a sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO: 156, and a polypeptide (particularly two polypeptides) comprising a sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO: 157.
[0508] In one aspect, the CD3CEA bispecific antibody comprises a polypeptide comprising the sequence of SEQ ID NO: 154, a polypeptide comprising the sequence of SEQ ID NO: 155, a polypeptide comprising the sequence of SEQ ID NO: 156, and a polypeptide (particularly two polypeptides) comprising the sequence of SEQ ID NO: 157.
[0509] In a particular aspect, the CD3CEA bispecific antibody is cibisatamab (WHO Drug Information (International Nonproprietary Names for Pharmaceutical Substances), Recommended INN: List 80, 2018, vol. 32, no. 3, p. 438).
[0510] In one aspect, the CD3CEA bispecific antibody comprises
(i) a first antigen binding moiety that specifically binds to CD3, comprising a heavy chain variable region comprising the heavy chain CDR (HCDR) 1 of SEQ ID NO: 130, the HCDR2 of SEQ ID NO: 131, and the HCDR3 of SEQ ID NO: 132; and a light chain variable region comprising the light chain CDR (LCDR) 1 of SEQ ID NO: 133, the LCDR2 of SEQ ID NO: 134 and the LCDR3 of SEQ ID NO: 135, wherein the first antigen binding moiety is a crossover Fab molecule wherein either the variable or the constant regions, particularly the variable regions, of the Fab light chain and the Fab heavy chain are exchanged;
(ii) a second and a third antigen binding moiety that specifically bind to CEA, comprising a heavy chain variable region comprising the heavy chain CDR (HCDR) 1 of SEQ ID NO: 146, the HCDR2 of SEQ ID NO: 147, and the HCDR3 of SEQ ID NO: 148; and a light chain variable region comprising the light chain CDR (LCDR) 1 of SEQ ID NO: 149, the LCDR2 of SEQ ID NO: 150 and the LCDR3 of SEQ ID NO: 151, wherein the second and third antigen binding moiety are each a Fab molecule, particularly a conventional Fab molecule;
(iii) an Fc domain composed of a first and a second subunit capable of stable association,
wherein the second antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the Fab heavy chain of the first antigen binding moiety, and the first antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain, and wherein the third antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the second subunit of the Fc domain.
[0511] In one aspect, the first antigen binding moiety comprises a heavy chain variable region sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 136 and a light chain variable region sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 137.
[0512] In one aspect, the first antigen binding moiety comprises the heavy chain variable region sequence of SEQ ID NO: 136 and the light chain variable region sequence of SEQ ID NO: 137.
[0513] In one aspect, the second and third antigen binding moiety comprise a heavy chain variable region sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 152 and a light chain variable region sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 153. In one aspect, the second and third antigen binding moieties comprise the heavy chain variable region of SEQ ID NO: 152 and the light chain variable region of SEQ ID NO: 153.
[0514] The Fc domain according to the above aspects may incorporate, singly or in combination, all of the features described hereinabove in relation to Fc domains.
[0515] In one aspect, the antigen binding moieties and the Fc region are fused to each other by peptide linkers, particularly by peptide linkers as in SEQ ID NO: 158 and SEQ ID NO: 159.
[0516] In one aspect, in the constant domain CL of the second and the third Fab molecule under (ii) the amino acid at position 124 is substituted by lysine (K) (numbering according to Kabat) and the amino acid at position 123 is substituted by lysine (K) or arginine (R), particularly by arginine (R) (numbering according to Kabat), and in the constant domain CH1 of the second and the third Fab molecule under (ii) the amino acid at position 147 is substituted by glutamic acid (E) (numbering according to Kabat EU index) and the amino acid at position 213 is substituted by glutamic acid (E) (numbering according to Kabat EU index).
[0517] In one aspect, the bispecific antibody comprises a polypeptide comprising a sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO: 158, a polypeptide comprising a sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO: 159, a polypeptide comprising a sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO: 160, and a polypeptide (particularly two polypeptides) comprising a sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO: 161.
[0518] In one aspect, the bispecific antibody comprises a polypeptide comprising the sequence of SEQ ID NO: 158, a polypeptide comprising the sequence of SEQ ID NO: 159, a polypeptide comprising the sequence of SEQ ID NO: 160, and a polypeptide (particularly two polypeptides) comprising the sequence of SEQ ID NO: 161.
[0519] Other CD3CEA bispecific antibodies as will be known to the skilled practitioner are also contemplated for use in the present invention.
[0520] In one aspect, the CD3CEA bispecific antibody is MEDI565 (AMG211, MT111).
[0521] G. Articles of Manufacture
[0522] In another aspect of the invention, an article of manufacture containing materials useful for the treatment, prevention and/or diagnosis of the disorders described above is provided. The article of manufacture comprises a container and a label or package insert on or associated with the container. Suitable containers include, for example, bottles, vials, syringes, IV solution bags, etc. The containers may be formed from a variety of materials such as glass or plastic. The container holds a composition which is by itself or combined with another composition effective for treating, preventing and/or diagnosing the condition and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). At least one active agent in the composition is an antibody of the invention. The label or package insert indicates that the composition is used for treating the condition of choice. Moreover, the article of manufacture may comprise (a) a first container with a composition contained therein, wherein the composition comprises an antibody of the invention; and (b) a second container with a composition contained therein, wherein the composition comprises a further cytotoxic or otherwise therapeutic agent. The article of manufacture in this aspect of the invention may further comprise a package insert indicating that the compositions can be used to treat a particular condition. Alternatively, or additionally, the article of manufacture may further comprise a second (or third) container comprising a pharmaceutically-acceptable buffer, such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, and syringes.
[0523] H. Methods and Compositions for Diagnostics and Detection
[0524] In certain aspects, any of the antibodies provided herein is useful for detecting the presence of its target (e.g. NKG2D) in a biological sample. The term detecting as used herein encompasses quantitative or qualitative detection. In certain aspects, a biological sample comprises a cell or tissue, such as prostate tissue.
[0525] In one aspect, an antibody according to the invention for use in a method of diagnosis or detection is provided. In a further aspect, a method of detecting the presence of NKG2D in a biological sample is provided. In certain aspects, the method comprises contacting the biological sample with an antibody of the present invention under conditions permissive for binding of the antibody to NKG2D, and detecting whether a complex is formed between the antibody and NKG2D. Such method may be an in vitro or in vivo method. In one aspect, an antibody of the invention is used to select subjects eligible for therapy with an antibody that binds to NKG2D, e.g. where NKG2D is a biomarker for selection of patients.
[0526] Exemplary disorders that may be diagnosed using an antibody of the invention include cancer.
[0527] In certain aspects, an antibody according to the present invention is provided, wherein the antibody is labelled. Labels include, but are not limited to, labels or moieties that are detected directly (such as fluorescent, chromophoric, electron-dense, chemiluminescent, and radioactive labels), as well as moieties, such as enzymes or ligands, that are detected indirectly, e.g., through an enzymatic reaction or molecular interaction. Exemplary labels include, but are not limited to, the radioisotopes .sup.32P, .sup.14C, .sup.125I, .sup.3H, and .sup.131I, fluorophores such as rare earth chelates or fluorescein and its derivatives, rhodamine and its derivatives, dansyl, umbelliferone, luceriferases, e.g., firefly luciferase and bacterial luciferase (U.S. Pat. No. 4,737,456), luciferin, 2,3-dihydrophthalazinediones, horseradish peroxidase (HRP), alkaline phosphatase, -galactosidase, glucoamylase, lysozyme, saccharide oxidases, e.g., glucose oxidase, galactose oxidase, and glucose-6-phosphate dehydrogenase, heterocyclic oxidases such as uricase and xanthine oxidase, coupled with an enzyme that employs hydrogen peroxide to oxidize a dye precursor such as HRP, lactoperoxidase, or microperoxidase, biotin/avidin, spin labels, bacteriophage labels, stable free radicals, and the like.
III. Sequences
[0528]
TABLE-US-00001 SEQ AminoAcidSequence IDNO HCDR1 SYAMS 1 5C5 HCDR2 AISGSGGSTYYADSVKG 2 5C5 HCDR3 ELYREYMDY 3 5C5 LCDR1 QGDSLRSYYAS 4 5C5 LCDR2 GKNNRPS 5 5C5 LCDR3 NSRDSFSIHQNV 6 5C5 VH5C5 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQA 7 PGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYL QMNSLRAEDTAVYYCAKELYREYMDYWGQGTLVTVSS VL5C5 SSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPG 8 QAPVLVIYGKNNRPSGIPDRFSGSSSGNTASLTITGAQAEDE ADYYCNSRDSFSIHQNVFGGGTKLTVL HCDR1 SYWIG 9 13C6 HCDR2 IIYPGDSDTRYSPSFQG 10 13C6 HCDR3 LYPVGVYFDY 11 13C6 LCDR1 RASQSISSWLA 12 13C6 LCDR2 DASSLES 13 13C6 LCDR3 QQYWSYWM 14 13C6 VH13C6 EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQM 15 PGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQ WSSLKASDTAMYYCARLYPVGVYFDYWGQGTLVTVSS VL13C6 DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPG 16 KAPKLLIYDASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFA TYYCQQYWSYWMFGQGTKVEIK HCDR1 YWMT 17 001 HCDR2 CIHGGSSGSTYYASWVNG 18 001 HCDR3 PGYRSWSKTFDL 19 001 LCDR1001 RASQDISESLN 20 LCDR2001 AASSLQS 21 LCDR3001 QQANSFPLT 22 VH001 QQLEQSGGGLVTPGGSLKLCCIGSGFDFNTYWMTWVRQAP 23 GKGLEWIGCIHGGSSGSTYYASWVNGRFTLSRDIDQSTGCL QVNSLTAADTAMYYCARPGYRSWSKTFDLWGQGTMVTV SS VL001 DIQMTQSPSSLSASVGDRVTITCRASQDISESLNWYQQKPG 24 KAPKLLIYAASSLQSGVPSRFSGSGSGTDYTLTISSLQPEDFA TYYCQQANSFPLTFGGGTKVEIK HCDR1 IYWMS 25 013 HCDR2 RIYGGSSDYTAYASWVNG 26 013 HCDR3 LNPSFSRSFDY 27 013 LCDR1013 RASQGIFSWLV 28 LCDR2013 GASTLQS 29 LCDR3013 QQGYSTPYT 30 VH013 EQSGGGAGGGLVKPGGSLELCCKASGFDFSIYWMSWVRQS 31 PGKGLEWIGRIYGGSSDYTAYASWVNGRFTLSRDIDQSTGC LQLNSLTAADTAMYYCVRLNPSFSRSFDYWGQGTLVTVSS VL013 DIQMTQSPSSVSASVGDRVTITCRASQGIFSWLVWYQQKPG 32 KAPELLMYGASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDF ATYYCQQGYSTPYTFGQGTKVEIK HCDR1 SYAMS 33 014 HCDR2 RISDGGGTIYYTDSVKG 34 014 HCDR3 HRLYDSIGAYAMDV 35 014 LCDR1014 RASQSISSYLN 36 LCDR2014 DASNLET 37 LCDR3014 QQANSFPLT 38 VH014 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQA 39 PGKGLEWVSRISDGGGTIYYTDSVKGRFTIARDNSKNTLYL EMKSLRAEDTAVYYCAKHRLYDSIGAYAMDVWGQGTTV AVSS VL014 DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPG 40 KAPKLLIYDASNLETGVPSRFSGSGSGTDFTLTISSLQPEDFA TYYCQQANSFPLTFGPGTKVDIK HCDR1 YWMT 41 018 HCDR2 CIHGGDSGATYYANWVNG 42 018 HCDR3 PGYPSWSKTFDL 43 018 LCDR1018 QASQDISNALN 44 LCDR2018 AASTLQS 45 LCDR3018 QHSNSFPLT 46 VH018 QQLEQSGGGLVTPGGSLKVCCKASGFDFTTYWMTWVRQA 47 PEKGLEWIGCIHGGDSGATYYANWVNGRFTLSRDIDQSTG CLQLNSLTAADTAMYYCARPGYPSWSKTFDLWGQGTMVT VSS VL018 DIQMTQSPSSLSASVGDRVTITCQASQDISNALNWYQQKPG 48 KAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFA TYYCQHSNSFPLTFGGGTKVEIK HCDR1 YWMT 49 230 HCDR2 CIHGGGSGTTSYASWVNG 50 230 HCDR3 PGYRSWSKTFDL 51 230 LCDR1230 QANQDISNALN 52 LCDR2230 AASSLQS 53 LCDR3230 QQAASFPLT 54 VH230 QQLEQSGGGLVKPGGSLELCCIASGFDFSTYWMTWVRQAP 55 GKGLEWIGCIHGGGSGTTSYASWVNGRFTLSRDIDQSTGCL QLTSLTAADTAMYYCARPGYRSWSKTFDLWGQGTMVTVS S VL230 DIQMTQSPSSLSASVGDRVTITCQANQDISNALNWYQQKPG 56 KAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFA AYYCQQAASFPLTFGGGTKVEIK HCDR1 SYAMS 57 296 HCDR2 AIGIGGGGTYYADSVKG 58 296 HCDR3 GASFDFINFFPY 59 296 LCDR1296 RASQGISNDLA 60 LCDR2296 AASSLQS 61 LCDR3296 QQTYSTPLT 62 VH296 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQA 63 PGKGLEWVSAIGIGGGGTYYADSVKGRFTISRDNSKNTLYL QMNSLRAEDTAVYHCAKGASFDFINFFPYWGQGTLVTVSS VL296 DIQMTQSPSSLSASVGDRVTITCRASQGISNDLAWYQQKPG 64 KAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFA TYYCQQTYSTPLTFGGGTKVEIK HCDR1 DYAMS 65 320 HCDR2 YNSFSVGSTDYADSVKG 66 320 HCDR3 HSGNYYTGPFHY 67 320 LCDR1320 RASQGISSYLA 68 LCDR2320 AASSLES 69 LCDR3320 QQSYSTPIT 70 VH320 EVQLLESGGGLVQPGGSLRLSCATSGFTFSDYAMSWVRQA 71 PGKGLEWVSYNSFSVGSTDYADSVKGRFTISRDNSKNTLYL QMNSLRAEDTAVYYCSKHSGNYYTGPFHYWGQGTLVTVS S VL320 DIQLTQSPSFLSASVGDRVTITCRASQGISSYLAWYQQKPGK 72 APKLLIYAASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFAT YYCQQSYSTPITFGQGTRLEIK HCDR1 TFWMT 73 395 HCDR2 CIHGGSGSRDYASWVNG 74 395 HCDR3 PGYRSWSKTFDL 75 395 LCDR1395 RASQDISGALN 76 LCDR2395 AASSLQS 77 LCDR3395 QQANSFPLT 78 VH395 QEQLEQSGGGLVTPGGSLKLCCTASGFDFNTFWMTWVRQ 79 APGKGLEWIGCIHGGSGSRDYASWVNGRFTLSRDIDQSTAC LQVNSLTAADTAMYYCARPGYRSWSKTFDLWGQGTMVT VSS VL395 DIQMTQSPSSLSASVGDRVTITCRASQDISGALNWYQQKPG 80 KAPNLLIYAASSLQSGVPSRFSGSGSGTDYTLTISSLQPEDFA TYYCQQANSFPLTFGGGTKVEIK Untargeted EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQA 81 VH PGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYL QMNSLRAEDTAVYYCAKGSGFDYWGQGTLVTVSS Untargeted EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPG 82 VL QAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFA VYYCQQYGSSPLTFGQGTKVEIK Human RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQW 83 kappaCL KVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKH domain KVYACEVTHQGLSSPVTKSFNRGEC Human QPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAW 84 lambdaCL KADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSH domain RSYSCQVTHEGSTVEKTVAPTECS Human ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW 85 IgG1heavy NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC chain NVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVF constant LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG region VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK (CH1CH2CH3) CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS FFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL SP hIgG1Fc DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV 86 region VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG QPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWE SNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSP huNKG2D MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRC 87 PVVKSKCRENASPFFFCCFIAVAMGIRFIIMVAIWSAVFLNS LFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYE SQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPT NGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENC STPNTYICMQRTV huNKG2D NSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNW 88 ECD YESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVH IPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIE NCSTPNTYICMQRTV cyNKG2D MGWIRGRRPRHNLEMSEFHNYKLGLAKSDFSTRCQKQRCP 89 VIKSKCRENASPLFFCCFIAVAMGIRFIIMVTIWSAVFLNSLF NQEVQIPLTESYCGPCPKNWICYKNNCYQFFNESKNWYES QASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPT NGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENC SIPNTYICMQRTV cyNKG2D NSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFNESKNW 90 ECD YESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVH IPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIE NCSIPNTYICMQRTV muNKG2D MALIRDRKSHHSEMSKCHNYDLKPAKWDTSQEQQKQRLA 91 LTTSQPGENGIIRGRYPIEKLKISPMFVVRVLAIALAIRFTLN TLMWLAIFKETFQPVLCNKEVPVSSREGYCGPCPNNWICHR NNCYQFFNEEKTWNQSQASCLSQNSSLLKIYSKEEQDFLKL VKSYHWMGLVQIPANGSWQWEDGSSLSYNQLTLVEIPKGS CAVYGSSFKAYTEDCANLNTYICMKRAV muNKG2D NKEVPVSSREGYCGPCPNNWICHRNNCYQFFNEEKTWNQS 92 ECD QASCLSQNSSLLKIYSKEEQDFLKLVKSYHWMGLVQIPANG SWQWEDGSSLSYNQLTLVEIPKGSCAVYGSSFKAYTEDCA NLNTYICMKRAV hisavi HHHHHHGSGLNDIFEAQKIEWHEGGGGSNSLFNQEVQIPLT 93 huNKG2D ESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQN ECD ASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWED GSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQ RTV mono GLNDIFEAQKIEWHEDKTHTCPPCPAPELLGGPSVFLFPPKP 94 huNKG2D KDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN ECDFckh AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN avi KALPAPIEKTISKAKGQPREPQVYTLPPCRDELTKNQVSLW (knob) CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGG GGGSGGGGSNSLFNQEVQIPLTESYCGPCPKNWICYKNNCY QFFDESKNVVYESQASCMSQNASLLKVYSKEDQDLLKLVKS YHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCAL YASSFKGYIENCSTPNTYICMQRTV mono DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV 95 huNKG2D VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR ECDFckh VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG avi QPREPQVCTLPPSRDELTKNQVSLSCAVKGFYPSDIAVEWE (hole) SNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNV FSCSVMHEALHNRFTQKSLSLSPGK di GLNDIFEAQKIEWHEDKTHTCPPCPAPELLGGPSVFLFPPKP 96 huNKG2D KDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN ECDFcavi AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN KALGAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGG GGGSGGGGSNSLFNQEVQIPLTESYCGPCPKNWICYKNNCY QFFDESKNVVYESQASCMSQNASLLKVYSKEDQDLLKLVKS YHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCAL YASSFKGYIENCSTPNTYICMQRTV di GLNDIFEAQKIEWHEDKTHTCPPCPAPELLGGPSVFLFPPKP 97 cyNKG2D KDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN ECDFcavi AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN KALGAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGG GGGSGGGGSNSLFNQEVQIPLTESYCGPCPKNWICYKNNCY QFFNESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKS YHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCAL YASSFKGYIENCSIPNTYICMQRTV di GLNDIFEAQKIEWHEDKTHTCPPCPAPELLGGPSVFLFPPKP 98 muNKG2D KDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN ECDFcavi AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN KALGAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGG GGGSGGGGSNKEVPVSSREGYCGPCPNNWICHRNNCYQFF NEEKTWNQSQASCLSQNSSLLKIYSKEEQDFLKLVKSYHW MGLVQIPANGSWQWEDGSSLSYNQLTLVEIPKGSCAVYGS SFKAYTEDCANLNTYICMKRAV di DGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDIS 99 huNKG2D KDAPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPI ECDmu MHQDWLNGKEFKCRVNSAAFGAPIEKTISKTKGRPKAPQV IgG1Fc YTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAE NYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLH EGLHNHHTEKSLSHSPGGGGGSGGGGSGGGGSNSLFNQEV QIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASC MSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSW QWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNT YICMQRTV ECDFL AEPHSLRYNLMVLSQDESVQSGFLAEGHLDGQPFLRYDRQ 100 MICBFc KRRAKPQGQWAEDVLGAKTWDTETEDLTENGQDLRRTLT avi HIKDQKGGLHSLQEIRVCEIHEDSSTRGSRHFYYDGELFLSQ (knob) NLETQESTVPQSSRAQTLAMNVTNFWKEDAMKTKTHYRA MQADCLQKLQRYLKSGVAIRRTVPPMVNVTSSEVSEGNIT VTCRASSFYPRNITLTWRQDGVSLSHNTQQWGDVLPDGNG TYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPSGKVLV LQSQRTVDASGGSPTPPTPGGGSADKTHTCPPCPAPEAAGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGK EYKCKVSNKALGAPIEKTISKAKGQPREPQVYTLPPCRDEL TKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT QKSLSLSPGKSGGLNDIFEAQKIEWHE ECDFL DKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCV 101 MICBFc VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR avi VVSVLTVLHQDWLNGKEYKCKVSNKALGAPIEKTISKAKG (hole) QPREPQVCTLPPSRDELTKNQVSLSCAVKGFYPSDIAVEWE SNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNV FSCSVMHEALHNRFTQKSLSLSPGK HCDR1 TFWMT 73 (395, P1AE4972, P1AE4973, P1AE4975, P1AE4977, P1AE4978, P1AE4979, P1AE4980, P1AE4981) HCDR2 SIHGGSGSRDYASWVNG 102 (P1AE4972) HCDR2 SIHGGSGSRDYADSVKG 103 (P1AE4973, P1AE4975, P1AE4977, P1AE4978, P1AE4979) HCDR2 SIHGGSGSRDYSPSFQG 104 (P1AE4980) HCDR2 SIHGGSGSRDYNPSLKS 105 (P1AE4981) HCDR3 PGYRSWSKTFDL 75 (395, P1AE4972, P1AE4973, P1AE4975, P1AE4977, P1AE4978, P1AE4979, P1AE4980, P1AE4981) VH QEQLEQSGGGLVTPGGSLKLCCTASGFDFNTFWMTWVRQ 106 395(C50S)= APGKGLEWIGSIHGGSGSRDYASWVNGRFTLSRDIDQSTAC P1AE4972 LQVNSLTAADTAMYYCARPGYRSWSKTFDLWGQGTMVT VSS Hu395 EVQLLESGGGLVQPGGSLRLSCAASGFDFNTFWMTWVRQ 107 P1AE4973 APGKGLEWVGSIHGGSGSRDYADSVKGRFTISRDNSKNTL VHYLQMNSLRAEDTAVYYCARPGYRSWSKTFDLWGQGTTVT VSS Hu395 EVQLLESGGGLVQPGGSLRLSCAASGFDFNTFWMTWVRQ 108 P1AE4975 APGKGLEWVGSIHGGSGSRDYADSVKGRFTISRDNSKNTA VH YLQMNSLRAEDTAVYYCARPGYRSWSKTFDLWGQGTTVT VSS Hu395 EVQLLESGGGLVQPGGSLRLSCAASGFDFNTFWMTWVRQ 109 P1AE4977 APGKGLEWVGSIHGGSGSRDYADSVKGRFTISRDIDQSTAY VH LQMNSLRAEDTAVYYCARPGYRSWSKTFDLWGQGTTVTV SS Hu395 EVQLVESGGGLVQPGGSLRLSCAASGFDFNTFWMTWVRQ 110 P1AE4978 APGKGLEWVGSIHGGSGSRDYADSVKGRFTISADIDQSTAY VH LQMNSLRAEDTAVYYCARPGYRSWSKTFDLWGQGTTVTV SS Hu395 QEQLLESGGGLVQPGGSLRLSCAASGFDFNTFWMTWVRQ 111 P1AE4979 APGKGLEWVGSIHGGSGSRDYADSVKGRFTISRDIDQSTAY VH LQMNSLRAEDTAVYYCARPGYRSWSKTFDLWGQGTTVTV SS Hu395 QEQLVQSGAEVKKPGESLKISCKGSGFDFNTFWMTWVRQ 112 P1AE4980 MPGKGLEWMGSIHGGSGSRDYSPSFQGQVTISADIDQSTAY VH LQWSSLKASDTAMYYCARPGYRSWSKTFDLWGQGTTVTV SS Hu395 QEQLQESGPGLVKPSETLSLTCTVSGFDFNTFWMTWIRQPP 113 P1AE4981 GKGLEWIGSIHGGSGSRDYNPSLKSRVTISVDIDQNQFSLKL VH SSVTAADTAVYYCARPGYRSWSKTFDLWGQGTTVTVSS B9HCDR1 SYWMH 114 B9HCDR2 FIRNKANGGTTEYAASVKG 115 B9HCDR3 DRGLRFYFDY 116 B9LCDR1 TLRRGINVGAYSIY 117 B9LCDR2 YKSDSDKQQGS 118 B9LCDR3 MIWHSGASAV 119 B9VH VQLVESGGGLVQPGRSLRLSCAASGFTVSSYWMHWVRQA 120 PGKGLEWVGFIRNKANGGTTEYAASVKGRFTISRDDSKNT LYLQMNSLRAEDTAVYYCARDRGLRFYFDYWGQGTTVTV SS B9VL QAVLTQPASLSASPGASASLTCTLRRGINVGAYSIYWYQQK 121 PGSPPQYLLRYKSDSDKQQGSGVSSRFSASKDASANAGILLI SGLQSEDEADYYCMIWHSGASAVFGGGTKLTVL huA5B7 DYYMN 122 HCDR1 huA5B7 FIGNKANAYTTEYSASVKG 123 HCDR2 huA5B7 DRGLRFYFDY 124 HCDR3 huA5B7 RASSSVTYIH 125 LCDR1 huA5B7 ATSNLAS 126 LCDR2 huA5B7 QHWSSKPPT 127 LCDR3 huA5B7 EVQLLESGGGLVQPGGSLRLSCAASGFTFTDYYMNWVRQA 128 VH PGKGLEWLGFIGNKANAYTTEYSASVKGRFTISRDKSKNTL YLQMNSLRAEDTATYYCTRDRGLRFYFDYWGQGTTVTVS S huA5B7 EIVLTQSPATLSLSPGERATLSCRASSSVTYIHWYQQKPGQA 129 VL PRSWIYATSNLASGIPARFSGSGSGTDFTLTISSLEPEDFAVY YCQHWSSKPPTFGQGTKLEIK CD3 TYAMN 130 HCDR1 CD3 RIRSKYNNYATYYADSVKG 131 HCDR2 CD3 HGNFGNSYVSWFAY 132 HCDR3 CD3 GSSTGAVTTSNYAN 133 LCDR1 CD3 GTNKRAP 134 LCDR2 CD3 ALWYSNLWV 135 LCDR3 CD3VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSTYAMNWVRQA 136 PGKGLEWVSRIRSKYNNYATYYADSVKGRFTISRDDSKNT LYLQMNSLRAEDTAVYYCVRHGNFGNSYVSWFAYWGQG TLVTVSS CD3VL QAVVTQEPSLTVSPGGTVTLTCGSSTGAVTTSNYANWVQE 137 KPGQAFRGLIGGTNKRAPGTPARFSGSLLGGKAALTLSGAQ PEDEAEYYCALWYSNLWVFGGGTKLTVL CEA EFGMN 138 HCDR1 CEA WINTKTGEATYVEEFKG 139 HCDR2 CEA WDFAYYVEAMDY 140 HCDR3 CEA KASAAVGTYVA 141 LCDR1 CEA SASYRKR 142 LCDR2 CEA HQYYTYPLFT 143 LCDR3 CEAVH QVQLVQSGAEVKKPGASVKVSCKASGYTFTEFGMNWVRQ 144 APGQGLEWMGWINTKTGEATYVEEFKGRVTFTTDTSTSTA YMELRSLRSDDTAVYYCARWDFAYYVEAMDYWGQGTTV TVSS CEAVL DIQMTQSPSSLSASVGDRVTITCKASAAVGTYVAWYQQKP 145 GKAPKLLIYSASYRKRGVPSRFSGSGSGTDFTLTISSLQPEDF ATYYCHQYYTYPLFTFGQGTKLEIK CEA(2) DTYMH 146 HCDR1 CEA(2) RIDPANGNSKYVPKFQG 147 HCDR2 CEA(2) FGYYVSDYAMAY 148 HCDR3 CEA(2) RAGESVDIFGVGFLH 149 LCDR1 CEA(2) RASNRAT 150 LCDR2 CEA(2) QQTNEDPYT 151 LCDR3 CEA(2) QVQLVQSGAEVKKPGSSVKVSCKASGFNIKDTYMHWVRQ 152 VH APGQGLEWMGRIDPANGNSKYVPKFQGRVTITADTSTSTA YMELSSLRSEDTAVYYCAPFGYYVSDYAMAYWGQGTLVT VSS CEA(2) EIVLTQSPATLSLSPGERATLSCRAGESVDIFGVGFLHWYQQ 153 VL KPGQAPRLLIYRASNRATGIPARFSGSGSGTDFTLTISSLEPE DFAVYYCQQTNEDPYTFGQGTKLEIK CEA-TCB QVQLVQSGAEVKKPGASVKVSCKASGYTFTEFGMNWVRQ 154 HC1 APGQGLEWMGWINTKTGEATYVEEFKGRVTFTTDTSTSTA YMELRSLRSDDTAVYYCARWDFAYYVEAMDYWGQGTTV TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVT VSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ TYICNVNHKPSNTKVDKKVEPKSCDGGGGSGGGGSEVQLL ESGGGLVQPGGSLRLSCAASGFTFSTYAMNWVRQAPGKGL EWVSRIRSKYNNYATYYADSVKGRFTISRDDSKNTLYLQM NSLRAEDTAVYYCVRHGNFGNSYVSWFAYWGQGTLVTVS SASVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQ WKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYE KHKVYACEVTHQGLSSPVTKSFNRGECDKTHTCPPCPAPEA AGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKALGAPIEKTISKAKGQPREPQVYTLPPC RDELTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTT PPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHN HYTQKSLSLSPGK CEA-TCB QVQLVQSGAEVKKPGASVKVSCKASGYTFTEFGMNWVRQ 155 HC2 APGQGLEWMGWINTKTGEATYVEEFKGRVTFTTDTSTSTA YMELRSLRSDDTAVYYCARWDFAYYVEAMDYWGQGTTV TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVT VSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ TYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAG GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG KEYKCKVSNKALGAPIEKTISKAKGQPREPQVCTLPPSRDE LTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVL DSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNHYT QKSLSLSPGK CEA-TCB QAVVTQEPSLTVSPGGTVTLTCGSSTGAVTTSNYANWVQE 156 LC1 KPGQAFRGLIGGTNKRAPGTPARFSGSLLGGKAALTLSGAQ PEDEAEYYCALWYSNLWVFGGGTKLTVLSSASTKGPSVFP LAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVH TFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK VDKKVEPKSC CEA-TCB DIQMTQSPSSLSASVGDRVTITCKASAAVGTYVAWYQQKP 157 LC2 GKAPKLLIYSASYRKRGVPSRFSGSGSGTDFTLTISSLQPEDF ATYYCHQYYTYPLFTFGQGTKLEIKRTVAAPSVFIFPPSDEQ LKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVT EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPV TKSFNRGEC CEA-TCB QVQLVQSGAEVKKPGSSVKVSCKASGFNIKDTYMHWVRQ 158 (2)HC1 APGQGLEWMGRIDPANGNSKYVPKFQGRVTITADTSTSTA YMELSSLRSEDTAVYYCAPFGYYVSDYAMAYWGQGTLVT VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVEDYFPEPVTV SWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT YICNVNHKPSNTKVDEKVEPKSCDGGGGSGGGGSQAVVTQ EPSLTVSPGGTVTLTCGSSTGAVTTSNYANWVQEKPGQAF RGLIGGTNKRAPGTPARFSGSLLGGKAALTLSGAQPEDEAE YYCALWYSNLWVFGGGTKLTVLSSASTKGPSVFPLAPSSKS TSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKV EPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTP EVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALGAPIEKTI SKAKGQPREPQVYTLPPCRDELTKNQVSLWCLVKGFYPSDI AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSP CEA-TCB QVQLVQSGAEVKKPGSSVKVSCKASGFNIKDTYMHWVRQ 159 (2)HC2 APGQGLEWMGRIDPANGNSKYVPKFQGRVTITADTSTSTA YMELSSLRSEDTAVYYCAPFGYYVSDYAMAYWGQGTLVT VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVEDYFPEPVTV SWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT YICNVNHKPSNTKVDEKVEPKSCDKTHTCPPCPAPEAAGGP SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKE YKCKVSNKALGAPIEKTISKAKGQPREPQVCTLPPSRDELT KNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS DGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQK SLSLSP CEA-TCB EVQLLESGGGLVQPGGSLRLSCAASGFTFSTYAMNWVRQA 160 (2)LC1 PGKGLEWVSRIRSKYNNYATYYADSVKGRFTISRDDSKNT LYLQMNSLRAEDTAVYYCVRHGNFGNSYVSWFAYWGQG TLVTVSSASVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPR EAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLS KADYEKHKVYACEVTHQGLSSPVTKSFNRGEC CEA-TCB EIVLTQSPATLSLSPGERATLSCRAGESVDIFGVGFLHWYQQ 161 (2)LC2 KPGQAPRLLIYRASNRATGIPARFSGSGSGTDFTLTISSLEPE DFAVYYCQQTNEDPYTFGQGTKLEIKRTVAAPSVFIFPPSDR KLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQES VTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSS PVTKSFNRGEC A5B7 FIGNKANGYTTEYSASVKG 162 HCDR2 A5B7VH EVKLVESGGGLVQPGGSLRLSCATSGFTFTDYYMNWVRQP 163 PGKALEWLGFIGNKANGYTTEYSASVKGRFTISRDKSQSIL YLQMNTLRAEDSATYYCTRDRGLRFYFDYWGQGTTLTVSS A5B7VL QTVLSQSPAILSASPGEKVTMTCRASSSVTYIHWYQQKPGS 164 SPKSWIYATSNLASGVPARFSGSGSGTSYSLTISRVEAEDAA TYYCQHWSSKPPTFGGGTKLEIK HCDR1 DYXMN,wherein 165 consensus XisYorAorE HCDR1 DYAMN 166 HCDR1 DYEMN 167 HCDR2 X.sub.1IX.sub.2NKANAYTTEYSASVKG,wherein 168 consensus X.sub.1isForV, X.sub.2isGorS HCDR2 VISNKANAYTTEYSASVKG 169 HCDR2 FISNKANAYTTEYSASVKG 170 HCDR3 DRGX.sub.1RFX.sub.2FDY,wherein 171 consensus X.sub.1isLorI, X.sub.2isYorGorQorS HCDR3 DRGIRFGFDY 172 HCDR3 DRGLRFSFDY 173 HCDR3 DRGIRFYFDY 174 HCDR3 DRGIRFYFDY 175 HCDR3 DRGIRFSFDY 176 LCDR1 XASSSVTYIH,wherein 177 consensus XisRorH LCDR1 HASSSVTYIH 178 LCDR3 QHWSSX.sub.1X.sub.2PT,wherein 179 consensus X.sub.1isKorVorQorI, X.sub.2isPorS LCDR3 QHWSSVPPT 180 LCDR3 QHWSSQPPT 181 LCDR3 QHWSSISPT 182 LCDR3 QHWSSKSPT 183 P006.038 EVQLLESGGGLVQPGGSLRLSCAASGFTFTDYYMNWVRQA 184 VH PGKGLEWLGFIGNKANAYTTEYSASVKGRFTISRDKSKNTL YLQMNSLRAEDTATYYCTRDRGIRFGFDYWGQGTTVTVSS P006.038 EIVLTQSPATLSLSPGERATLSCRASSSVTYIHWYQQKPGQA 185 VL PRSWIYATSNLASGIPARFSGSGSGTDFTLTISSLEPEDFAVY YCQHWSSVPPTFGQGTKLEIK P005.097 EVQLLESGGGLVQPGGSLRLSCAASGFTFTDYYMNWVRQA 186 VH PGKGLEWLGFIGNKANAYTTEYSASVKGRFTISRDKSKNTL YLQMNSLRAEDTATYYCTRDRGLRFSFDYWGQGTTVTVSS P005.097 EIVLTQSPATLSLSPGERATLSCRASSSVTYIHWYQQKPGQA 187 VL PRSWIYATSNLASGIPARFSGSGSGTDFTLTISSLEPEDFAVY YCQHWSSQPPTFGQGTKLEIK P005.103 EVQLLESGGGLVQPGGSLRLSCAASGFTFTDYYMNWVRQA 188 VH PGKGLEWLGFIGNKANAYTTEYSASVKGRFTISRDKSKNTL YLQMNSLRAEDTATYYCTRDRGIRFYFDYWGQGTTVTVSS P005.103 EIVLTQSPATLSLSPGERATLSCRASSSVTYIHWYQQKPGQA 189 VL PRSWIYATSNLASGIPARFSGSGSGTDFTLTISSLEPEDFAVY YCQHWSSISPTFGQGTKLEIK P002.139 EVQLLESGGGLVQPGGSLRLSCAASGFYFTDYAMNWVRQ 190 VH APGKGLEWLGVISNKANAYTTEYSASVKGRFTISRDKSKNT LYLQMNSLRAEDTATYYCTRDRGLRFYFDYWGQGTTVTV SS P002.139 EIVLTQSPATLSLSPGERATLSCHASSSVTYIHWYQQKPGQA 191 VL PRSWIYATSNLASGIPARFSGSGSGTDFTLTISSLEPEDFAVY YCQHWSSKPPTFGQGTKLEIK P001.177 EVQLLESGGGLVQPGGSLRLSCAASGFYFTDYYMNWVRQ 192 VH APGKGLEWLGFISNKANAYTTEYSASVKGRFTISRDKSKNT LYLQMNSLRAEDTATYYCTRDRGLRFYFDYWGQGTTVTV SS P001.177 EIVLTQSPATLSLSPGERATLSCRASSSVTYIHWYQQKPGQA 193 VL PRSWIYATSNLASGIPARFSGSGSGTDFTLTISSLEPEDFAVY YCQHWSSKPPTFGQGTKLEIK P005.102 EVQLLESGGGLVQPGGSLRLSCAASGFTFTDYYMNWVRQA 194 VH PGKGLEWLGFIGNKANAYTTEYSASVKGRFTISRDKSKNTL YLQMNSLRAEDTATYYCTRDRGIRFQFDYWGQGTTVTVSS P005.102 EIVLTQSPATLSLSPGERATLSCRASSSVTYIHWYQQKPGQA 195 VL PRSWIYATSNLASGIPARFSGSGSGTDFTLTISSLEPEDFAVY YCQHWSSKSPTFGQGTKLEIK P005.102- EVQLLESGGGLVQPGGSLRLSCAASGFYFTDYYMNWVRQ 196 combo1VH APGKGLEWLGVISNKANAYTTEYSASVKGRFTISRDKSKNT LYLQMNSLRAEDTATYYCTRDRGIRFQFDYWGQGTTVTVS S P005.102- EIVLTQSPATLSLSPGERATLSCRASSSVTYIHWYQQKPGQA 197 combo1VL PRSWIYATSNLASGIPARFSGSGSGTDFTLTISSLEPEDFAVY YCQHWSSKSPTFGQGTKLEIK P005.102- EVQLLESGGGLVQPGGSLRLSCAASGFYFSDYYMNWVRQ 198 combo2VH APGKGLEWLGVISNKANAYTTEYSASVKGRFTISRDKSKNT LYLQMNSLRAEDTATYYCTRDRGIRFQFDYWGQGTTVTVS S P005.102- EIVLTQSPATLSLSPGERATLSCRASSSVTYIHWYQQKPGQA 199 combo2VL PRSWIYATSNLASGIPARFSGSGSGTDFTLTISSLEPEDFAVY YCQHWSSKSPTFGQGTKLEIK P005.103- EVQLLESGGGLVQPGGSLRLSCAASGFTFTDYYMNWVRQA 200 combo1VH PGKGLEWLGFIGNKANAYTTEYSASVKGRFTISRDKSKNTL YLQMNSLRAEDTATYYCTRDRGIRFSFDYWGQGTTVTVSS P005.103- EIVLTQSPATLSLSPGERATLSCRASSSVTYIHWYQQKPGQA 201 combo1VL PRSWIYATSNLASGIPARFSGSGSGTDFTLTISSLEPEDFAVY YCQHWSSISPTFGQGTKLEIK P005.103- EVQLLESGGGLVQPGGSLRLSCAASGFYFTDYYMNWVRQ 202 combo2VH APGKGLEWLGVISNKANAYTTEYSASVKGRFTISRDKSKNT LYLQMNSLRAEDTATYYCTRDRGIRFSFDYWGQGTTVTVS S P005.103- EIVLTQSPATLSLSPGERATLSCRASSSVTYIHWYQQKPGQA 203 combo2VL PRSWIYATSNLASGIPARFSGSGSGTDFTLTISSLEPEDFAVY YCQHWSSISPTFGQGTKLEIK P006.038- EVQLLESGGGLVQPGGSLRLSCAASGFYFTDYAMNWVRQ 204 combo1VH APGKGLEWLGVISNKANAYTTEYSASVKGRFTISRDKSKNT LYLQMNSLRAEDTATYYCTRDRGIRFGFDYWGQGTTVTVS S P006.038- EIVLTQSPATLSLSPGERATLSCRASSSVTYIHWYQQKPGQA 205 combo1VL PRSWIYATSNLASGIPARFSGSGSGTDFTLTISSLEPEDFAVY YCQHWSSVPPTFGQGTKLEIK P006.038- EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYEMNWVRQA 206 combo2VH PGKGLEWLGFISNKANAYTTEYSASVKGRFTISRDKSKNTL YLQMNSLRAEDTATYYCTRDRGIRFGFDYWGQGTTVTVSS P006.038- EIVLTQSPATLSLSPGERATLSCRASSSVTYIHWYQQKPGQA 207 combo2VL PRSWIYATSNLASGIPARFSGSGSGTDFTLTISSLEPEDFAVY YCQHWSSVPPTFGQGTKLEIK hu QLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKGERVD 208 N(A2B2)A- GNRQIVGYAIGTQQATPGPANSGRETIYPNASLLIQNVTQN avi-His DTGFYTLQVIKSDLVNEEATGQFHVYPELPKPFITSNNSNPV EDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDN RTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPD DPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQH TQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSALSP VVAKPQIKASKTTVTGDKDSVNLTCSTNDTGISIRWFFKNQ SLPSSERMKLSQGNITLSINPVKREDAGTYWCEVFNPISKNQ SDPIMLNVNYNALPQENLINVDGSGLNDIFEAQKIEWHEAR AHHHHHH NKG2D DIQMTQSPSSLSASVGDRTITCRASQDISGALNWYQQKPG 209 (P1AE4980) KAPNLLIYAASSLQSGVPSRFSGSGSGTDYTLTISSLQPEDFA VL-CH1- TYYCQQANSFPLTFGGGTKVEIKASTKGPSVFPLAPSSKSTS Fc(knob, GGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS PGLALA) SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP KSDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEV TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALGAPIEKTISK AKGQPREPQVYTLPPCRDELTKNQVSLWCLVKGFYPSDIA VEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ QGNVFSCSVMHEALHNHYTQKSLSLSP CEA EVQLLESGGGLVQPGGSLRLSCAASGFTFIDYYMNWVRQA 210 (huA5B7) PGKGLEWLGFIGNKANAYTTEYSASVKGRFTISRDKSKNTL VH-CH1- YLQMNSLRAEDTATYYCTRDRGLRFYFDYWGQGTTVTVS Fc(hole, SASTKGPSVFPLAPSSKSTSGGTAALGCLVEDYFPEPVTVS PGLALA) WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYI CNVNHKPSNTKVDEKVEPKSCDKTHTCPPCPAPEAAGGPS VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEY KCKVSNKALGAPIEKTISKAKGQPREPQVCTLPPSRDELTK NQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSL SLSP NKG2D QEQLVQSGAEVKKPGESLKISCKGSGFDFNTFWMTWVRQ 211 (P1AE4980) MPGKGLEWMGSIHGGSGSRDYSPSFQGQVTISADIDQSTAY VH-CL LQWSSLKASDTAMYYCARPGYRSWSKTFDLWGQGTTVTV SSASVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQ WKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYE KHKVYACEVTHQGLSSPVTKSFNRGEC CEA EIVLTQSPATLSLSPGERATLSCRASSSVTYIHWYQQKPGQA 212 (huA5B7) PRSWIYATSNLASGIPARFSGSGSGTDFTLTISSLEPEDFAVY VL-CL YCQHWSSKPPTFGQGTKLEIKRTVAAPSVFIFPPSDRKLKSG TASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDS KDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSF NRGEC NKG2D QEQLVQSGAEVKKPGESLKISCKGSGFDFNTFWMTWVRQ 213 (P1AE4980) MPGKGLEWMGSIHGGSGSRDYSPSFQGQVTISADIDQSTAY VH-CH1- LQWSSLKASDTAMYYCARPGYRSWSKTFDLWGQGTTVTV Fc(knob, SSASTKGPSVFPLAPSSKSTSGGTAALGCLVEDYFPEPVTVS PGLALA) WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYI CNVNHKPSNTKVDEKVEPKSCDKTHTCPPCPAPEAAGGPS VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEY KCKVSNKALGAPIEKTISKAKGQPREPQVYTLPPCRDELTK NQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQK SLSLSP CEA EIVLTQSPATLSLSPGERATLSCRASSSVTYIHWYQQKPGQA 214 (P001.177) PRSWIYATSNLASGIPARFSGSGSGTDFTLTISSLEPEDFAVY VL-CH1- YCQHWSSKPPTFGQGTKLEIKSSASTKGPSVFPLAPSSKSTS Fc(hole, GGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS PGLALA) SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP KSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEV TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALGAPIEKTISK AKGQPREPQVCTLPPSRDELTKNQVSLSCAVKGFYPSDIAV EWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSP NKG2D DIQMTQSPSSLSASVGDRVTITCRASQDISGALNWYQQKPG 215 (P1AE4980) KAPNLLIYAASSLQSGVPSRFSGSGSGTDYTLTISSLQPEDFA VL-CL TYYCQQANSFPLTFGGGTKVEIKRTVAAPSVFIFPPSDRKLK SGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQ DSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTK SFNRGEC CEA EVQLLESGGGLVQPGGSLRLSCAASGFYFTDYYMNWVRQ 216 (P001.177) APGKGLEWLGFISNKANAYTTEYSASVKGRFTISRDKSKNT VH-CL LYLQMNSLRAEDTATYYCTRDRGLRFYFDYWGQGTTVTV SSASVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQ WKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYE KHKVYACEVTHQGLSSPVTKSFNRGEC C26VH QVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIRQP 217 PGKGLEWIGEIDHSGSTNYNPSLKSRVTISVDTSKNQFSLKL SSVTAADTAVYYCARARGPWSFDPWGQGTLVTVSS C26VL DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPG 218 KAPKLLIYKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFA TYYCQQYGSFPITFGGGTKVEIK ADI27743 QVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIRQP 219 VH PGKGLEWIGEIDHSGSTNYNPSLKSRVTISVDTSKNQFSLKL SSVTAADTAVYYCARARGPWSFDPWGQGTLVTVSS ADI27743 DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPG 220 VL KAPKLLIYKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFA TYYCQQYNSYPTFGGGTKVEIK C26IgG QVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIRQP 221 (PGLALA) PGKGLEWIGEIDHSGSTNYNPSLKSRVTISVDTSKNQFSLKL HC SSVTAADTAVYYCARARGPWSFDPWGQGTLVTVSSASTK GPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNH KPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPP KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS NKALGAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK C26IgG DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPG 222 (PGLALA) KAPKLLIYKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFA LC TYYCQQYGSFPITFGGGTKVEIKRTVAAPSVFIFPPSDEQLK SGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQ DSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTK SFNRGEC ADI27743 QVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIRQP 223 IgG(PG PGKGLEWIGEIDHSGSTNYNPSLKSRVTISVDTSKNQFSLKL LALA)HC SSVTAADTAVYYCARARGPWSFDPWGQGTLVTVSSASTK GPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNH KPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPP KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS NKALGAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK ADI27743 DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPG 224 IgG(PG KAPKLLIYKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFA LALA)LC TYYCQQYNSYPTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKS GTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQ DSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTK SFNRGEC NKG2D DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPG 225 (C26)VL- KAPKLLIYKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFA CH1-Fc TYYCQQYGSFPITFGGGTKVEIKSSASTKGPSVFPLAPSSKST (hole, SGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ PGLALA) SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE PKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPE VTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCKVSNKALGAPIEKTIS KAKGQPREPQVCTLPPSRDELTKNQVSLSCAVKGFYPSDIA VEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQ QGNVFSCSVMHEALHNHYTQKSLSLSPGK NKG2D QVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIRQP 226 (C26)VH- PGKGLEWIGEIDHSGSTNYNPSLKSRVTISVDTSKNQFSLKL CL SSVTAADTAVYYCARARGPWSFDPWGQGTLVTVSSASVA APSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDN ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYA CEVTHQGLSSPVTKSFNRGEC NKG2D DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPG 227 (ADI27743) KAPKLLIYKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFA VL-CH1- TYYCQQYNSYPTFGGGTKVEIKSSASTKGPSVFPLAPSSKST Fc(hole, SGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ PGLALA) SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE PKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPE VTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCKVSNKALGAPIEKTIS KAKGQPREPQVCTLPPSRDELTKNQVSLSCAVKGFYPSDIA VEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQ QGNVFSCSVMHEALHNHYTQKSLSLSPGK NKG2D QVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIRQP 228 (ADI27743) PGKGLEWIGEIDHSGSTNYNPSLKSRVTISVDTSKNQFSLKL VH-CL SSVTAADTAVYYCARARGPWSFDPWGQGTLVTVSSASVA APSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDN ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYA CEVTHQGLSSPVTKSFNRGEC CEA EVQLLESGGGLVQPGGSLRLSCAASGFTFTDYYMNWVRQA 229 (huA5B7) PGKGLEWLGFIGNKANAYTTEYSASVKGRFTISRDKSKNTL VH-CHI- YLQMNSLRAEDTATYYCTRDRGLRFYFDYWGQGTTVTVS Fc(knob, SASTKGPSVFPLAPSSKSTSGGTAALGCLVEDYFPEPVTVS PGLALA) WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYI CNVNHKPSNTKVDEKVEPKSCDKTHTCPPCPAPEAAGGPS VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEY KCKVSNKALGAPIEKTISKAKGQPREPQVYTLPPCRDELTK NQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQK SLSLSPGK CEA EIVLTQSPATLSLSPGERATLSCRASSSVTYIHWYQQKPGQA 230 (huA5B7) PRSWIYATSNLASGIPARFSGSGSGTDFTLTISSLEPEDFAVY VL-CL YCQHWSSKPPTFGQGTKLEIKRTVAAPSVFIFPPSDRKLKSG TASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDS KDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSF NRGEC
IV. Examples
[0529] The following are examples of methods and compositions of the invention. It is understood that various other aspects may be practiced, given the general description provided above.
Example 1. General Methods and Tools
Recombinant DNA Techniques
[0530] Standard methods were used to manipulate DNA as described in Sambrook, J. et al, Molecular cloning: A laboratory manual; Cold Spring Harbor Laboratory press, Cold spring Harbor, N.Y. 1989. The molecular biological reagents were used according to the manufacturer's instructions. General information regarding the nucleotide sequences of human immunoglobulin light and heavy chains is given in: Kabat, E. A. et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Ed., NIH Publication No 91-3242.
DNA Sequencing
[0531] DNA sequences were determined by double strand sequencing.
Gene Synthesis
[0532] Desired gene segments, where required, were either generated by PCR using appropriate templates or were synthesized at Geneart AG (Regensburg, Germany) from synthetic oligonucleotides and PCR products by automated gene synthesis. The gene segments flanked by singular restriction endonuclease cleavage sites were cloned into standard cloning/sequencing vectors. The plasmid DNA was purified from transformed bacteria and concentration determined by UV spectroscopy. The DNA sequence of the subcloned gene fragments was confirmed by DNA sequencing. Gene segments were designed with suitable restriction sites to allow subcloning into the respective expression vectors. All constructs were designed with a 5-end DNA sequence coding for a leader peptide which targets proteins for secretion in eukaryotic cells.
Generation of NKG2D Receptors and MIC-B Ligand
[0533] Several constructs of NKG2D receptors as well as an MIC-B ligand were generated to be used as antigens for phage display, immunogen for protein immunization of transgenic rabbits, and as screening and characterization tools. The extracellular domain (ECD) of human NKG2D was cloned as 4 different constructs: 1. with N-terminal H6-avi-tags to form non-covalent dimers (his avi huNKG2D ECD) (SEQ ID NO: 93), 2. as a monovalent Fc-fusion to the C-terminus of an avi-tagged human IgG1 Fc-knob chain paired with an empty human IgG1 Fc-hole chain (mono huNKG2D ECD Fc kh avi) (SEQ ID NO: 94 and 95), 3. as a dimeric Fc-fusion to the C-terminus of an avi-tagged human IgG1 Fc dimerized by an intact hinge-region (di huNKG2D ECD Fc avi) (SEQ ID NO: 96), and 4. as a dimeric Fc-fusion to the C-terminus of a murine IgG1 Fc dimerized by an intact hinge-region (di huNKG2D ECD mu IgG1 Fc) (SEQ ID NO: 99). This murine Fc-fusion was used for increased immunogenicity in the transgenic rabbits. The ECDs of cynomolgus and murine NKG2D (di cyNKG2D ECD Fc avi and di muNKG2D ECD Fc avi respectively) were cloned in a similar fashion as the human dimeric Fc-fusion to the C-terminus of an avi-tagged human IgG1 Fc as outlined above (SEQ ID NOs 97 and 98, respectively). Moreover, the ECD of the NKG2D ligand MIC-B (ECD FL MIC-B Fc avi) was cloned as monovalent N-terminal fusion to a human IgG1 Fc-knob chain carrying a C-terminal avi-tag and paired with an empty human IgG1 Fc-hole chain (SEQ ID NOs 100 and 101). Above receptors and the MIC-B ligand are depicted in
Generation of NKG2D/DAP10 Expressing Cell Lines
[0534] Full-length cDNAs encoding human NKG2D and DAP10 were subcloned into mammalian expression vector. The plasmid was transfected into CHO-K1M (Roche) and 293T (ATCC, CRL-3216) cells using Lipofectamine LTX Reagent (Invitrogen, #15338100) according to the manufacturer's protocol. Stably transfected NKG2D/DAP10-positive CHO cells were maintained in CDM2 Opt.1.1 medium (GIBCO, #08-0059) supplemented with 10 nM L-Glutamine (Gibco, #25030081). 293T cells were maintained in DMEM (Gibco, #11965092) supplemented with 10% fetal bovine serum (Gibco, #16140063) and 1% GlutaMAX Supplement (Gibco; #31331-028). Two days after transfection, puromycin (Invivogen; #ant-pr-1) was added to 6 g/mL for CHO cells and to 1 g/mL for 293T cells. After initial selection, the cells with the highest cell surface expression of NKG2D were sorted by BD FACSAria III cell sorter (BD Biosciences) and cultured to establish stable cell clones. The expression level and stability was confirmed by FACS analysis using anti-NKG2D antibody KYK-2.0 (Kwong et al. (2008) J Mol Biol 384, 1143-1156) and PerCP-conjugated Fc gamma-specific goat anti-human IgG (Jackson ImmunoResearch, #109-126-097) as secondary antibody over a period of 4 weeks.
Example 2. Generation of Anti-NKG2D Antibodies by Phage Display
Generation of Generic Fab-Libraries
[0535] Two generic phage display antibody libraries in the Fab-format were generated on the basis of human germline genes. The libraries were randomized in CDR3 of the light chain (L3) and CDR3 of the heavy chain (H3) using randomized primers of different lengths spanning these CDRs and were assembled from 3 fragments by splicing by overlapping extension (SOE) PCR. After assembly of sufficient amounts of full length randomized Fab fragments, they were digested with NcoI/NheI alongside with similarly treated acceptor phagemid vector. Fab library inserts were ligated with phagemid vector and purified ligations were used for transformations into E. coli TG1. Phagemid particles displaying the Fab library were rescued using helperphage VCSM13 and purified by PEG/NaCl purification to be used for selections.
Selection of Anti-NKG2D Binders from Generic Fab Libraries by Phage Display
[0536] NKG2D binders were selected from the libraries against di muNKG2D ECD Fc avi (SEQ ID NO: 98) and di huNKG2D ECD Fc avi (SEQ ID NO: 96), or di huNKG2D ECD Fc avi (SEQ ID NO: 96) and his avi huNKG2D ECD (SEQ ID NO: 93), in an alternating fashion over 4 panning rounds.
[0537] Specific binders were identified by ELISA as follows: 100 l of 50 nM biotinylated di huNKG2D ECD Fc avi (SEQ ID NO: 96) or his avi huNKG2D ECD (SEQ ID NO: 93) were coated on neutravidin plates. Fab-containing bacterial supernatants were added and binding Fabs were detected via their Flag-tags by using an anti-Flag/HRP secondary antibody. Clones exhibiting significant signals over background, like clone 5C5 and clone 13C6, were short-listed for sequencing and further analyses.
Purification of Fabs
[0538] Fabs from bacterial cultures were purified for the determination of the kinetic parameters. For each clone, a 500 ml culture was inoculated with bacteria harboring the corresponding phagemid and induced with 1 mM IPTG at an OD.sub.600 0.9. Afterwards, the cultures were incubated at 25 C. overnight and harvested by centrifugation. After the incubation of the resuspended pellet for 20 min in 25 ml PPB buffer (30 mM Tris-HCl pH8, 1 mM EDTA, 20% sucrose), bacteria were centrifuged again and the supernatant was harvested. This incubation step was repeated once with 25 ml of a 5 mM MgSO.sub.4 solution. The supernatants of both incubation steps were pooled, filtered and loaded on an IMAC column (His gravitrap, GE Healthcare). Subsequently, the column was washed with 40 ml washing buffer (500 mM NaCl, 20 mM imidazole, 20 mM NaH2PO.sub.4 pH 7.4). After the elution (500 mM NaCl, 500 mM imidazole, 20 mM NaH.sub.2PO.sub.4 pH 7.4) the eluate was re-buffered using PD10 columns (GE Healthcare). The kinetic parameters of the purified Fabs were then studied by SPR-analysis (ProteOn XPR36, Biorad) in a dilution series that ranged from 100 nM to 6.25 nM for clone 5C5 (SEQ ID NO: 7 (VH) and SEQ ID NO: 8 (VL)) and 200 nM to 12.5 nM for clone 13C6 (SEQ ID NO: 15 (VH) and SEQ ID NO: 16 (VL)).
Affinity-Determination by Surface Plasmon Resonance (SPR)
[0539] Affinity (K.sub.D) of selected Fab clones was measured by surface plasmon resonance using a ProteOn XPR36 instrument (Biorad) at 25 C. with biotinylated mono huNKG2D ECD Fc kh avi (SEQ ID NO: 94 and SEQ ID NO: 95) and di huNKG2D ECD Fc avi (SEQ ID NO: 96) immobilized on NLC chips by neutravidin capture. Immobilization of recombinant antigens (ligand): Antigens were diluted with PBST (10 mM phosphate, 150 mM sodium chloride pH 7.4, 0.005% Tween 20) to 10 g/ml, then injected at 30 l/minute at varying contact times in vertical orientation for immobilization. Injection of analytes: For one-shot kinetics measurements, injection direction was changed to horizontal orientation, two-fold dilution series of purified Fab (varying concentration ranges between 200 and 6.25 nM) were injected simultaneously at 60 l/min along separate channels 1-5, with association times of 200 s or 300 s, respectively, and dissociation times of 360 s. Buffer (PBST) was injected along the sixth channel to provide an in-line blank for referencing. Association rate constants (k.sub.on) and dissociation rate constants (k.sub.off) were calculated using a simple one-to-one Langmuir binding model in ProteOn Manager v3.1 software by simultaneously fitting the association and dissociation sensorgrams. The equilibrium dissociation constant (K.sub.D) was calculated as the ratio k.sub.off/k.sub.on. The kinetic and thermodynamic data of all measurements are summarized in Table 1. Cross-reactivity of clones 5C5 and 13C6 to cynomolgus NKG2D, i.e. binding to di cyNKG2D ECD Fc avi, was assessed on IgG level (see Example 9).
TABLE-US-00002 TABLE 1 Affinities of anti-NKG2D Fabs to human NKG2D as determined by SPR. mono huNKG2D ECD Fc kh di huNKG2D ECD Fc avi antibody ka (1/Ms) kd (1/s) KD (M) ka (1/Ms) kd (1/s) KD (M) 5C5 3.6E+05 5.5E03 1.5E08 2.5E+05 5.6E03 2.2E08 13C6 1.2E+04 9.6E04 7.9E08 9.5E+03 7.0E04 7.4E08
Cloning of Variable Antibody Domains into IgG Expression Vectors (IgG Conversion)
[0540] Fabs of phage display derived antibodies 5C5 and 13C6 were converted into an IgG1/lambda or kappa antibody, respectively. For this, the PCR-amplified DNA fragments of heavy and light chain V-domains were inserted in frame into either a human IgG1 constant heavy chain or the human constant lambda or constant kappa light chain containing respective recipient mammalian expression vector. The antibody expression was driven by an MPSV promoter and transcription terminated by a synthetic polyA signal sequence located downstream of the CDS. In addition to the expression cassette, each vector contained an EBV oriP sequence for autonomous replication in EBV-EBNA expressing cell lines.
Example 3. Generation of Anti-NKG2D Antibodies by Immunization of Transgenic Rabbits
Animal Care, Immunization of Rabbits and Organ Removal
[0541] In addition to the antibodies generated by phage display described above, further antibodies were derived from transgenic rabbits expressing a humanized antibody repertoire (see, e.g. WO 2000/46251, WO 2002/12437, WO 2005/007696, WO 2006/047367, WO 2007/019223, and WO 2008/027986, all incorporated herein by reference in their entirety), upon immunization with NKG2D antigens. The animals were housed according to the Appendix A Guidelines for accommodation and care of animals in an AAALAC-accredited animal facility. All animal immunization protocols and experiments were approved by the Government of Upper Bavaria (permit number 55.2-1-54-2532-90-14) and performed according to the German Animal Welfare Act and the Directive 2010/63 of the European Parliament and Council.
[0542] Rabbits were immunized with recombinant human NKG2D ECD protein (his avi huNKG2D ECD (SEQ ID NO: 93)) or recombinant human NKG2D ECD fused to the C-terminus of a murine IgG1 Fc (di huNKG2D ECD mu IgG1 Fc (SEQ ID NO: 99)), or immunized genetically, using a plasmid expression vector coding for full-length human NKG2D and DAP10, alternating with CHO cells recombinantly expressing full-length human NKG2D and DAP10.
[0543] Antigen-specific titer was determined by ELISA in serum from immunized animals (see below).
B Cell Cloning
[0544] Rabbit peripheral blood mononuclear cells (PBMC) were isolated for B cell cloning. Macrophages and monocytes were depleted through unspecific adhesion to a layer of HEK293 cells. The cells in the supernatant (peripheral blood lymphocytes (PBLs)) were used for the antigen panning step. Antigen-specific B cells were enriched through binding to antigen-coated plates (his avi huNKG2D ECD (SEQ ID NO: 93) or HEK293T cells recombinantly expressing full-length human NKG2D and DAP10). Enriched cells were subjected to single cell sorting by flow cytometry.
[0545] The rabbit B cells were cultivated as described by Seeber et al. (Seeber et al. (2014) PLoS One 4; 9(2)), and supernatants used for Level 1 screening by ELISA (see below).
PCR Amplification and Subcloning of V-Domains for Recombinant Expression of IgG Antibodies
[0546] Total RNA was prepared from B cells lysate and used to generate cDNA by reverse transcriptase reaction. cDNA was used to amplify the immunoglobulin heavy and light chain variable regions (VH and VL) by PCR using appropriate primers.
[0547] For recombinant expression of rabbit monoclonal bivalent antibodies, PCR-products coding for VH or VL were cloned as cDNA into expression vectors by the overhang cloning method (Haun et al. (1992) Biotechniques 13, 515-518; Li et al. (2007) Nature Methods 4, 251-256). The expression vectors contained an expression cassette consisting of a 5 CMV promoter including intron A, and a 3 BGH poly adenylation sequence. In addition to the expression cassette, the plasmids contained a pUC18-derived origin of replication and a beta-lactamase gene conferring ampicillin resistance for plasmid amplification in E. coli. Three variants of the basic plasmid were used: one plasmid containing the rabbit IgG constant region designed to accept the VH regions, and two additional plasmids containing either rabbit or human kappa LC constant region to accept the VL regions. Linearized expression plasmids coding for the kappa or gamma constant region and VL/VH inserts were amplified by PCR using overlapping primers. Purified PCR products were incubated with T4 DNA-polymerase which generated single-strand overhangs. The reaction was stopped by dCTP addition. In the next step, plasmid and insert were combined and incubated with recA which induced site specific recombination. The recombined plasmids were transformed into E. coli. The next day the grown colonies were picked and tested for correct recombined plasmid by plasmid preparation, restriction analysis and DNA-sequencing. For Level 2 screening by ELISA (see below), the isolated heavy chain (HC) and light chain (LC) plasmids were transiently co-transfected into HEK293 cells and the supernatants were harvested after 1 week to be subsequently subjected to micro-purification.
Example 4. Screening of Anti-NKG2D Antibodies for NKG2D Binding by ELISA
[0548] For screening of the clones derived from immunization of transgenic rabbits, either supernatants of the B-cell cultivation (Level 1 screening, see above) or subcloned and micro-purified IgGs (Level 2 screening, see above) were used.
Protein Binding ELISA for Human NKG2D
[0549] Nunc streptavidin coated plates (MicroCoat, #11974998001) were coated with 25 l/well biotinylated his avi huNKG2D ECD (SEQ ID NO: 93) at a concentration of 0.5 g/ml and incubated at room temperature (RT) for 1 hour. After washing with 390 l/well PBST-buffer (10PBS, Roche #11666789001+0.1% Tween 20), 25 l anti-NKG2D antibodies were added in 1:3 dilutions starting at a concentration of 3 g/ml or alternatively with a 1:30 dilution of the original sample and incubated 1 h at RT. After washing (390 l/well PBST-buffer), 25 l/well anti hu kappa chain HRP (horseradish peroxidase)-conjugate (Millipore, #AP502P, 1:2000) was added and incubated at RT for 1 h. After washing (390 l/well PBST-buffer) 25 l/well TMB (3,3,5,5-tetramethylbenzidine) substrate (Roche, #11835033001) was added. Measurements were performed at OD 370/492 nm and results are summarized in Table 2 below. All antibodies bound specifically and in a dose-dependent manner to the immobilized his avi huNKG2D ECD.
TABLE-US-00003 TABLE 2 Binding of anti-NKG2D antibodies to recombinant human NKG2D determined by ELISA. EC.sub.50 and OD max. Molecule EC.sub.50 [nM] OD max clone 001 0.8 2.5 clone 013 2 2.5 clone 014 1 1.7 clone 018 1.1 2.3 clone 230 n.d. 2.4 clone 296 n.d. 2.1 clone 320 1.4 2.4 clone 395 n.d. 2.4 (n.d. = not determined)
Protein Binding ELISA for Cynomolgous NKG2D
[0550] Nunc streptavidin coated plates (MicroCoat, #11974998001) were coated with 25 l/well biotinylated di cyNKG2D ECD Fc avi (SEQ ID NO: 97) at a concentration of 0.25 g/ml and incubated at room temperature (RT) for 1 hour. The assay was performed as described above for human NKG2D.
[0551] The results are summarized in Table 3. All antibodies are cross-reactive to cynomolgus NKG2D and this has also been confirmed by surface plasmon resonance (see Example 9).
TABLE-US-00004 TABLE 3 Binding of anti-NKG2D antibodies to recombinant cynomolgus NKG2D determined by ELISA. EC.sub.50 and OD max. antibody EC.sub.50 [nM] OD max clone 001 0.3 1.7 clone 013 0.4 1.5 clone 014 n.d. 0.4 clone 018 0.4 1.3 clone 230 1.3 1.6 clone 296 0.7 0.9 clone 320 0.4 0.9 clone 395 0.6 1.4 (n.d. = not determined)
Protein Binding ELISA for Murine NKG2D
[0552] Nunc streptavidin coated plates (MicroCoat, #11974998001) were coated with 25 l/well biotinylated di muNKG2D ECD Fc avi (SEQ ID NO: 98) at a concentration of 1 g/ml and incubated at room temperature (RT) for 1 hour. The assay was performed as described above for human NKG2D.
[0553] The results are summarized in Table 4. The antibodies are not or only very weakly cross-reactive to murine NKG2D.
TABLE-US-00005 TABLE 4 Binding of anti-NKG2D antibodies to recombinant murine NKG2D determined by ELISA. EC.sub.50 and OD max. antibody EC.sub.50 [nM] OD max clone 001 n.d. 0.2 clone 013 n.d. 0.4 clone 014 n.d. 0.1 clone 018 n.d. 0.1 clone 230 n.d. 0.3 clone 296 n.d. 0.3 clone 320 n.d. 0.1 clone 395 n.d. 0.3 (n.d. = not determined)
Human NKG2D Cell-Surface Binding ELISA 25 l/well of HEK293T cells recombinantly expressing full-length human NKG2D and DAP10 (15000 cells/well) or unmodified HEK293T were seeded into 384-well poly-D-lysine plates (Corning, #356662) and incubated overnight at 37 C. in cell culture medium (Gibco, #42430-25+10% FCS (PAN, #P30-2006)+1 g/ml puromycin+1 penicillin/streptomycin (Roche, #11074440001, 500)). The next day after removal of medium, 25 l anti-NKG2D antibodies were added in 1:3 dilutions starting at a concentration of 3 g/ml or alternatively with a 1:20 dilution of the original sample and incubated for 2 h at 4 C. After washing (190 l in PBST) cells were fixed by addition of 30 l/well glutaraldehyde to a final concentration of 0.05% (Sigma, #G5882), 10 min at room temperature. After washing (290 l/well PBST-buffer), 25 l/well anti hu kappa POD (Millipore, #AP502P, 1:2000) was added and incubated at RT for 1 h. After washing (390 l/well with PBST-buffer) 25 TMB substrate (Roche, #11835033001) was added and incubated for 6-10 min. Measurement were performed on a Tecan Safire 2 instrument at OD 370/492 nm.
[0554] The results are summarized in Table 5. All antibodies bound specifically and in a dose-dependent manner to HEK293T cells that recombinantly expressed full-length human NKG2D and DAP10, except for the weak binders clone 013 and 014 for which binding could not be detected in this assay. None of these antibodies bound to non-transfected HEK293T reference cells.
TABLE-US-00006 TABLE 5 Cell binding of anti-NKG2D antibodies determined by cell ELISA. EC.sub.50 and OD max. HEK293T human NKG2D HEK293T antibody EC.sub.50 [nM] OD max EC.sub.50 [nM] OD max clone 001 2.2 1.0 n.d. 0.2 clone 013 n.d. n.d. n.d. 0.2 clone 014 n.d. n.d. n.d. 0.2 clone 018 1.9 0.8 n.d. 0.1 clone 230 n.d. 0.7 n.d. 0.2 clone 296 n.d. 0.5 n.d. 0.2 clone 320 n.d. 1.0 n.d. 0.2 clone 395 n.d. 0.8 n.d. 0.2 (n.d. = not determined)
Example 5. Screening of Anti-NKG2D Antibodies for MIC-B Competition by ELISA
[0555] 384-well Maxisorp plates (Nunc, #464718) were coated with 25 l/well recombinant human MIC-B (ECD FL MIC-B Fc avi, SEQ ID NOs 100 and 101)) at a concentration of 2 g/ml and incubated at room temperature (RT) for 1 hour. After washing with 390 l/well PBST-buffer (10PBS (Roche, #11666789001)+0.1% Tween 20), each well was incubated with 90 l blocking buffer (10PBS (Roche, #11666789001)+2% Bovine Serum Albumin Fraction V, fatty acid free (Roche, #10735086001)+0.05% Tween 20) for 1 h at RT. In parallel, recombinant biotinylated human NKG2D was incubated with anti-NKG2D antibodies (2 g/ml NKG2D with 1:3 dilutions of antibody starting at a concentration of 3 g/ml) on a polypropylene plate (Weidman, #23490-101) for 1 h at RT. After washing (390 l/well PBST-buffer), 25 l/well of the NKG2D-antibody mixtures were transferred to the assay plate and incubated for 1 h at RT. After washing (390 l/well PBST-buffer), 25 l/well Poly-HRP40-Streptavidin (Fitzgerald, #65R-S104PHRPx) was added in a 1:2000 dilution and incubated for 1 h at RT. After an additional washing step (390 l/well PBST-buffer), 25 l TMB substrate (Roche, #11835033001) was added to each well. Measurements were performed at OD 370/492 nm.
[0556] The results are shown in
TABLE-US-00007 TABLE 6 EC.sub.50 of NKG2D:MIC-B inhibition by anti-NKG2D antibodies. antibody EC.sub.50 [ng/ml]* clone 13C6 111 clone 5C5 717 clone 001 560 clone 013 no inhibition clone 014 no inhibition clone 018 332 clone 230 1065 clone 296 20 clone 320 67 clone 395 1636 (*estimated when no full upper or lower plateau was reached)
Example 6. Upscaled Expression, Purification and Analysis of IgGs
[0557] The antibody molecules were generated in transiently transfected HEK293 cells (human embryonic kidney cell line 293-derived) cultivated in F17 Medium (Invitrogen). For transfection 293-Free Transfection Reagent (Novagen) was used. The respective antibody heavy- and light chain molecules as described above were expressed from individual expression plasmids. Transfections were performed as specified in the manufacturer's instructions. Immunoglobulin-containing cell culture supernatants were harvested 3-7 days after transfection and frozen at 80 C. until purification. General information regarding the recombinant expression of human immunoglobulins in e.g. HEK293 cells is given in: Meissner et al. (2001) Biotechnol Bioeng 75, 197-203 (incorporated herein by reference).
[0558] The recombinant antibodies were purified from the supernatant in two steps by affinity chromatography using protein A-Sepharose affinity chromatography (GE Healthcare) and Superdex200 (GE Healthcare) size exclusion chromatography. Briefly, the antibody-containing clarified culture supernatants were loaded onto a MabSelectSuRe Protein A (5-50 ml) column equilibrated with PBS buffer (10 mM Na.sub.2HPO.sub.4, 1 mM KH.sub.2PO.sub.4, 137 mM NaCl and 2.7 mM KCl, pH 7.4). Unbound proteins were washed out with equilibration buffer. The antibodies were eluted with 100 mM citrate buffer, pH 2.8. The protein-containing fractions were neutralized with 1/10 eluate volume of 2 M Tris buffer, pH 9.0. In a subsequent step, the eluted protein fractions were pooled and processed according to one of the three options: a) concentrated with an Amicon Ultra centrifugal filter device (MWCO: 30 K, Millipore) and loaded on a Superdex200 HiLoad 16/60 gel filtration column (GE Healthcare) equilibrated with 20 mM histidine, 140 mM NaCl, at pH 6.0, orb) loaded onto a Superdex200 HiLoad 16/60 gel filtration column (GE Healthcare) equilibrated with 20 mM histidine, 140 mM NaCl, at pH 6.0, or c) dialysed with 10K Slide-A-Lyzer (Thermo Fisher Scientific). Monomeric antibody fractions were pooled. The protein concentration of purified antibodies and derivatives was determined by determining the optical density (OD) at 280 nm with the OD at 320 nm as background correction, using the molar extinction coefficient calculated on the basis of the amino acid sequence according to Pace et. al. (1995) Protein Science 4, 2411-2423 (incorporated by reference). Antibody samples were snap-frozen and stored at 80 C.
[0559] The homogeneity of the antibodies was confirmed by CE-SDS LabChip GX (PerkinElmer) in the presence or absence of a reducing agent. Under reducing conditions, light and heavy chain polypeptide chains of the IgGs were identified after CE-SDS at apparent molecular sizes analogous to the calculated molecular weights.
[0560] The quality of the antibodies was confirmed by analytical SEC (size-exclusion chromatography) using a BioSuite High Resolution SEC, 250A, 5 m run on an UltiMate 3000 HPLC system (Thermo Fisher Scientific). Elution from the chromatography material was performed by applying 200 mM K.sub.2HPO.sub.4/KH.sub.2PO.sub.4, 250 mM KCl, pH 6.2. Main peak of analytical SEC resulted in >91% for all analyzed samples.
Example 7. Screening of Anti-NKG2D Antibodies (IgGs) for NKG2D Binding by FACS
[0561] For the EC.sub.50 determination of binding to NK-92 cells, the antibodies were pre-labeled with a Zenon Human IgG Labeling Kit (Thermo Fisher Scientific). The IgGs were stained with a 5-fold excess of Zenon reagent A and unbound staining reagent was blocked with an equal amount of Zenon reagent B. After the preparation of a dilution series in steps of 1:3, 5.010.sup.4 NK-92 cells per well in a 96-well plate were incubated with 50 L pre-labeled antibody solution for 1 h at 4 C. Cells were washed twice with FACS buffer (2.5% FCS in PBS) and resuspended in 70 L buffer. Fluorescence was measured using a BD FACS Canto device and EC.sub.50 was determined (Table 7).
[0562] The antibodies exhibited specific and dose-dependent binding to NK92 cells with EC50 values ranging from 0.988 to 0.031 g/mL. For clones 013, 014, and 5C5, being weak cell binders, no EC.sub.50 values could be determined.
TABLE-US-00008 TABLE 7 EC.sub.50 of NK92 cell binding of NKG2D antibodies as determined by FACS antibody EC.sub.50 [g/mL] clone 018 0.758 clone 13C6 0.058 clone 5C5 n.d. clone 230 0.988 clone 013 n.d. clone 320 0.734 clone 001 0.729 clone 395 0.203 clone 296 0.031 clone 014 n.d. (n.d. = not determined).
Example 8. Re-Directed Lysis of Target Cells by Anti-NKG2D Antibodies (IgGs)
Calcein Labeling of Target Cells
[0563] P815 cells (a murine FcR expressing mast cell line) were harvested by centrifugation in a 50 mL Falcon tube (300g, 5 min) and subsequently re-suspended to 1.010.sup.6 cells/mL in P815 growth medium. 50 L calcein-AM per 5.010.sup.6 cells were added and labeling reaction was incubated for 30 min at 37 C. The cells were washed 3 with AIM-V assay medium and re-suspended to 6.010.sup.5 cells/mL
Antibody Treatment
[0564] The antibodies were adjusted to 80 g/mL in assay medium. Subsequently, 1:3 dilutions were prepared in AIM-V medium in a V-bottom plate according to the plate scheme by mixing 40 L pre-dilution with 80 L AIM-V medium. P815 cells were adjusted to 6.010.sup.5 cells/mL and 50 L/well cell suspension was added to the antibody dilutions resulting in 3.010.sup.4 cells/well and incubated for 30 min at 37 C. to allow binding of the antibodies to the Fc-receptors of the cells.
[0565] Afterwards, the plate was centrifuged for 3 min at 400g and the supernatants were discarded. NK-92 cells were resuspended to 7.510.sup.5 cells/mL in assay medium. P815 cells were resupended in 200 L NK-92 cell suspension (=1.510.sup.5 cells/well=E:T ratio 1:5). The plates were incubated for 4 h at 37 C.
Calcein Release
[0566] After centrifugation of the plates for 4 min at 420g, the supernatants were discarded and the cells were washed once with 200 L PBS (final centrifugation 420g, 4 min). The cells were then resuspended in 200 L/well 1% TritonX-100 PBS and 180 L of the lysed cells were transferred into a Costar Assay PLate, 96 well, black with clear bottom, and the fluorescence was measured (excitation filter 485 nm, band-pass filter 530 nm). The % cell killing was determined as quotient of the measured values against maximal release where the cells were re-suspended in 200 L 1% TritonX-100 in assay medium.
[0567] The result is shown in
Example 9. Determination of Kinetic Rate Constants and Affinities of Anti-NKG2D Antibodies (IgGs) to Human and Cynomolgus NKG2D by Surface Plasmon Resonance (SPR)
[0568] Around 1500 resonance units (RU) of the capture antibody (10 g/ml human Fab Capture Kit, GE Healthcare Life Sciences, #28958325) were coupled onto a CMS chip (GE Healthcare, #BR-1005-30) using a BIACORE B4000 instrument (GE Healthcare) at pH 5.0 by using an amine coupling kit supplied by GE Healthcare. The sample and system buffer was PBS-T (10 mM phosphate buffered saline including 0.05% Tween20) pH 7.4. The flow cells were set to 25 C.and the sample block set to 12 C.and primed twice with running buffer. The antibody was captured by injecting a 10 g/ml solution for 60 sec at a flow rate of 10 l/min. Association was measured by injection of di huNKG2D ECD Fc avi (SEQ ID NO: 96) or di cyNKG2D ECD Fc avi (SEQ ID NO: 97) in various concentrations in solution for 180 s at a flow rate of 30 l/min starting with 600 nM, 300 nM, 150 nM following 1:3 dilutions. The dissociation phase was monitored for up to 450 s and triggered by switching from the sample solution to running buffer. The surface was regenerated by 290 s washing with a glycine pH 2.1 solution at a flow rate of 30 l/min and an additional stabilization period of 180 s. Bulk refractive index differences were corrected by subtracting the response obtained from an anti-human Fab surface. Blank injections were also subtracted (=double referencing). For calculation of K.sub.D, k.sub.a and k.sub.d (see Table 8), the Langmuir 1:1 model in the Biacore 4000 Evaluation software 1.1 (GE Healthcare) or TraceDrawer 1.6.1 (Ridgeview Instruments AB) were used.
[0569] Affinities of these agonistic anti-NKG2D antibodies range from subnanomolar (clone 395) to micromolar (clone 014) affinities. All of them cross-react with cynomolgus NKG2D whereas for clone 296 there is a 187-fold difference between binding to human NKG2D (3.8 nM) vs. cynomolgus NKG2D (710 nM). Clone 395 exhibits the highest affinity to human and cynomolgus NKG2D of all antibodies, in the 3-digit picomolar range.
TABLE-US-00009 TABLE 8 Kinetic rate constants and affinities to human and cynomolgus NKG2D. di huNKG2D ECD Fc avi di cyNKG2D ECD Fc avi antibody ka (1/Ms) kd (1/s) KD (M) ka (1/Ms) kd (1/s) KD (M) clone 13C6 3.4E+04 2.8E04 8.2E09 2.0E+04 9.2E04 4.7E08 clone 018 4.3E+04 1.3E03 2.9E08 3.9E+04 8.0E04 2.1E08 clone 001 5.2E+04 4.5E04 8.5E09 4.8E+04 2.1E04 4.5E09 clone 5C5 2.2E+05* 1.4E02* 6.3E08* 1.1E+05 9.1E04 8.4E09 clone 230 4.3E+04 1.6E04 3.6E09 4.0E+04 1.0E04 2.6E09 clone 395 5.7E+04 3.2E05 5.5E10 4.7E+04 3.6E05 7.8E10 clone 013 8.4E+04 1.3E03 1.6E08 8.1E+04 6.4E04 7.9E09 clone 296 2.1E+05 7.9E04 3.8E09 1.3E+05* 9.0E02* 7.1E07* clone 320 8.3E+04 9.1E03 1.1E07 7.8E+04 4.7E03 6.1E08 clone 014 1.1E+05* 2.1E01* 2.0E06* 4.7E+04* 6.1E02* 1.3E06* *has been calculated by TraceDrawer 1.6.1 (Ridgeview Instruments AB)
Example 10. Epitope Binning of Anti-NKG2D Antibodies (IgGs) on Human NKG2D by SPR
[0570] The sensor surface of an SA chip (GE Healthcare, #BR-1005-31) was conditioned with three 1-minute injections of 1 M NaCl in 50 mM NaOH before the ligand was immobilized. Around 200-300 resonance units (RU) of mono huNKG2D ECD Fc kh avi (SEQ ID NOs 94 and 95) were coupled onto the sensorchip surface using a BIACORE T200 instrument (GE Healthcare). An extra wash using 50% isopropanol in 1 M NaCl and 50 mM NaOH was performed after ligand injection. The sample and system buffer was PBS-T (10 mM phosphate buffered saline including 0.05% Tween20) pH 7.4. The flow cells were set to 25 C., the sample block set to 12 C., and the sensorchip surface was primed with running buffer twice. The first and second antibody were injected by dual injection, each at a concentration of 200 nM for 180 s at a flow rate of 30 l/min. Saturation of the immobilized antigen with the first antibody was essential. The dissociation phase was monitored for up to 120 s and triggered by switching from the sample solution to running buffer. The surface was regenerated by washing with a glycine pH 2.1 solution at a flow rate of 30 l/min for 40 s and an additional stabilization period of 180 s. Bulk refractive index differences were corrected by subtracting the response obtained from the blank surface. Blank injections were also subtracted (=double referencing). Binding responses were analyzed by Biacore T200 Evaluation software 3.0 (GE Healthcare).
[0571] The second antibody can only bind the antigen saturated by the first antibody if its epitope is not the same or does not overlap with that of the first antibody. An exemplary sensorgram is shown in
TABLE-US-00010 TABLE 9 Different panels of antibodies tested against each other including respective self- blocking controls. Values represent percentage of binding of second antibody in relation to the binding response of the first antibody. Numbers in bold indicate simultaneous binding, underlined numbers indicate mutual blocking. Cut-off between simultaneous binding and blocking was defined at 30%. first second antibody antibody clone 018 clone 13C6 clone 5C5 clone 230 clone 013 clone 320 clone 001 clone 296 clone 018 0 0 5 3 81 3 4 2 clone 13C6 2 0 4 4 57 0 5 3 clone 5C5 50 101 0 56 121 75 56 32 clone 230 1 1 5 0 83 4 1 0 clone 013 79 70 49 89 0 3 83 66 clone 320 6 9 16 8 7 0 8 8 clone 001 1 2 6 3 80 1 0 2 clone 296 15 13 8 21 97 14 20 0 first second antibody antibody clone 13C6 clone 5C5 clone 013 clone 320 clone 306 clone 002 clone 132 clone 366 clone 13C6 0 7 46 5 3 0 25 66 clone 5C5 92 0 106 62 48 43 13 123 clone 013 74 53 0 4 85 54 33 10 clone 320 13 11 4 0 10 6 27 51 clone 306 1 3 77 5 0 2 12 90 clone 002 4 1 33 3 5 0 8 15 clone 132 178 36 113 56 72 62 0 141 clone 366 71 46 5 24 89 5 25 0 first second antibody antibody clone 13C6 clone 5C5 clone 013 clone 320 clone 001 clone 296 clone 014 clone 395 clone 13C6 0 9 48 6 1 4 15 3 clone 5C5 90 0 100 58 44 24 77 52 clone 013 72 51 0 4 79 59 63 83 clone 320 21 16 10 0 14 8 46 20 clone 001 3 1 78 2 0 1 52 8 clone 296 20 10 93 13 20 0 49 28 clone 014 85 14 79 71 63 62 0 72 clone 395 5 12 66 4 5 3 53 0
[0572] Three different epitope bins could be established by this SPR-based competition assay (Table 10). The majority of antibodies fall into epitope bin 1 with two antibodies representing epitope bin 2 (clones 5C5 and 132) and three antibodies representing epitope bin 3 (clones 013, 014, and 366).
TABLE-US-00011 TABLE 10 Epitope bins of anti-NKG2D antibodies. bin 1 bin 2 bin 3 clone 13C6 clone 5C5 clone 013 clone 018 clone 132 clone 014 clone 230 clone 366 clone 296 clone 001 clone 306 clone 395 clone 002 clone 320
[0573] The anti-NKG2D antibody clones 5C5, 320, 230, 013, 296 and 395 were selected for further analysis.
Example 11. Specific Binding of Anti-NKG2D Antibodies (IgGs) to Human NKG2D on Immune Cells
[0574] Binding to human NKG2D was confirmed for selected antibody clones using NKG2D positive immune cells, namely NK cells, y T cells and CD8 T cells. Binding of the antibodies to the human NKG2D positive NK cell line NK92, to human CD8 T cells, expanded human NK cells and expanded human y T cells was assessed by flow cytometry. A non-binding control was included in the experiment (untargeted IgG (VH and VL sequences of SEQ ID NOs 81 and 82) with L234A L235A P329G (PGLALA) mutation in Fc region).
Methods
Binding to the Human NK Cell Line NK92
[0575] Viability of NK92 cells was checked and cells were re-suspended and adjusted to a density of 1 mio cells/ml. 100 l of this cell suspension (containing 0.1 mio cells) were seeded into a 96 well round bottom plate. The plate was centrifuged for 4 min at 400g and the supernatant was removed. Then 40 l of the diluted antibodies or FACS buffer were added to the cells and incubated for 30 min at 4 C. After the incubation the cells were washed twice with 150 l FACS buffer per well. Then 20 l of the diluted APC anti-human Fc specific secondary antibody (Jackson ImmunoResearch, #109-116-170) was added to the cells. The cells were incubated for an additional 30 min at 4 C. To remove unbound antibody, the cells were washed again twice with 150 l per well FACS buffer. To fix the cells 100 l of FACS buffer containing 1% PFA were added to the wells. Before measuring the cells were re-suspended in 150 l FACS buffer. The fluorescence was measured using a BD CantoII flow cytometer.
Binding to CD8 T Cells
[0576] Viability of freshly isolated PBMCs was checked and cells were adjusted to a density of 1 mio cells/ml in FACS buffer. 100 l of the PBMCs (containing 0.1 mio cells) were seeded into a 96 well round bottom plate. The plate was centrifuged for 4 min at 400g and the supernatant was removed. Then 0.5 l Fc Block (BD Bioscience) in 20 l total volume per well were added and the plate was incubated for 30 min at 4 C. Supernatant was removed and then 40 l of the diluted NKG2D antibodies were added to the cells and incubated for additional 30 min at 4 C. After the incubation the cells were washed twice with 150 l FACS buffer per well. Then 20 l of the diluted FITC anti-human Fc specific secondary antibody (Jackson ImmunoResearch, #109-096-098) together with CD8 APC (Clone SK1, BioLegend) and CD3 PE/Cy7 (clone UCHT1, BioLegend) was added to the cells to detect the NKG2D antibodies and identify CD8 T cells as CD8 and CD3 positive cells within PBMCs. The cells were incubated for an additional 30 min at 4 C. To remove unbound antibody, the cells were washed again twice with 150 l per well FACS buffer. To fix the cells 100 l of FACS buffer containing 1% PFA were added to the wells. Before measuring the cells were re-suspended in 150 l FACS buffer. The fluorescence was measured using a BD CantoII flow cytometer.
Binding to Expanded NK Cells
[0577] Viability of expanded NK cells was checked and cells were adjusted to a density of 1 mio cells/ml in FACS buffer. 100 l of these cell suspensions (containing 0.1 mio cells) were seeded into a 96 well round bottom plate. The plate was centrifuged for 4 min at 400g and the supernatant was removed. Then 0.5 l Fc Block (BD Bioscience) in 20 l total volume per well were added and the plate was incubated for 30 min at 4 C. Supernatant was removed and then 40 l of the diluted NKG2D antibodies were added to the cells and incubated for additional 30 min at 4 C. After the incubation the cells were washed twice with 150 l FACS buffer per well. Then 20 l of the diluted FITC anti-human Fc specific secondary antibody (Jackson ImmunoResearch, #109-096-098) was added to the cells. The cells were incubated for an additional 30 min at 4 C. To remove unbound antibody the cells were washed again twice with 150 l per well FACS buffer. To fix the cells 100 l of FACS buffer containing 1% PFA were added to the wells. Before measuring the cells were re-suspended in 150 l FACS buffer. The fluorescence was measured using a BD CantoII flow cytometer.
[0578] Binding to Expanded T Cells
[0579] Viability of expanded y T cells was checked and cells were adjusted to a density of 1 mio cells/ml in FACS buffer. 100 l of these cell suspensions (containing 0.1 mio cells) were seeded into a 96 well round bottom plate. The plate was centrifuged for 4 min at 400g and the supernatant was removed. Then 40 l of the diluted NKG2D antibodies were added to the cells and incubated for additional 30 min at 4 C. After the incubation the cells were washed twice with 150 l FACS buffer per well. Then 20 l of the diluted secondary FITC anti-human Fc specific secondary antibody (Jackson ImmunoResearch, #109-096-098) was added to the cells. The cells were incubated for an additional 30 min at 4 C. To remove unbound antibody, the cells were washed again twice with 150 l per well FACS buffer. To fix the cells 100 l of FACS buffer containing 1% PFA were added to the wells. Before measuring the cells were re-suspended in 150 l FACS buffer. The fluorescence was measured using a BD CantoII flow cytometer.
Generation of Expanded Human NK Cells
[0580] NK cells were isolated from PBMCs using the NK Cell Isolation Kit (Miltenyi Biotec, #130-092-657). For this, non-NK cells were indirectly magnetically labeled followed by magnetic separation using a MACS Separator. Unlabeled NK cells were then passing through a MACS column, while non-NK cells were retained in the column.
[0581] After cell isolation, NK cells were then cultivated using the NK Cell Activation/Expansion Kit (Miltenyi Biotec, #130-094-483). When starting with the NK expansion culture, anti-Biotin Bead Particles were loaded with biotinylated antibodies against CD335 and CD2. These particles were then added once to the cell culture in a bead-to-cell ratio of 1:2. Cells were put in a 24-well cell culture plate at a cell density of 1 million cells per ml. NK cells were incubated for 6 days and inspected daily. Fresh culture medium was added if necessary. At day 6, cells were re-suspended and counted. NK cells were then kept at 1-1.5 million cells per ml for further culture. The expansion medium for NK cells contained NK MACS medium (NK MACS Basal medium (Miltenyi Biote, #130-107-879) with 2% NK MACS supplement (#130-107-210), 5% human AB serum and 500 IU/ml IL2 (Proleukin, Novartis).
[0582] Generation of Expanded Human T Cells
[0583] The protocol used to generate expanded human y T cells was adapted from Rincon-Orozco et al. (2005) J Immunol 175, 2144-2151 (incorporated herein by reference). Briefly, freshly isolated PBMCs were re-suspended at 1 mio cells/ml in y T cell expansion medium (RPMI 1640, 10% FBS, 1% Glutamax, 100 mM sodium pyruvate, 10 mM MEM NEAA, 100 M (3-mercaptoethanol, 1 g/ml IPP (Sigma-Aldrich) and 100 U/ml IL-2 (Proleukin, Novartis) and plated in a 24-well cell culture plate. Half of the medium was exchanged at day 3 and 7. At day 10 after isolation, y T cells were isolated using the human TCRy T cell isolation kit (Miltenyi Biotec, #130-092-892). y T cells were kept in 24 well cell culture plates at 1-2 mio cells/ml in y T cell expansion medium to further expand them.
Results
[0584] The selected antibodies, 5C5, 320, 230, 013, 296 and 395, bound in a concentration dependent manner to the tested immune cells (
TABLE-US-00012 TABLE 11 EC.sub.50 values binding of NKG2D antibodies to NKG2D positive immune cells EC50 (nM) NK92 NK cells T cells CD8 T cells 5C5 0.47 0.40 0.28 (0.30 to 0.73) (0.27 to 0.59) (0.11 to 0.73) 230 2.72 2.87 3.31 0.83 (2.15 to 3.43) (2.65 to 3.11) (2.97 to 3.69) (0.67 to 1.04) 013 122.2 48.8 132.9 264 (66.47 to 224.6) (41.17 to 57.85) (20.30 to 869.9) (8.42 to 8276) 320 8.97 3.68 3.84 13.05 (7.95 to 10.11) (3.49 to 3.88) (2.36 to 6.26) (2.38 to 71.53) 296 0.63 0.48 1.32 0.13 (0.34 to 1.15) (0.39 to 0.61) (1.03 to 1.69) (0.058 to 0.31) 395 2.49 Not measured 1.94 Not measured (2.16 to 2.86) (1.81 to 2.08)
[0585] The anti-NKG2D antibodies bind specifically to immune cells that are described to express NKG2D. Most antibodies have low EC.sub.50 values (0.28-13.5 nM) indicating a high affinity binding to NKG2D which is comparable for the different tested immune cell subsets being NK cells, y T cells and CD8 T cells.
Example 12. Activation of NKG2D-Positive Immune Cells with Crosslinked Anti-NKG2D Antibodies (IgGs)
[0586] Next, the agonistic activity of the human NKG2D IgG.sub.1 antibodies was confirmed.
Activity of Anti-NKG2D Antibodies on NK92 Cells
[0587] We tested the activation of NKG2D on the human NK cell line NK92 upon crosslinking by coating the antibodies at the indicated concentrations to protein A beads. Protein A beads presenting the anti-NKG2D antibodies were co-incubated with NK92 cells for 24 h. Subsequently IFN release of NK92 cells into the supernatant was determined by cytometric bead array (CBA), as a marker for activation of NK92 cells induced by NKG2D activation.
[0588] All anti-NKG2D antibodies were tested for their agonistic activity and subsequently the best agonistic clones were selected for further characterization.
[0589] In
[0590] The best agonistic anti-NKG2D antibodies were selected for retesting of their functional activity in more detail.
[0591] The selected anti-NKG2D antibodies induced IFN release of NK92 cells in a concentration dependent manner upon crosslinking with differences in potency (
Activity of Anti-NKG2D Antibodies on Primary Human NK Cells
[0592] Anti-NKG2D antibodies that showed agonistic activity on the human NK92 cell line were subsequently tested on expanded primary human NK cells as a more physiological cell population. The same setup was used to assess functional activity of the antibodies on this cell type. As seen on NK92 cells, all tested anti-NKG2D antibodies induced activation of human NK cells compared to the non-binding isotype control IgG.sub.1 indicated by IFN and TNF release into the supernatant (
Activity of Anti-NKG2D Antibodies on Human y T Cells
[0593] After having tested the agonistic anti-NKG2D antibodies on NK cells, it was also tested if they could activate y T cells. y T cells are the second cell population that is reported to directly respond upon NKG2D triggering. To get sufficient amounts of y T cells, freshly isolated PBMCs were activated with IPP (isopentenyl pyrophosphate) and IL-2 to preferentially expand y T cells. Expanded y T cells were isolated and subsequently co-cultured with the agonistic NKG2D IgG1 antibodies bound to protein A beads. Again, the non-binding isotype control (see above) was included in the experiment. After 24 h the supernatant was collected and release of TNF into the supernatant was determined by CBA. The tested NKG2D antibodies induced TNF release of y T cells into the supernatant indicating activation of NKG2D by the antibodies (
Methods
[0594] Protein A Dynabeads (Invitrogen, #10001D) were re-suspended and 10 l of the bead solution was diluted within 5 ml PBS. Subsequently, 50 l of the diluted bead solution was transferred into each well of a 96 well round bottom plate which corresponded to about 200000 beads per well. Calculation was done by assuming that 1 l of the stock bead solution contains about 2 million beads. The plate was centrifuged at 400g for 3 min and the supernatant was removed. Then 50 l of the anti-NKG2D antibodies diluted in PBS were added to the beads and incubated for 1 h in the fridge to allow binding of the antibodies to the beads.
[0595] After incubation the plate was centrifuged again at 400g for 3 min and washed twice with 150 l PBS per well to remove antibodies that were not captured by the protein A beads. Effector cells which could be NK92, expanded human NK cells or expanded human y T cells were counted and viability was checked. NK92 and expanded NK cells were re-suspended in RPMI 1640 containing 10% FCS, 1% glutamine and 10 ng/ml Proleukin, and y T cells were re-suspended in RPMI 1640 containing 10% FBS, 1% GlutaMax and 100 U/ml IL-2 (Proleukin, Novartis). 100 l of the cell suspension with a concentration of 1 mio cells per ml were seeded in each well of a 96 well round bottom plate containing the protein A beads and incubated for 24 h at 37 C.
[0596] After 24 h of incubation the supernatant containing released cytokines was harvested and either stored at 20 C. or directly used for CBA (BD Bioscience) analysis. Depending of the effector cells different cytokines were analyzed. CBA analysis was performed according to manufacturer's instructions but instead of 50 l bead and sample volume only 25 l bead and sample volume were used and all other reagent amounts were adapted accordingly. The analysis was performed using a BD FACS CantoII flow cytometer.
Example 13. Co-Stimulation of CD8 T Cell Clones with Crosslinked Anti-NKG2D Antibodies
[0597] NLV-specific CD8 T cell clones and MART1-specific CD8 T cell clones were used to assess the co-stimulatory potential of the anti-NKG2D antibodies. The used CD8 T cell clones are NKG2D positive. To address the co-stimulatory potential of the anti-NKG2D antibodies (with a CD3 antibody providing the primary stimulation (signal 1), 96 well plates were coated with anti-human antibody to immobilize the anti-NKG2D antibodies and with anti-mouse antibody to capture the CD3 antibody. Subsequently, the CD8 T cell were added to the plates and incubated for 24 h. After stimulation, the CD8 T cell clones were harvested and analyzed by measuring CD25 upregulation for activation. In addition, the same experiment was performed with NLV-specific CD8 T cell clones in the absence of CD3 antibody to assess the potential of the anti-NKG2D antibodies to directly activate CD8 T cell in the absence of signal 1. Again, the non-binding isotype control (see above) was included in the experiments.
[0598] In more detail, to test co-stimulation of the CD8 T cell clones with the anti-NKG2D antibodies, a 96 well round bottom plate was coated with 2 g/ml anti-human IgG (Jackson ImmunoResearch, #109-006-098) and 2 g/ml anti-mouse IgG (Jackson ImmunoResearch, #115-005-071) in 50 l PBS per well overnight at 4 C. On the next day, the plate was washed three times with 200 l PBS containing 1% BSA. Then 200 l of PBS containing 1% BSA was added to each well and incubated for 90 min at 37 C. to block free plastic surface with BSA. After removing the supernatant, 0.25 g/ml in 50 l per well of the CD3 antibody (BioLegend, #317304) and the respective anti-NKG2D human IgG1 antibodies or the control were added to each well. The plate was incubated for 90 min at 37 C. Afterwards the plate was washed three times with 200 l per well of PBS containing 1% BSA and stored in the fridge until 100000 cells of the CD8 T cell clones were added in the evening. The cells were incubated overnight at 37 C. On the next day the CD8 T cell clones were harvested, washed twice with FACS buffer and stained with CD8 FITC (clone SK-1, BioLegend), CD25 PE (clone M-A251, BioLegend) and CD69 BV421 or CD69 APC (clone FN50, BioLegend) for 30 min at 4 C. To remove unbound antibody, the cells were washed again twice with 150 l per well FACS buffer. To fix the cells, 100 l of FACS buffer containing 1% PFA were added to the wells. Before measuring, the cells were re-suspended in 150 l FACS buffer. The fluorescence was measured using a BD CantoII or Fortessa flow cytometer.
[0599] The results are shown in
Example 14. Humanization of Agonistic Anti-NKG2D Antibody 395
[0600] The agonistic anti-NKG2D antibody 395 was obtained by immunization of transgenic rabbits. While the VL domain was already human, the VH domain was of rabbit sequence and had to be humanized. More precisely, the VL domain is a human germline IGKV1D-39#01 with 3 amino acids matured in CDRL1 (S28D, S31G, and Y32A) and 3 in CDRL3 (S91A, Y92N, and T94F). No change was made in CDRL2. In addition, two somatic mutations are observed in FR2L and FR3L: K45N and F71Y, respectively. This human variable domain was not modified. The variable heavy chain of antibody 395 is a rabbit VH matured from the germline RABBIT IGHV1S7#01 with several somatic mutations in the framework regions and the CDRs: 8 in FR H1, 4 in HCDR1, none in FR H2, 4 in HCDR2, and 6 in FR H3. In addition, the immunoglobulin VH domain of clone 395 contains 3 additional cysteines at Kabat position 21, 50, and 79. According to its germline, positions 21 and 79 form a disulfide bridge. The cysteine in position 50 has no partner as the partner C35 of the germline has been matured to a threonine.
[0601] The humanization eliminated the additional disulfide bridge as no human germline presents such a feature. For developability reasons, C50 was mutated to its close analog, a serine, to avoid influencing too much the binding of clone 395 to its target NKG2D. None of the human germlines selected as acceptor frameworks has a serine in Kabat position 50.
[0602] hVH5_51, hVH3_23, and hVH4_59 were selected as acceptor frameworks. They represent frequently used human germlines with a high degree of sequence similarity to the VH-domain of antibody 395 and no or only small predicted Abangle deviations (representing the change in orientation of the respective humanized variable heavy chain domains compared to the original rabbit variable heavy chain both paired with the unmodified human light chain variable domain). In addition, the CDRs of the VH-domain of antibody 395 were grafted onto the VH framework of trastuzumab, a framework based on VH3_23 and well characterized as a stable antibody.
[0603] The humanized sequences shown in
[0604] Some forward-mutations were considered at the end of HCDR2 as these residues are supposed to be far away from the binding site to the antigen NKG2D. On the other hand, some back-mutations were also considered in order to stick more closely to the original amino acids of clone 395. A prominent example is the S49G back-mutation on hVH3_23. In some variants, the N-terminal QE motif is also considered as those amino acids are located in the back of the HCDR3. The CDR4 loop is characterized by the sequence IDQS that has been reintroduced in some variants as this loop is sometimes in contact with the antigen as the fourth CDR of the variable heavy domain.
[0605] The humanized VH-domain variants of antibody 395 and its original human VL-domain have been used to generate bispecific NKG2DCEA antibodies which were then tested for binding and functionality (see Examples 17 and 18).
Example 15. Generation of Bispecific NKG2D Antibodies
[0606] Bispecific NKG2D antibody in several formats were generated and tested, using CEA as exemplary second specificity. The bispecific antibody formats were termed D, J, K, I, L, and M, and are schematically depicted in
[0607] The agonistic anti-NKG2D antibodies 5C5, 013, 230, 320 and 395, which showed good agonistic activity as IgGs, were chosen for functional assessment in the different bispecific antibody formats. In the antibody 395, comprising a rabbit VH-domain, an unpaired cysteine C50 in CDRH2 was replaced by a serine without affecting binding or function. Antibodies B9 (CDR and VH and VL sequences SEQ ID NOs 114-119, 120 and 121; see also WO 2007/071422 (SEQ ID NOs 27-29, 32-34, 22 and 26); incorporated herein by reference in its entirety) and huA5B7 (CDR and VH and VL sequences SEQ ID NOs 122-127, 128 and 129; see also EP application no. 19182505.8 and the PCT application claiming priority thereof, incorporated herein by reference in its entirety) used as exemplary anti-CEA antibodies for the second specificity.
TABLE-US-00013 TABLE 13 Overview of bispecific NKG2D CEA antibody formats. D K M clone format J format format I format L format format 5C5 B9 B9 B9 B9 013 B9 B9 B9 230 B9 320 B9 B9 B9 B9 B9 395 B9 B9
Production of Bi-Specific Antibodies
[0608] Bispecific antibodies were generated by transient transfection of HEK293 EBNA cells. Cells were centrifuged and, medium was replaced by pre-warmed CD CHO medium (Thermo Fisher, #10743029). Expression vectors were mixed in CD CHO medium, polyethylenimine (PEI; Polysciences, #23966-1) was added, the solution vortexed and incubated for 10 minutes at room temperature. Afterwards, cells (2 mio/ml) were mixed with the vector/PEI solution, transferred to a flask and incubated for 3 hours at 37 C. in a shaking incubator with a 5% CO.sub.2 atmosphere. After the incubation, Excell medium with supplements (80% of total volume) was added (Mammalian Cell Cultures for Biologics Manufacturing, Eds. W. Zhou and A. Kantardjieff, Springer Verlag 2014). One day after transfection, supplements (Feed, 12% of total volume) were added. Cell supernatants were harvested after 7 days by centrifugation and subsequent filtration (0.2 m filter), and proteins were purified from the harvested supernatant by standard methods as indicated below.
Purification and Analytics of Bi-Specific Antibodies
[0609] Proteins were purified from filtered cell culture supernatants referring to standard protocols. In brief, Fc containing proteins were purified from cell culture supernatants by Protein A-affinity chromatography (equilibration buffer: 20 mM sodium citrate, 20 mM sodium phosphate, pH 7.5; elution buffer: 20 mM sodium citrate, pH 3.0). Elution was achieved at pH 3.0 followed by immediate pH neutralization of the sample. The protein was concentrated by centrifugation (Millipore Amicon ULTRA-15, #UFC903096), and aggregated protein was separated from monomeric protein by size exclusion chromatography in 20 mM histidine, 140 mM sodium chloride, pH 6.0.
[0610] The concentrations of purified proteins were determined by measuring the absorption at 280 nm using the mass extinction coefficient calculated on the basis of the amino acid sequence according to Pace et al. (Protein Science, 4, 2411-2423 (1995). Purity and molecular weight of the proteins were analyzed by CE-SDS in the presence and absence of a reducing agent using a LabChipGXII (Perkin Elmer). Determination of the aggregate content was performed by HPLC chromatography at 25 C. using analytical size-exclusion column (TSKgel G3000 SW XL or UP-SW3000) equilibrated in running buffer (25 mM K.sub.2HPO.sub.4, 125 mM NaCl, 200 mM L-arginine monohydrocloride, pH 6.7 or 200 mM KH.sub.2PO.sub.4, 250 mM KCl pH 6.2, respectively).
Example 16. Comparison of Different Bispecific Antibody Formats with Different Agonistic Anti-NKG2D Antibodies
[0611] Selected anti-NKG2D antibodies with good agonistic activity (5C5, 013, 230 and 320) were converted into bispecific antibodies in the I format, using the anti-CEA antibody B9 as exemplary second specificity. The bispecific antibodies should induce activation of NKG2D on immune cells by crosslinking via CEA on tumor cells.
[0612] The bispecific antibodies were tested for their functional activity in combination with a suboptimal fixed concentration of a CEACD3 bispecific antibody (CEA-T cell bispecific antibody (TCB), SEQ ID NOs 130-137 (CD3 CDRs and VH/VL), 138-145 (CEA CDRs and VH/VL), and 154-157; to provide signal 1) in the Jurkat NFAT NKG2D reporter cell assay. In this assay, engagement of NKG2D in the presence of signal 1 delivered by CEA-TCB via CD3 activation led to an increased activation of NFAT. This activation resulted in an increase of luminescence upon addition of the luciferase substrate.
[0613] As shown in
[0614] Anti-NKG2D antibody 320 was chosen for further evaluation of different bispecific antibody formats. It was among the most potent ones in the tested I format and was therefore considered to be a good candidate for further evaluation of different bispecific formats. Four additional bispecific formats were designed with different valences for NKG2D and CEA, to be able to identify a format with ideal properties for agonizing NKG2D. The bispecific formats D, J, K and L were produced, again using the anti-CEA antibody B9 as exemplary second specificity, and their functional activity was tested in the Jurkat NFAT NKG2D reporter cell assay in combination with CEA-TCB. The activity of the new formats was compared to the previously tested I format and subsequently the format with the highest potency to induce NKG2D activation was selected. The formats D and L had the highest potency, similar to the activity of the previously tested I format. The format K and J had a much weaker activity compared to the other tested formats and were therefore not considered for further characterization (
[0615] Antibody 320 in the bispecific antibody formats D, J, K, L and I was further tested for binding to NK92 cells expressing NKG2D and LS180 cells expressing CEA, measured by flow cytometry.
[0616] On NK92 cells, the tetravalent construct J had the lowest EC50 values followed by the 320 IgG and the I format which bind similar and format K, L and D have the weakest binding (
[0617] In a next step, selected formats were tested for two additional potent agonistic anti-NKG2D antibodies, 5C5 and 013. Anti-NKG2D antibody 5C5 was converted into formats D, J and K and antibody 013 was converted into formats D and K. Functional activity was tested in the Jurkat NFAT NKG2D reporter cell assay in combination with CEA-TCB and compared to the activity of the respective I formats. As seen with antibody 320, also with antibody 5C5 (FIG. 16A) and antibody 013 (
[0618] An additional potent agonistic anti-NKG2D antibody, antibody 395, was then converted into the bispecific I format being the most potent bispecific format so far. In addition, an IgG like 1+1 format (M format) was generated with antibody 395. The functional activity of these constructs was tested in the Jurkat NFAT NKG2D reporter cell assay in combination with CEA-TCB and compared to the functional activity of the I format with antibody 320 which was one of the most potent ones tested so far. As seen in
[0619] Binding of the two bispecific formats I and M of the anti-NKG2D antibody 395 to NKG2D on NK92 (
[0620] To further characterize the bispecific M format with antibody 395 and the I format with antibody 320, both constructs were tested in the Jurkat NFAT NKG2D reporter cell assay on CEA high MKN-45 cells, CEA medium LS-180 cells and CEA low HT-29 cells. The I format with antibody 320 had good activity on CEA high MKN-45 cells and CEA medium LS-180 but only very weak activity on CEA low HT-29 cells (
[0621] Format M was subsequently chosen for further characterization as the agonistic anti-NKG2D antibody 395 in the M format had the highest potency compared to all other tested bispecific constructs. As a next step, binding of the bispecific format M to NKG2D expressed on CD8 T cells and NK cells was tested by flow cytometry using freshly isolated PBMCs from a healthy donor. As negative control, binding to NKG2D negative CD4 T cells was tested and the non-binding control was included in the experiment (untargeted IgG (VH and VL sequences of SEQ ID NOs 81 and 82) with L234A L235A P329G (PGLALA) mutation in Fc regionsee also above). As expected, the bispecific construct showed strong binding to CD8 T cells (
[0622] Functional activity of the selected bispecific antibody (antibody 395 in the M format) was then tested in a co-culture assay of CEA expressing tumor cells with freshly isolated PBMCs to assess activation of CD8 T cells upon NKG2D engagement in combination with a TCB. Upregulation of the early activation marker CD69 and the late activation marker CD25 was measured as a marker for CD8 T cell activation. NKG2DCEA bispecific antibody treatment in combination with a CD3CEA bispecific antibody (CEA-TCB (2), SEQ ID NOs 130-137 (CD3 CDRs and VH/VL), 146-153 (CEA CDRs and VH/VL), and 158-161) induced increased upregulation of CD25 and CD69 on CD8 T cells in the presence of the colorectal adenocarcinoma cell line LS-180 compared to treatment with CEA-TCB (2) alone (
Methods
Jurkat NFAT NKG2D Reporter Cell Assay
[0623] NKG2D-expressing Jurkat NFAT cells (Jurkat NFAT NKG2D) were generated by stable transfection of Jurkat NFAT Fluc cells (Promega). The cells were cultured in advanced RPMI 1640 (Gibco) medium containing 2% FBS, 1% GlutaMax (Gibco) and 200 g/ml hygromcyin. Jurkat NFAT NKG2D reporter cells were co-cultured with the tumor cell lines MKN45 (DSMZ ACC 409), LS180 (ATCC CL-187), HT-29 (ATCC HTB-38) or HeLa (ATCC CRM-CCL-2). The assay was performed in assay medium (advanced RPMI 1640 (Gibco) containing 2% FCS and 1% GlutaMax (Gibco)).
[0624] Tumor cells were detached using trypsin. The cells were counted and viability was checked. The target cells were re-suspended in assay medium and 60 000 cells were seeded per well in a white flat bottom 96 well plate. Then the T-cell bispecific antibody (TCB), the NKG2D bispecific antibodies were added at the indicated concentrations. Jurkat NFAT NKG2D reporter cells were counted, viability was checked and 0.1 mio cells were seeded per well, corresponding to an effector-to-target (E:T) ratio of 1.6:1. Also, 2% end-volume of GloSensor cAMP Reagent (E1291, Promega) was added to each well. After the indicated incubation time, luminescence was measured using a Tecan Spark 10M device.
Binding to NK92 and Tumor Cell Lines
[0625] Viability of NK92 cells or tumor cells (MKN-45, LS180) was checked and cells were re-suspended and adjusted to a density of 1 mio cells/ml. 100 l per well of this cell suspension (containing 0.1 mio cells) were seeded into a 96 well round bottom plate. The plate was centrifuged for 4 min at 400g and the supernatant was removed. Then 40 l of the diluted antibodies or FACS buffer were added to the cells and incubated for 30 min at 4 C. After the incubation the cells were washed twice with 150 l FACS buffer per well. Then 20 l of the diluted APC anti-human Fc specific secondary antibody (Jackson ImmunoResearch, #109-116-170), was added to the cells. The cells were incubated for an additional 30 min at 4 C. To remove unbound antibody, the cells were washed again twice with 150 l per well FACS buffer. To fix the cells, 100 l of FACS buffer containing 1% PFA were added to the wells. Before measuring, the cells were re-suspended in 150 l FACS buffer. The fluorescence was measured using a BD flow cytometer.
Binding to PBMCs
[0626] Viability of freshly isolated peripheral blood mononuclear cells (PBMCs) was checked and cells were adjusted to a density of 1 mio cells/ml in FACS buffer. 100 l per well of the PBMCs (containing 0.1 mio cells) were seeded into a 96 well round bottom plate. The plate was centrifuged for 4 min at 400g and the supernatant was removed. Then 0.5 l Fc Block (BD Bioscience) in 20 l total volume per well were added and the plate was incubated for 30 min at 4 C. Supernatant was removed and then 40 l of the diluted anti-NKG2D antibodies were added to the cells and incubated for additional 30 min at 4 C. After the incubation, the cells were washed twice with 150 l FACS buffer per well. Then 20 l of the diluted PE anti-human Fc specific secondary antibody (Jackson ImmunoResearch, #109-116-170) together with CD3 FITC (clone UCHT1, BioLegend), CD8 APC/Cy7 (Clone SK1, BioLegend), CD4 APC (clone RPA-T4, BioLegend) and CD56 BV421 (clone HCD56, BioLegend) was added to the cells to detect the anti-NKG2D antibodies and identify CD8 T cells as CD8 and CD3 double positive cells, CD4 T cells as CD4 and CD3 double positive cells, and NK cells as CD3 negative and CD56 positive cells within PBMCs. The cells were incubated for an additional 30 min at 4 C. To remove unbound antibody, the cells were washed again twice with 150 l per well FACS buffer. To fix the cells, 100 l of FACS buffer containing 1% PFA were added to the wells. Before measuring the cells were re-suspended in 150 l FACS buffer. The fluorescence was measured using a BD flow cytometer.
Activation of CD8 T Cells in Combination with T-Cell Bispecific Antibody (TCB)
[0627] PBMCs were isolated from blood of healthy donors and viability was checked before the start of the assay. Target cells (MKN-45 or LS180) were detached using Trypsin (Gibco) and viability was checked. The target cells were re-suspended in assay medium (advanced RPMI 1640 (Gibco) containing 2% FBS and 1% GlutaMax (Gibco)) at a density of 0.6 mio cells/ml. The cells were seeded into a 96 well plate at 30 000 cells/well. Antibodies were diluted in assay medium and the indicated concentrations of the diluted anti-NKG2D antibodies or the TCB were added to the target cells. Then the isolated PBMCs at a cell density of 6 mio cells/ml (E:T 10:1) were added, resulting in 300 000 cells/well and a final volume of 200 l per well. The assay was incubated for 48 h at 37 C. in the incubator. Afterwards PBMCs were harvested and analyzed by flow cytometry. The cells were centrifuged for 4 min at 400g and washed once with PBS. Aqua Live stain (L34957, Thermo Fisher Scientific) was added in 50 l PBS (diluted 1:1000 in PBS) and incubated for 20 min at room temperature. Afterwards 100 l FACS buffer was added and the plate was centrifuged for 4 min at 400g. Supernatant was removed and cells were washed again with 150 l FACS Buffer. Then 30 l per well of the antibody mix containing CD3 FITC (clone UCHT1, BioLegend), CD8 APC/Cy7 (clone SK1, BioLegend), CD56 BV421 (clone HCD56, BioLegend), CD25 PE (clone M-A251, BioLegend), CD69 APC (clone FN50, BioLegend) and CD44 AF700 (clone IM7, BioLegend) was added to the cells. The cells were incubated for 30 min in the fridge. Afterwards the cells were washed twice with FACS buffer and re-suspended in 100 l FACS buffer containing 1% PFA per well. Before the measurement, cells were resuspended in 150 l FACS buffer. The analysis was performed using a BD LSR Fortessa device.
Example 17. Determination of Affinities of Bispecific NKG2DCEA Antibodies in M Format Comprising Humanized Variants of Antibody 395 to Human NKG2D and Human CEA Using Surface Plasmon Resonance (BIACORE)
[0628] The affinities of the bispecific NKG2DCEA antibodies in M format comprising the humanized variants of antibody 395 were assessed by surface plasmon resonance using a BIACORE T200 instrument. On a CMS chip, an anti-penta-His capture antibody (Qiagen PentaHis Antibody, BSA-free; #34660) was immobilized by standard amine coupling on flow cells 2 and 3 at approximately 12000 RU. As respective ligands, his avi huNKG2D ECD (SEQ ID NO: 93) was captured on flow cell 2 and hu N(A2B2)A-avi-His (SEQ ID NO: 208), containing the A2 domain of human CEA, was captured on flow cell 3 at approximately 20 RU. The bispecific NKG2DCEA antibodies in M format comprising the humanized variants of antibody 395 were subsequently injected as analytes in 3-fold dilutions ranging from 800 to 0.366 nM for a contact time of 120 s, a dissociation time of 250 or 1000 s and at a flow rate of 30 l/min. Regeneration at the level of the anti-H6 tag capture antibody was achieved by 2 pulses of 10 mM glycine/HCl pH 2.0 for 60 s. Data were double-referenced against the unimmobilized flow cell 1 and a zero concentration of the analyte. The sensorgrams of the analytes were fitted to a simple 1:1 Langmuir interaction model. Affinity constants [K.sub.D] for both targets are summarized in Table 14.
TABLE-US-00014 TABLE 14 Affinity constants of bispecific NKG2D CEA antibodies in M format binding to human NKG2D and human CEA (A2 domain). These bispecific antibodies comprise different humanized VH-domain variants of agonistic anti-NKG2D antibody 395. affinity to hu affinity to hu NKG2D ECD N(A2B2)A humanized variant [M] [M] P1AE4972 1.05E08 3.34E09 (non-humanized comparator) P1AE4973 1.45E08 2.55E09 P1AE4975 1.86E08 3.66E09 P1AE4977 2.29E08 3.77E09 P1AE4978 3.74E08 3.84E09 P1AE4979 1.72E08 5.13E09 P1AE4980 1.26E08 3.45E09 P1AE4981 4.63E08 3.23E09
[0629] The bispecific NKG2DCEA antibodies comprising humanized VH-domain variants of agonistic anti-NKG2D antibody 395 are of slightly lower affinities than the construct with the non-humanized parental rabbit VH-domain (P1AE4972). However, P1AE4980 has a very comparable affinity to human NKG2D as P1AE4972 (13 nM vs. 11 nM). Affinities of these bispecific antibodies to human CEA (A2 domain) do not differ significantly as they all comprise the same CEA binder (huA5B7).
[0630] The humanized variant P1AE4980 (M format, in combination with CEA binder huA5B7) was chosen for further detailed functional characterization. Moreover, this bispecific molecule is thermally stable as determined by dynamic light scattering (DLS) (T.sub.agg 63 C.) and suited for cell-line development.
[0631] In order to further increase the potency of this preferred molecule P1AE4980 (M format, in combination with CEA binder huA5B7), the CEA binder huA5B7 was replaced by an affinity matured binder (see Example 19).
Example 18. Functional Characterization of Humanization Variants of Anti-NKG2D Antibody 395 in the Bispecific M Format
[0632] The parental (with the C50S mutation) and seven humanized variants of the agonistic anti-NKG2D antibody 395 were converted into NKG2DCEA bispecific antibodies in the M format, using CEA binder huA5B7 as second specificity. Binding of the humanized variants in the bispecific format to NKG2D on NK92 was compared to the binding of the parental antibody 395 (P1AE4972, including the C50S mutation). The variant P1AE4980 showed comparable binding to NKG2D as the parental antibody, binding of variants P1AE4973, P1AE4975, P1AE4977 and P1AE4979 was slightly reduced, binding of variant P1AE4978 was stronger reduced and variant P1AE4981 bound only weakly to NKG2D (
TABLE-US-00015 TABLE 15 EC50 values of binding of humanized variants of anti-NKG2D antibody 395 in bispecific M format to NK92 cells. 95% Humanization confidence variant EC50 (nM) interval P1AE4972 8.471 7.768 to 9.256 P1AE4973 17.59 14.73 to 21.54 P1AE4975 14.92 13.28 to 16.88 P1AE4977 19.61 17.45 to 22.24 P1AE4978 35.52 27.02 to 50.19 P1AE4979 13.14 11.78 to 14.71 P1AE4980 7.376 6.208 to 8.783 P1AE4981 68.25 62.51 to 75.51
[0633] Furthermore, the functional activity of the seven humanization variants was tested in the Jurkat NFAT NKG2D reporter cell assay in combination with CEA-TCB and compared to the functional activity of the parental antibody 395 (with the C50S mutation) on the CEA high expressing tumor cell line MKN-45 (
[0634] The humanized variant P1AE4980 was then selected for further characterization because it showed good binding to NKG2D and had the highest functional activity among the humanized variants and was comparable in activity to the parental antibody 395.
[0635] In a next step we tested if the boosting of CEA-TCB activity via NKG2D engagement is dependent on crosslinking of NKG2D via CEA expressed on tumor cells. The combination of a FolR1CD3 bispecific antibody (FolR1-TCB) with CEA-TCB was tested on CEA-negative, FolR1-positive HeLa cells in the Jurkat NFAT NKG2D reporter cell assay. In this setup signal 1 can be delivered via FolR1-TCB but the NKG2DCEA bispecific antibody cannot be crosslinked due to missing CEA expression on HeLa cells. FolR1-TCB was able to activate the Jurkat NFAT NKG2D reporter cell assay but the activation could not be enhanced by addition of NKG2DCEA bispecific antibody (
[0636] Then the functional activity of the NKG2DCEA bispecific antibody was tested in the presence of shed CEA (sCEA). The combination of NKG2DCEA bispecific antibody with CEA-TCB on MKN-45 was tested in the Jurkat NFAT NKG2D reporter cell assay in the presence of increasing concentrations of sCEA.
[0637] Only at high concentrations (>5 g/ml) sCEA had a negative impact on the activity of the NKG2DCEA bispecific antibody (
[0638] In a next step it was also tested if the presence of soluble NKG2D ligands can interfere with the activity of the NKG2DCEA bispecific antibody in combination with CEA-TCB. Soluble MICA (sMICA; R&D Systems, #1300-MA-050) and soluble ULBP2 (sULBP2; R&D Systems, #1298-UL-050) were added to the combination of NKG2DCEA bispecific antibody with CEA-TCB and activation of Jurkat NFAT NKG2D cells was tested and compared to the activation in the absence of soluble NKG2D ligands.
[0639] The addition of nM of either soluble MICA or soluble ULBP2 did not change the activity of the NKG2DCEA bispecific antibody in combination with CEA-TCB in the Jurkat NFAT NKG2D reporter cell assay (
Example 19. Generation of NKG2DCEA Bispecific Antibodies Using Affinity Matured Variants of Antibody huA5B7
[0640] CEA binder huA5B7 is a humanized version of antibody A5B7. Antibody A5B7 is for example disclosed by M. J. Banfield et al, Proteins 1997, 29(2), 161-171 and its structure can be found as PDB ID:1CLO in the Protein structural database PDB (www.rcsb.org, H. M. Berman et al, The Protein Data Bank, Nucleic Acids Research, 2000, 28, 235-242). The CDR and variable region sequences of A5B7 are given in SEQ ID NOs 122 (HCDR1), 162 (HCDR2), 124 (HCDR3), 125 (LCDR1), 126 (LCDR2), 127 (LCDR3), 163 (VH) and 164 (VL). The generation of huA5B7 is described in EP application no. 19182505.8 and the PCT application claiming priority thereof. The CDR and variable region sequences of huA5B7 are given in SEQ ID NOs 122 (HCDR1), 123 (HCDR2), 124 (HCDR3), 125 (LCDR1), 126 (LCDR2), 127 (LCDR3), 128 (VH) and 129 (VL).
[0641] In order to further increase the potency of the preferred molecule P1AE4980 (see Example 17 above), the CEA binder huA5B7 was replaced by affinity matured variants thereof. Affinity maturation of huA5B7 is described in EP application no. 19182505.8 and the PCT application claiming priority thereof.
[0642] The CDR and variable region sequences of selected affinity matured variants of huA5B7 are given in the sequence listing and the corresponding SEQ ID NOs are summarized in Table 16 below.
TABLE-US-00016 TABLE 16 CDR and variable region sequences (SEQ ID NOs) of affinity matured variants of antibody huA5B7. Binder HCDR1 HCDR2 HCDR3 LCDR1 LCDR2 LCDR3 VH VL huA5B7 122 123 124 125 126 127 128 129 P006.038 122 123 172 125 126 180 184 185 P005.097 122 123 173 125 126 181 186 187 P005.103 122 123 174 125 126 182 188 189 P002.139 166 169 124 178 126 127 190 191 P001.177 122 170 124 125 126 127 192 193 P005.102 122 123 175 125 126 183 194 195 P005.102- 122 169 175 125 126 183 196 197 combo1 P005.102- 122 169 175 125 126 183 198 199 combo2 P005.103- 122 123 176 125 126 182 200 201 combo1 P005.103- 122 169 176 125 126 182 202 203 combo2 P006.038- 166 169 172 125 126 180 204 205 combo1 P006.038- 167 170 172 125 126 180 206 207 combo2
[0643] The variable domains of all affinity matured variants were synthesized and cloned into plasmids coding for an IgG-like NKG2DCEA bispecific antibody based on the knob-into-hole and the CrossMab technology (for correct heavy/heavy and heavy/light chain pairing, respectively) in combination with the PGLALA Fc domain mutations. A schematic illustration of the bispecific molecules prepared in this example is shown in
[0644] The constructs were prepared using conventional (non-PCR based) cloning techniques and expressed in transiently transfected suspension-adapted CHO K1 cells, grown in animal-component free and serum-free media. Proteins were purified from filtered cell culture supernatants referring to standard protocols. In brief, Fc containing proteins were purified from cell culture supernatants by affinity chromatography using Protein A. Elution was achieved at pH 3.0 followed by immediate neutralization of the sample. The protein was concentrated, and aggregated protein was separated from monomeric protein by size exclusion chromatography in 20 mM histidine, 140 mM sodium chloride, pH 6.0.
Example 20. Characterization of Bispecific CEANKG2D Antibodies Comprising Affinity Matured CEA Binders
[0645] The two affinity matured CEA binders P002.139 and P001.177 were converted into bispecific molecules as described in Example 19 above. Binding of these two molecules to the medium CEA expressing LS180 tumor cells was compared to binding of the corresponding molecule containing the parental humanized A5B7 CEA binder (huA5B7). Binding of the molecules to tumor cells was analyzed by flow cytometry (
[0646] In a next step, the functional activity of these three bispecific NKG2DCEA antibodies was determined in the Jurkat NFAT NKG2D reporter cell assay on MKN45 cells (
[0647] The experiments were performed as described in Example 16 above. For the Jurkat NFAT NKG2D reporter cell assay, in some instances 384 well plates were used, as follows. 10 000 target cells were seeded in a white flat bottom 384 well plate. Then the TCB and the bispecific NKG2DCEA antibodies were added at the indicated concentrations and 15 000 Jurkat NFAT NKG2D reporter cells were added corresponding to an E:T ratio of 1.5:1.
Example 21. Cloning, Production, and Purification of Anti-NKG2D (Bispecific) Antibodies Using NKG2D Binders C26 and ADI27743
[0648] The variable domains of the anti-NKG2D antibodies C26 and ADI27743 (WO 2018/148445) were synthesized and cloned into plasmids coding for human IgG1 or bispecific molecules in the M format (
[0649] Resulting constructs were prepared by Evitria (Switzerland) using their proprietary vector system with conventional (non-PCR based) cloning techniques and suspension-adapted CHO K1 cells (originally received from ATCC and adapted to serum-free growth in suspension culture at Evitria). For the production, Evitria's proprietary, animal-component free and serum-free media (eviGrow and eviMake2) and its proprietary transfection reagent (eviFect) were used.
[0650] Proteins were purified from filtered cell culture supernatants according to standard protocols. In brief, Fc containing proteins were purified from cell culture supernatants by affinity chromatography using Protein A. Elution was achieved at pH 3.0, followed by immediate neutralization of the sample. The protein was concentrated and aggregated protein was separated from monomeric protein by size exclusion chromatography in 20 mM histidine, 140 mM sodium chloride, pH 6.0.
Example 22. Comparison of Anti-NKG2D Antibody P1AE4980 to C26 and ADI27743
Binding to NKG2D on NK92 Cell Line
[0651] The anti-NKG2D antibodies P1AE4980, C26 and ADI27743 from Example 21 were tested for binding to NKG2D on NK92 cells.
[0652] NK92 cells were cultured in advanced RPMI 1640 medium (Gibco) containing 2% FBS, 1% GlutaMax (Gibco) and 10 ng/ml Proleukin (Novartis). Viability of NK92 cells was checked and cells were re-suspended and adjusted to a density of 1.5 mio cells/ml. 100 l of this cell suspension (containing 0.15 mio cells) were seeded into a 96 well round bottom plate. The plate was centrifuged for 4 min at 400g and the supernatant was removed. Then 40 l of the diluted antibodies or FACS buffer were added to the cells and incubated for 30 min at 4 C. After the incubation the cells were washed twice with 150 l FACS buffer per well. Then 30 l of the diluted secondary PE anti-human Fc specific secondary antibody (Jackson ImmunoResearch, #109-116-170) was added to the cells. The cells were incubated for an additional 30 min at 4 C. To remove unbound antibody the cells were washed again twice with 150 l per well FACS buffer. For the measurement, the cells were re-suspended in 150 l FACS buffer. The fluorescence was measured using a BD flow cytometer.
[0653] As shown in
[0654] The binding was also tested for the corresponding bispecific NKG2DCEA antibodies from Example 21.
[0655] As seen with the IgGs, the bispecific antibody comprising P1AE4980 as NKG2D binder shows highest overall binding to NK92 cells compared to the bispecific antibodies comprising either C26 or ADI27743 (
Test of Functional Activity in the Jurkat NFAT NKG2D Reporter Cell Assay
[0656] The bispecific CEANKG2D antibodies comprising either C26, ADI27743 or P1AE4980 as NKG2D binders were tested in the Jurkat NFAT NKG2D reporter cell assay in combination with 5 nM CEA-TCB, with the tumor cell lines MKN45 (DSMZ ACC 409) and HT-29 (ATCC HTB-38), as described in Example 16 above.
[0657] The Jurkat NFAT NKG2D reporter cell assay in presence of MKN45 (
Example 23. Comparison of Anti-NKG2D Antibodies Comprising Wild-Type or Effector-Silent Fc Domains
[0658] Activation of NK cells by anti-NKG2D antibodies with either wild-type or effector-silent Fc domains was assessed. For this assay, antibody P1AE4980 or 395 was used in (monospecific) human IgG.sub.1 format.
[0659] PBMCs were freshly isolated from whole blood. Isolated PBMCs were counted and viability was checked. The cells were re-suspended in RPMI+10% FBS+1% Glutamax at a density of 3 mio cells/ml. 100 l of the cell suspension was seeded per well in a 96-well U-bottom plate (resulting in 300 000 cells/well). 50 l of the diluted anti-NKG2D antibodies were added to each well, resulting in a total of 150 l/well.
[0660] The plate was incubated for 24 hours at 37 C. in the incubator and then centrifuged for 2 min at 350g. PBMCs were harvested and seeded in another 96 well U bottom plate for analysis by flow cytometry. The cells were centrifuged for 4 min at 400g and washed once with PBS. 50 l of diluted Aqua Live/Dead stain (diluted 1:1000 in PBS, Invitrogen, #L34965) was added to each well and incubated for 30 min at 4 C. Afterwards, 150 l FACS buffer (1PBS, 2% FBS, 1% 0.5 M EDTA pH 8, 0.25% NaN.sub.3 (20%)) was added and the plate was centrifuged for 4 min at 400g. Supernatant was removed and cells were washed again with 150 l FACS buffer. Then, 30 l per well of the antibody mix of FITC anti-human CD3 (BioLegend, #300406), Brilliant Violet 421TM anti-human CD56 (BioLegend, #318328), APC anti-human CD69 (BioLegend, #310910) was added to the cells. The cells were incubated for 60 min at 4 C. Afterwards, the cells were washed twice with FACS buffer and re-suspended in 100 l FACS buffer containing 1% PFA per well for fixing the cells. The plate was incubated overnight at 4 C. Before the FACS measurement the next day, the cells were resuspended in 150 l FACS buffer. The analysis was performed using BD LSR Fortessa device.
[0661] As shown in
[0662] Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity of understanding, the descriptions and examples should not be construed as limiting the scope of the invention. The disclosures of all patent and scientific literature cited herein are expressly incorporated in their entirety by reference.